F434435

General Info

Members Datasets Scaffolds Average Seq Length
399 244 350 199

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0047836|Ga0500604_0047836_27_728
Length 233
Sequence MCNDYRLEVEIASILEDFDDLEINIETPEGLPNVEARSDIRMTDVAPIVKGIDGKRGAGELVNRRWSWPGQNRKPVYNFRSEGREFASHRCLIIADGFYEFTDPEVPRPKDKRLDKWLFTMKDHTWFCIAGIWREHPDVGEAFTMLTMDAGDDIAPYHHRQIIPLSRDQWTDWLDPAVPASEVLQYLPKGGLPAVRVYPAPDTDQQPTLALWSHESGLALDERRDSSEHKENN

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
5 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
6 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
7 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
8 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
9 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
10 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
11 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
12 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
13 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
14 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
15 2791355263 Rhizobium chutanense C5 Isolate Nodule
16 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
17 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
18 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
19 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
20 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
21 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
22 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
23 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
24 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
25 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
26 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
27 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
28 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
29 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
30 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
31 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
32 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
33 2936381700 Rhizobium chutanense C16 Isolate Unclassified
34 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
35 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
36 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
37 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
38 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
105 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
231 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
236 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
237 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
238 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
239 8005395548 Rhizobium sp. R339 Isolate Nodule
240 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
241 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
242 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
243 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
244 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.07
Nodule 10.03
Rhizoplane 3.76
Rhizosphere 45.86
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10015794 3300002244 Bacteria 1271
2 JGI25158J39367_1000001 3300002739 Bacteria 92617
3 JGI25152J39213_1000020 3300002773 Bacteria 107721
4 JGI25159J45721_1000130 3300002987 Bacteria 36138
5 JGI25165J46597_1000010 3300003214 Bacteria 442113
6 JGI25153J46596_10000174 3300003215 Bacteria 63885
7 rootH2_10040694 3300003320 Bacteria 11228
8 JGI25161J50226_1000101 3300003374 Bacteria 69891
9 Ga0055532_1003645 3300003758 Bacteria 2547
10 Ga0055526_1000969 3300003771 Bacteria 21195
11 Ga0055536_1002032 3300003781 Bacteria 11593
12 Ga0055530_10000020 3300003791 Bacteria 139957
13 Ga0055530_10002751 3300003791 Bacteria 10881
14 Ga0055530_10003172 3300003791 Bacteria 9654
15 Ga0055540_1000185 3300003792 Bacteria 60356
16 Ga0055540_1020385 3300003792 Bacteria 1753
17 Ga0055531_10000088 3300003794 Bacteria 100973
18 Ga0055531_10000364 3300003794 Bacteria 43647
19 Ga0055531_10008607 3300003794 Bacteria 5349
20 JGI25405J52794_10055597 3300003911 Bacteria 852
21 Ga0055543_1000186 3300004625 Bacteria 50563
22 Ga0065165_1000213 3300005262 Bacteria 100746
23 Ga0065165_1000291 3300005262 Bacteria 85135
24 Ga0070658_10006674 3300005327 Bacteria 9353
25 Ga0070658_10453983 3300005327 Bacteria 1104
26 Ga0070658_10904435 3300005327 Bacteria 767
27 Ga0070670_100230708 3300005331 Bacteria 1611
28 Ga0070660_100418403 3300005339 Bacteria 1109
29 Ga0070661_100021534 3300005344 Bacteria 4607
30 Ga0070661_100138236 3300005344 Bacteria 1834
31 Ga0070661_100418831 3300005344 Bacteria 1061
32 Ga0070692_10388286 3300005345 Bacteria 878
33 Ga0070668_100001223 3300005347 Bacteria 18252
34 Ga0070671_100000065 3300005355 Bacteria 71901
35 Ga0070659_100672817 3300005366 Bacteria 893
36 Ga0070659_100707715 3300005366 Bacteria 871
37 Ga0070710_10618093 3300005437 Unclassified 756
38 Ga0070711_100441173 3300005439 Bacteria 1064
39 Ga0070662_100275259 3300005457 Bacteria 1360
40 Ga0070681_10178149 3300005458 Bacteria 2047
41 Ga0068867_100014074 3300005459 Bacteria 5667
42 Ga0068867_100058683 3300005459 Bacteria 2852
43 Ga0070679_100728490 3300005530 Bacteria 934
44 Ga0068853_100144482 3300005539 Bacteria 2137
45 Ga0068853_100392043 3300005539 Bacteria 1298
46 Ga0070665_100000164 3300005548 Bacteria 120601
47 Ga0070665_100141709 3300005548 Bacteria 2407
48 Ga0070664_100025889 3300005564 Bacteria 4864
49 Ga0070664_100159955 3300005564 Bacteria 1992
50 Ga0068857_100140067 3300005577 Bacteria 2186
51 Ga0068857_100159054 3300005577 Bacteria 2049
52 Ga0068857_101056126 3300005577 Unclassified 783
53 Ga0068854_100033051 3300005578 Bacteria 3604
54 Ga0068856_100000710 3300005614 Bacteria 36130
55 Ga0068856_100180239 3300005614 Bacteria 2125
56 Ga0068852_100008653 3300005616 Bacteria 7522
57 Ga0068852_100262632 3300005616 Bacteria 1658
58 Ga0068852_100678424 3300005616 Bacteria 1039
59 Ga0068861_100014503 3300005719 Bacteria 5532
60 Ga0068851_10010570 3300005834 Bacteria 4310
61 Ga0068851_10035839 3300005834 Bacteria 2482
62 Ga0068863_100004297 3300005841 Bacteria 14032
63 Ga0068863_100005078 3300005841 Bacteria 12979
64 Ga0068860_100033472 3300005843 Bacteria 4930
65 Ga0081455_10000190 3300005937 Bacteria 78474
66 Ga0081455_10003117 3300005937 Bacteria 19304
67 Ga0081455_10181636 3300005937 Bacteria 1592
68 Ga0075365_10002206 3300006038 Bacteria 9396
69 Ga0075365_10019740 3300006038 Unclassified 4167
70 Ga0075368_10000011 3300006042 Bacteria 44307
71 Ga0075368_10000048 3300006042 Bacteria 28872
72 Ga0075368_10000127 3300006042 Bacteria 20168
73 Ga0075368_10146774 3300006042 Bacteria 984
74 Ga0075363_100000043 3300006048 Bacteria 24265
75 Ga0075364_10000007 3300006051 Bacteria 73806
76 Ga0075364_10025846 3300006051 Bacteria 3741
77 Ga0075362_10000027 3300006177 Bacteria 58346
78 Ga0075362_10178259 3300006177 Bacteria 1029
79 Ga0075367_10000010 3300006178 Bacteria 43233
80 Ga0075367_10002712 3300006178 Bacteria 8174
81 Ga0075367_10071474 3300006178 Bacteria 2087
82 Ga0075369_10000412 3300006186 Bacteria 12944
83 Ga0075369_10001464 3300006186 Bacteria 8052
84 Ga0075366_10004650 3300006195 Bacteria 7376
85 Ga0075366_10008534 3300006195 Bacteria 5700
86 Ga0075366_10028817 3300006195 Bacteria 3260
87 Ga0075370_10000024 3300006353 Bacteria 52434
88 Ga0075370_10004208 3300006353 Bacteria 6950
89 Ga0075370_10005338 3300006353 Bacteria 6373
90 Ga0075370_10058233 3300006353 Bacteria 2197
91 Ga0105240_10000005 3300009093 Bacteria 702630
92 Ga0105243_10000055 3300009148 Bacteria 136180
93 Ga0105243_10439916 3300009148 Bacteria 1221
94 Ga0105241_10530380 3300009174 Bacteria 1054
95 Ga0105248_10002650 3300009177 Bacteria 19866
96 Ga0105238_10413254 3300009551 Bacteria 1343
97 Ga0105238_10852616 3300009551 Bacteria 928
98 Ga0105148_100201 3300009978 Bacteria 8734
99 Ga0105239_10006414 3300010375 Bacteria 13654
100 Ga0105239_10458080 3300010375 Bacteria 1447
101 Ga0105239_10542628 3300010375 Bacteria 1324
102 Ga0157373_10191731 3300013100 Bacteria 1440
103 Ga0157371_10099413 3300013102 Bacteria 2063
104 Ga0157371_10401844 3300013102 Bacteria 1003
105 Ga0157370_10000034 3300013104 Bacteria 137749
106 Ga0157370_10000654 3300013104 Bacteria 43161
107 Ga0157370_10003278 3300013104 Bacteria 19076
108 Ga0157369_10068212 3300013105 Bacteria 3821
109 Ga0157369_10172400 3300013105 Bacteria 2279
110 Ga0157374_10107142 3300013296 Bacteria 2686
111 Ga0163162_10000230 3300013306 Bacteria 51221
112 Ga0157372_10848239 3300013307 Bacteria 1061
113 Ga0182008_10183941 3300014497 Bacteria 1058
114 Ga0214542_1026166 3300021321 Bacteria 2900
115 Ga0214543_1004720 3300021327 Bacteria 25639
116 Ga0213876_10361961 3300021384 Bacteria 772
117 Ga0213875_10022344 3300021388 Bacteria 3027
118 Ga0228710_1026327 3300022740 Bacteria 3619
119 Ga0209436_100010 3300025208 Bacteria 139804
120 Ga0209147_100438 3300025229 Bacteria 26646
121 Ga0207425_1012990 3300025245 Bacteria 1935
122 Ga0209129_1000155 3300025258 Bacteria 108020
123 Ga0209233_1000044 3300025261 Bacteria 489783
124 Ga0209130_1000101 3300025284 Bacteria 139814
125 Ga0209676_1000288 3300025292 Bacteria 103217
126 Ga0209676_1000842 3300025292 Bacteria 39670
127 Ga0209025_1000062 3300025294 Bacteria 304236
128 Ga0209025_1105425 3300025294 Bacteria 880
129 Ga0209758_1000178 3300025297 Bacteria 142096
130 Ga0209758_1008353 3300025297 Bacteria 6735
131 Ga0209050_1000001 3300025298 Bacteria 3563507
132 Ga0209050_1000186 3300025298 Bacteria 139998
133 Ga0209050_1001679 3300025298 Bacteria 22239
134 Ga0209256_1000324 3300025299 Bacteria 81729
135 Ga0207426_1000205 3300025302 Bacteria 141339
136 Ga0207426_1000222 3300025302 Bacteria 134756
137 Ga0209051_1000129 3300025303 Bacteria 141968
138 Ga0209051_1000209 3300025303 Bacteria 102832
139 Ga0209051_1000982 3300025303 Bacteria 27634
140 Ga0209257_1000111 3300025304 Bacteria 234809
141 Ga0209257_1000211 3300025304 Bacteria 139998
142 Ga0209257_1004224 3300025304 Bacteria 11375
143 Ga0207697_10026762 3300025315 Bacteria 2359
144 Ga0207656_10019397 3300025321 Bacteria 2690
145 Ga0207656_10182262 3300025321 Bacteria 1008
146 Ga0207647_10043557 3300025904 Bacteria 2808
147 Ga0207647_10083317 3300025904 Bacteria 1915
148 Ga0207645_10009350 3300025907 Bacteria 6786
149 Ga0207705_10005983 3300025909 Bacteria 9052
150 Ga0207705_10010170 3300025909 Bacteria 6846
151 Ga0207705_10495941 3300025909 Bacteria 948
152 Ga0207695_10000011 3300025913 Bacteria 910221
153 Ga0207671_10587035 3300025914 Bacteria 888
154 Ga0207663_10486929 3300025916 Bacteria 956
155 Ga0207649_10044676 3300025920 Bacteria 2713
156 Ga0207652_10794990 3300025921 Bacteria 840
157 Ga0207700_10585040 3300025928 Bacteria 993
158 Ga0207644_10000045 3300025931 Bacteria 105495
159 Ga0207690_10079553 3300025932 Bacteria 2285
160 Ga0207706_10019701 3300025933 Bacteria 6069
161 Ga0207706_10196830 3300025933 Bacteria 1768
162 Ga0207706_10298654 3300025933 Bacteria 1403
163 Ga0207709_10000098 3300025935 Bacteria 136213
164 Ga0207711_10005813 3300025941 Bacteria 10422
165 Ga0207679_10583038 3300025945 Bacteria 1006
166 Ga0207679_10756112 3300025945 Unclassified 884
167 Ga0207667_10382347 3300025949 Bacteria 1434
168 Ga0207668_10026513 3300025972 Bacteria 3763
169 Ga0207640_10004029 3300025981 Bacteria 7938
170 Ga0207640_10446161 3300025981 Bacteria 1065
171 Ga0207640_10478769 3300025981 Bacteria 1032
172 Ga0207640_11099714 3300025981 Bacteria 703
173 Ga0207658_10206119 3300025986 Bacteria 1645
174 Ga0207639_10119996 3300026041 Bacteria 2159
175 Ga0207678_10007454 3300026067 Bacteria 9687
176 Ga0207678_10016129 3300026067 Bacteria 6560
177 Ga0207702_10009551 3300026078 Bacteria 8142
178 Ga0207702_10010066 3300026078 Bacteria 7926
179 Ga0207702_10500821 3300026078 Bacteria 1184
180 Ga0207641_10003542 3300026088 Bacteria 13815
181 Ga0207641_10125928 3300026088 Bacteria 2293
182 Ga0207648_10002863 3300026089 Bacteria 18260
183 Ga0207648_10079106 3300026089 Bacteria 2868
184 Ga0207674_10090374 3300026116 Bacteria 3053
185 Ga0207674_10299750 3300026116 Bacteria 1556
186 Ga0207675_100025204 3300026118 Bacteria 5535
187 Ga0207698_10008870 3300026142 Bacteria 6376
188 Ga0207698_10157416 3300026142 Bacteria 1981
189 Ga0209813_10000143 3300027866 Bacteria 24903
190 Ga0209813_10000565 3300027866 Bacteria 8667
191 Ga0268266_10000092 3300028379 Bacteria 192109
192 Ga0268266_10055802 3300028379 Bacteria 3397
193 Ga0268264_10006595 3300028381 Bacteria 9762
194 Ga0265332_10072984 3300031238 Bacteria 1461
195 Ga0265340_10200851 3300031247 Bacteria 897
196 Ga0307408_100000496 3300031548 Bacteria 34230
197 Ga0307408_100590030 3300031548 Bacteria 986
198 Ga0307405_10001491 3300031731 Bacteria 9899
199 Ga0307405_10001981 3300031731 Bacteria 8859
200 Ga0307405_10040641 3300031731 Bacteria 2818
201 Ga0307410_10003306 3300031852 Bacteria 8057
202 Ga0307406_10034491 3300031901 Bacteria 3104
203 Ga0307406_10043805 3300031901 Bacteria 2801
204 Ga0307407_10018233 3300031903 Bacteria 3545
205 Ga0307412_10000467 3300031911 Bacteria 24202
206 Ga0307412_10132705 3300031911 Bacteria 1811
207 Ga0307412_10133386 3300031911 Bacteria 1808
208 Ga0307409_100050503 3300031995 Bacteria 3176
209 Ga0307409_100171431 3300031995 Bacteria 1910
210 Ga0307414_10014331 3300032004 Bacteria 4750
211 Ga0307414_10030312 3300032004 Bacteria 3532
212 Ga0307414_10079081 3300032004 Bacteria 2399
213 Ga0307411_10251842 3300032005 Bacteria 1389
214 Ga0307411_10285603 3300032005 Bacteria 1315
215 Ga0307415_100048209 3300032126 Bacteria 2873
216 Ga0373931_0122095 3300035691 Unclassified 1490
217 Ga0395899_0025987 3300037312 Bacteria 4418
218 Ga0395900_0023213 3300037418 Bacteria 6350
219 Ga0395900_0132071 3300037418 Bacteria 2558
220 Ga0395900_0233769 3300037418 Bacteria 1847
221 Ga0395900_0351960 3300037418 Bacteria 1446
222 Ga0395900_0568120 3300037418 Bacteria 1077
223 Ga0395898_0008733 3300037466 Bacteria 10689
224 Ga0395905_0000321 3300037471 Bacteria 69144
225 Ga0395905_0043182 3300037471 Bacteria 4229
226 Ga0395905_0062185 3300037471 Bacteria 3492
227 Ga0395905_0107598 3300037471 Bacteria 2618
228 Ga0395905_0249774 3300037471 Bacteria 1657
229 Ga0436364_0518085 3300037853 Bacteria 102110
230 Ga0436364_1544924 3300037853 Bacteria 2359
231 Ga0395901_0016081 3300038443 Bacteria 7622
232 Ga0395901_0035199 3300038443 Bacteria 5174
233 Ga0395901_0050990 3300038443 Bacteria 4301
234 Ga0237819_00364 3300038705 Bacteria 16129
235 Ga0436365_1375549 3300039437 Bacteria 5187
236 Ga0436360_1007777 3300039438 Bacteria 1254
237 Ga0436363_0795217 3300039450 Bacteria 800
238 Ga0466961_0109596 3300044693 Bacteria 1738
239 Ga0495584_0125713 3300046491 Bacteria 1299
240 Ga0495583_0000032 3300046506 Bacteria 247728
241 Ga0495663_0000126 3300046525 Bacteria 31907
242 Ga0495654_0006492 3300046530 Bacteria 6641
243 Ga0495669_0024479 3300046684 Bacteria 2629
244 Ga0495670_0000008 3300046691 Bacteria 219555
245 Ga0495671_0000004 3300046692 Bacteria 545630
246 Ga0495673_0000021 3300047469 Bacteria 545523
247 Ga0495681_0107217 3300047470 Bacteria 1214
248 Ga0495686_0000601 3300047472 Bacteria 50079
249 Ga0495686_0000764 3300047472 Bacteria 42431
250 Ga0496100_0004696 3300048903 Bacteria 7280
251 Ga0496101_0010160 3300048904 Bacteria 6210
252 Ga0496102_0000117 3300048905 Bacteria 114037
253 Ga0496103_0000076 3300048906 Bacteria 113209
254 Ga0496104_0000046 3300048907 Bacteria 149482
255 Ga0496104_0024576 3300048907 Bacteria 5543
256 Ga0496105_0000026 3300048908 Bacteria 149665
257 Ga0496105_0010311 3300048908 Bacteria 7345
258 Ga0496106_0000176 3300048909 Bacteria 45812
259 Ga0496106_0000214 3300048909 Bacteria 40262
260 Ga0496107_0000051 3300048910 Bacteria 62937
261 Ga0496112_0044116 3300048915 Bacteria 4368
262 Ga0496113_0026240 3300048916 Bacteria 4163
263 Ga0496115_0012379 3300048918 Bacteria 6417
264 Ga0496116_0000189 3300048919 Bacteria 122859
265 Ga0496116_0002618 3300048919 Bacteria 18691
266 Ga0496116_0103530 3300048919 Bacteria 1693
267 Ga0496116_0148241 3300048919 Bacteria 1308
268 Ga0496117_0000201 3300048920 Bacteria 117679
269 Ga0496117_0001502 3300048920 Bacteria 33405
270 Ga0496117_0032242 3300048920 Bacteria 3984
271 Ga0496117_0086355 3300048920 Bacteria 2039
272 Ga0496117_0347351 3300048920 Bacteria 767
273 Ga0496118_0000097 3300048921 Bacteria 160837
274 Ga0496118_0007490 3300048921 Bacteria 11551
275 Ga0496118_0103617 3300048921 Bacteria 1913
276 Ga0496119_0000074 3300048922 Bacteria 150755
277 Ga0496119_0008696 3300048922 Bacteria 8873
278 Ga0496119_0066702 3300048922 Bacteria 2125
279 Ga0496119_0301325 3300048922 Bacteria 790
280 Ga0496120_0000667 3300048923 Bacteria 50432
281 Ga0496120_0069498 3300048923 Bacteria 1939
282 Ga0496120_0152522 3300048923 Bacteria 1160
283 Ga0496121_0001568 3300048924 Bacteria 38102
284 Ga0496121_0005280 3300048924 Bacteria 16649
285 Ga0496122_0000083 3300048925 Bacteria 208744
286 Ga0496122_0002368 3300048925 Bacteria 27001
287 Ga0496123_0000356 3300048926 Bacteria 85832
288 Ga0496123_0002833 3300048926 Bacteria 20507
289 Ga0496123_0132481 3300048926 Bacteria 1378
290 Ga0496124_0000011 3300048927 Bacteria 524145
291 Ga0496124_0000202 3300048927 Bacteria 117650
292 Ga0496124_0022322 3300048927 Bacteria 5803
293 Ga0496124_0085854 3300048927 Bacteria 2578
294 Ga0496124_0226175 3300048927 Bacteria 1402
295 Ga0496125_0000765 3300048928 Bacteria 52600
296 Ga0496125_0004343 3300048928 Bacteria 16448
297 Ga0496125_0147246 3300048928 Bacteria 1625
298 Ga0496126_0000051 3300048929 Bacteria 313169
299 Ga0496126_0003108 3300048929 Bacteria 21433
300 Ga0496126_0005032 3300048929 Bacteria 15370
301 Ga0496126_0011668 3300048929 Bacteria 9065
302 Ga0496126_0018501 3300048929 Bacteria 6899
303 Ga0496126_0039854 3300048929 Bacteria 4356
304 Ga0496126_0110854 3300048929 Bacteria 2390
305 Ga0495678_021120 3300049459 Bacteria 2872
306 Ga0501033_0135452 3300049570 Bacteria 1782
307 Ga0501034_0028195 3300049571 Bacteria 5713
308 Ga0501034_0103118 3300049571 Bacteria 2846
309 Ga0501034_0296407 3300049571 Bacteria 1554
310 Ga0501043_0017816 3300049579 Bacteria 5568
311 Ga0501043_0447293 3300049579 Bacteria 971
312 Ga0501043_0744814 3300049579 Bacteria 713
313 Ga0501047_0001078 3300049581 Bacteria 27187
314 Ga0501035_0642692 3300049822 Bacteria 861
315 Ga0501044_0405810 3300049823 Bacteria 1275
316 nmdc:mga03683_171227_c1 3300050489 Bacteria 987
317 nmdc:mga03683_39_c1 3300050489 Bacteria 62423
318 nmdc:mga03683_45_c1 3300050489 Bacteria 58869
319 nmdc:mga03n38_3_c1 3300050490 Bacteria 77674
320 nmdc:mga03n38_67_c1 3300050490 Bacteria 22276
321 nmdc:mga00v17_20_c1 3300050491 Bacteria 110672
322 nmdc:mga00v17_29_c1 3300050491 Bacteria 89620
323 nmdc:mga0yw44_13468_c1 3300050492 Bacteria 4309
324 nmdc:mga0yw44_66_c1 3300050492 Bacteria 37953
325 nmdc:mga0k408_4339_c1 3300050493 Bacteria 7533
326 nmdc:mga06z11_23_c1 3300050494 Bacteria 67588
327 nmdc:mga06z11_29_c1 3300050494 Bacteria 60343
328 nmdc:mga06z11_6852_c1 3300050494 Bacteria 4658
329 nmdc:mga04h51_15_c1 3300050495 Bacteria 76646
330 nmdc:mga04h51_59_c1 3300050495 Bacteria 35125
331 nmdc:mga07m45_209_c3 3300050496 Bacteria 17950
332 nmdc:mga07m45_24_c1 3300050496 Bacteria 110671
333 nmdc:mga07m45_28555_c1 3300050496 Bacteria 3079
334 nmdc:mga07m45_3178_c1 3300050496 Bacteria 7885
335 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
336 nmdc:mga0sz30_1765_c1 3300050516 Bacteria 3865
337 nmdc:mga0sz30_37_c3 3300050516 Bacteria 27761
338 Ga0500643_006498 3300053087 Bacteria 4871
339 Ga0500643_108845 3300053087 Unclassified 749
340 Ga0500556_0031787 3300053104 Bacteria 1799
341 Ga0500562_001062 3300053108 Bacteria 6751
342 Ga0500592_000010 3300053116 Bacteria 76714
343 Ga0500607_001183 3300053121 Bacteria 24020
344 Ga0500559_0001465 3300053136 Bacteria 13356
345 Ga0500559_0007824 3300053136 Bacteria 4720
346 Ga0500559_0029603 3300053136 Bacteria 2346
347 Ga0500568_0000317 3300053139 Bacteria 38482
348 Ga0500568_0033387 3300053139 Bacteria 2112
349 Ga0500604_0047836 3300053151 Bacteria 1312
350 Ga0500570_001145 3300053724 Bacteria 11757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10019740 Ga0075365_100197405 167
2 3300006042 Ga0075368_10000011 Ga0075368_100000114 167
3 3300006048 Ga0075363_100000043 Ga0075363_10000004323 167
4 3300006051 Ga0075364_10000007 Ga0075364_1000000759 167
5 3300006177 Ga0075362_10000027 Ga0075362_1000002730 167
6 3300006178 Ga0075367_10000010 Ga0075367_1000001017 167
7 3300006186 Ga0075369_10000412 Ga0075369_1000041213 167
8 3300006195 Ga0075366_10004650 Ga0075366_100046507 167
9 3300006353 Ga0075370_10000024 Ga0075370_1000002421 167
10 3300027866 Ga0209813_10000143 Ga0209813_100001436 167
11 3300050489 nmdc:mga03683_39_c1 nmdc:mga03683_39_c1_37662_38204 167
12 3300050490 nmdc:mga03n38_3_c1 nmdc:mga03n38_3_c1_39398_39940 167
13 3300050491 nmdc:mga00v17_29_c1 nmdc:mga00v17_29_c1_37440_37982 167
14 3300050492 nmdc:mga0yw44_66_c1 nmdc:mga0yw44_66_c1_10242_10784 167
15 3300050493 nmdc:mga0k408_4339_c1 nmdc:mga0k408_4339_c1_752_1294 167
16 3300050494 nmdc:mga06z11_23_c1 nmdc:mga06z11_23_c1_38493_39035 167
17 3300050495 nmdc:mga04h51_15_c1 nmdc:mga04h51_15_c1_10144_10686 167
18 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_106274_106816 167
19 3300050516 nmdc:mga0sz30_37_c3 nmdc:mga0sz30_37_c3_15457_15999 167
20 iso_pu_bacteria 2906328253 2906335605 176
21 3300053087 Ga0500643_108845 Ga0500643_108845_13_597 177
22 3300048919 Ga0496116_0148241 Ga0496116_0148241_17_565 180
23 3300013105 Ga0157369_10068212 Ga0157369_100682123 186
24 3300046525 Ga0495663_0000126 Ga0495663_0000126_22806_23369 186
25 3300046530 Ga0495654_0006492 Ga0495654_0006492_1443_2006 186
26 3300053116 Ga0500592_000010 Ga0500592_000010_61552_62115 186
27 3300022740 Ga0228710_1026327 Ga0228710_10263271 187
28 iso_pu_bacteria 2721755823 2724113489 187
29 iso_pu_bacteria 2599185354 2600203754 188
30 iso_pu_bacteria 2615840624 2616294570 189
31 iso_pu_bacteria 2919709256 2919710942 189
32 iso_pu_bacteria 8018127388 8018132064 189
33 3300039450 Ga0436363_0795217 Ga0436363_0795217_19_597 190
34 iso_pu_bacteria 2509276021 2509390370 190
35 iso_pu_bacteria 2529292951 2530644666 190
36 iso_pu_bacteria 2693429783 2694629549 190
37 iso_pu_bacteria 2693429784 2694639204 190
38 iso_pu_bacteria 2718217997 2719669074 190
39 iso_pu_bacteria 2718218199 2720489768 190
40 iso_pu_bacteria 2718218269 2720777870 190
41 iso_pu_bacteria 2721755556 2723030483 190
42 iso_pu_bacteria 2721755556 2723031316 190
43 iso_pu_bacteria 2721755684 2723564845 190
44 iso_pu_bacteria 2721755819 2724087612 190
45 iso_pu_bacteria 2728369352 2730105008 190
46 iso_pu_bacteria 2728369352 2730111016 190
47 iso_pu_bacteria 2791355263 2793343405 190
48 iso_pu_bacteria 2838016132 2838016768 190
49 iso_pu_bacteria 2838668709 2838674877 190
50 iso_pu_bacteria 2838701080 2838707145 190
51 iso_pu_bacteria 2841864319 2841866301 190
52 iso_pu_bacteria 2842146304 2842151824 190
53 iso_pu_bacteria 2842192696 2842193735 190
54 iso_pu_bacteria 2842250916 2842256983 190
55 iso_pu_bacteria 2842285085 2842289894 190
56 iso_pu_bacteria 2842341865 2842342187 190
57 iso_pu_bacteria 2842363717 2842365837 190
58 iso_pu_bacteria 2842402390 2842406966 190
59 iso_pu_bacteria 2842409023 2842413858 190
60 iso_pu_bacteria 2842415677 2842420500 190
61 iso_pu_bacteria 2842509118 2842515717 190
62 iso_pu_bacteria 2919171160 2919176221 190
63 iso_pu_bacteria 2936381700 2936386361 190
64 iso_pu_bacteria 2957443900 2957450439 190
65 iso_pu_bacteria 2960617483 2960623574 190
66 iso_pu_bacteria 2960660292 2960667097 190
67 iso_pu_bacteria 637000159 637080617 190
68 iso_pu_bacteria 8004395343 8004399996 190
69 iso_pu_bacteria 8004395343 8004401484 190
70 iso_pu_bacteria 8005282627 8005286251 190
71 iso_pu_bacteria 8005395548 8005401726 190
72 iso_pu_bacteria 8005497431 8005503794 190
73 iso_pu_bacteria 8005668836 8005674563 190
74 iso_pu_bacteria 8005668836 8005675573 190
75 iso_pu_bacteria 8005695170 8005698238 190
76 3300005327 Ga0070658_10904435 Ga0070658_109044351 191
77 3300005331 Ga0070670_100230708 Ga0070670_1002307082 191
78 3300005344 Ga0070661_100021534 Ga0070661_1000215344 191
79 3300005344 Ga0070661_100138236 Ga0070661_1001382362 191
80 3300005345 Ga0070692_10388286 Ga0070692_103882862 191
81 3300005366 Ga0070659_100672817 Ga0070659_1006728171 191
82 3300005457 Ga0070662_100275259 Ga0070662_1002752592 191
83 3300005459 Ga0068867_100058683 Ga0068867_1000586835 191
84 3300005539 Ga0068853_100392043 Ga0068853_1003920432 191
85 3300005564 Ga0070664_100025889 Ga0070664_1000258896 191
86 3300005577 Ga0068857_101056126 Ga0068857_1010561261 191
87 3300005578 Ga0068854_100033051 Ga0068854_1000330512 191
88 3300005616 Ga0068852_100008653 Ga0068852_1000086537 191
89 3300005616 Ga0068852_100262632 Ga0068852_1002626322 191
90 3300005616 Ga0068852_100678424 Ga0068852_1006784241 191
91 3300005834 Ga0068851_10035839 Ga0068851_100358392 191
92 3300009174 Ga0105241_10530380 Ga0105241_105303801 191
93 3300013100 Ga0157373_10191731 Ga0157373_101917312 191
94 3300013102 Ga0157371_10099413 Ga0157371_100994132 191
95 3300013296 Ga0157374_10107142 Ga0157374_101071422 191
96 3300014497 Ga0182008_10183941 Ga0182008_101839412 191
97 3300025321 Ga0207656_10182262 Ga0207656_101822622 191
98 3300025907 Ga0207645_10009350 Ga0207645_100093502 191
99 3300025909 Ga0207705_10010170 Ga0207705_100101702 191
100 3300025909 Ga0207705_10495941 Ga0207705_104959412 191
101 3300025920 Ga0207649_10044676 Ga0207649_100446762 191
102 3300025932 Ga0207690_10079553 Ga0207690_100795532 191
103 3300025933 Ga0207706_10196830 Ga0207706_101968301 191
104 3300025933 Ga0207706_10298654 Ga0207706_102986542 191
105 3300025945 Ga0207679_10756112 Ga0207679_107561121 191
106 3300025981 Ga0207640_10446161 Ga0207640_104461612 191
107 3300025981 Ga0207640_10478769 Ga0207640_104787692 191
108 3300025986 Ga0207658_10206119 Ga0207658_102061193 191
109 3300026067 Ga0207678_10016129 Ga0207678_100161297 191
110 3300026089 Ga0207648_10079106 Ga0207648_100791062 191
111 3300026142 Ga0207698_10008870 Ga0207698_100088707 191
112 3300026142 Ga0207698_10157416 Ga0207698_101574162 191
113 3300031852 Ga0307410_10003306 Ga0307410_100033065 191
114 3300031903 Ga0307407_10018233 Ga0307407_100182334 191
115 3300031995 Ga0307409_100050503 Ga0307409_1000505032 191
116 3300032004 Ga0307414_10014331 Ga0307414_100143313 191
117 3300032005 Ga0307411_10285603 Ga0307411_102856032 191
118 3300053104 Ga0500556_0031787 Ga0500556_0031787_842_1459 191
119 3300053136 Ga0500559_0007824 Ga0500559_0007824_3765_4376 191
120 3300003320 rootH2_10040694 rootH2_100406943 192
121 3300003791 Ga0055530_10000020 Ga0055530_100000204 192
122 3300003794 Ga0055531_10000364 Ga0055531_1000036443 192
123 3300009148 Ga0105243_10000055 Ga0105243_1000005581 192
124 3300009148 Ga0105243_10439916 Ga0105243_104399161 192
125 3300013104 Ga0157370_10000034 Ga0157370_1000003445 192
126 3300013307 Ga0157372_10848239 Ga0157372_108482391 192
127 3300025298 Ga0209050_1000186 Ga0209050_100018616 192
128 3300025304 Ga0209257_1000211 Ga0209257_10002113 192
129 3300025935 Ga0207709_10000098 Ga0207709_10000098102 192
130 3300025981 Ga0207640_10004029 Ga0207640_100040297 192
131 3300031548 Ga0307408_100590030 Ga0307408_1005900301 192
132 3300032004 Ga0307414_10079081 Ga0307414_100790812 192
133 3300037418 Ga0395900_0132071 Ga0395900_0132071_79_663 192
134 3300037418 Ga0395900_0233769 Ga0395900_0233769_1242_1826 192
135 3300037471 Ga0395905_0249774 Ga0395905_0249774_523_1104 192
136 3300038443 Ga0395901_0035199 Ga0395901_0035199_3674_4255 192
137 3300048903 Ga0496100_0004696 Ga0496100_0004696_1606_2220 192
138 3300048904 Ga0496101_0010160 Ga0496101_0010160_1780_2394 192
139 3300048907 Ga0496104_0000046 Ga0496104_0000046_136331_136945 192
140 3300048908 Ga0496105_0000026 Ga0496105_0000026_12718_13332 192
141 3300048909 Ga0496106_0000176 Ga0496106_0000176_14955_15569 192
142 3300048910 Ga0496107_0000051 Ga0496107_0000051_47460_48074 192
143 3300048915 Ga0496112_0044116 Ga0496112_0044116_3221_3808 192
144 3300048918 Ga0496115_0012379 Ga0496115_0012379_3572_4186 192
145 3300048922 Ga0496119_0000074 Ga0496119_0000074_73724_74338 192
146 3300048923 Ga0496120_0000667 Ga0496120_0000667_37976_38590 192
147 3300048924 Ga0496121_0005280 Ga0496121_0005280_13872_14486 192
148 3300048929 Ga0496126_0003108 Ga0496126_0003108_6846_7460 192
149 3300048929 Ga0496126_0005032 Ga0496126_0005032_5467_6081 192
150 3300049823 Ga0501044_0405810 Ga0501044_0405810_126_743 192
151 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010350 193
152 3300003758 Ga0055532_1003645 Ga0055532_10036454 193
153 3300003781 Ga0055536_1002032 Ga0055536_100203214 193
154 3300003791 Ga0055530_10003172 Ga0055530_100031722 193
155 3300003792 Ga0055540_1020385 Ga0055540_10203852 193
156 3300005327 Ga0070658_10453983 Ga0070658_104539832 193
157 3300005339 Ga0070660_100418403 Ga0070660_1004184031 193
158 3300005344 Ga0070661_100418831 Ga0070661_1004188311 193
159 3300005458 Ga0070681_10178149 Ga0070681_101781492 193
160 3300005459 Ga0068867_100014074 Ga0068867_1000140743 193
161 3300005530 Ga0070679_100728490 Ga0070679_1007284901 193
162 3300005539 Ga0068853_100144482 Ga0068853_1001444823 193
163 3300005564 Ga0070664_100159955 Ga0070664_1001599553 193
164 3300005577 Ga0068857_100140067 Ga0068857_1001400672 193
165 3300005577 Ga0068857_100159054 Ga0068857_1001590544 193
166 3300005614 Ga0068856_100180239 Ga0068856_1001802392 193
167 3300005834 Ga0068851_10010570 Ga0068851_100105703 193
168 3300005841 Ga0068863_100004297 Ga0068863_1000042974 193
169 3300006042 Ga0075368_10000048 Ga0075368_1000004813 193
170 3300006353 Ga0075370_10058233 Ga0075370_100582333 193
171 3300009551 Ga0105238_10413254 Ga0105238_104132542 193
172 3300009551 Ga0105238_10852616 Ga0105238_108526161 193
173 3300009978 Ga0105148_100201 Ga0105148_1002016 193
174 3300013102 Ga0157371_10401844 Ga0157371_104018442 193
175 3300013105 Ga0157369_10172400 Ga0157369_101724002 193
176 3300021388 Ga0213875_10022344 Ga0213875_100223445 193
177 3300025229 Ga0209147_100438 Ga0209147_10043818 193
178 3300025261 Ga0209233_1000044 Ga0209233_1000044131 193
179 3300025292 Ga0209676_1000842 Ga0209676_100084229 193
180 3300025298 Ga0209050_1001679 Ga0209050_100167911 193
181 3300025303 Ga0209051_1000982 Ga0209051_100098216 193
182 3300025304 Ga0209257_1004224 Ga0209257_10042242 193
183 3300025321 Ga0207656_10019397 Ga0207656_100193973 193
184 3300025904 Ga0207647_10043557 Ga0207647_100435573 193
185 3300025904 Ga0207647_10083317 Ga0207647_100833172 193
186 3300025921 Ga0207652_10794990 Ga0207652_107949901 193
187 3300025933 Ga0207706_10019701 Ga0207706_100197019 193
188 3300025945 Ga0207679_10583038 Ga0207679_105830382 193
189 3300025949 Ga0207667_10382347 Ga0207667_103823472 193
190 3300025981 Ga0207640_11099714 Ga0207640_110997141 193
191 3300026041 Ga0207639_10119996 Ga0207639_101199962 193
192 3300026067 Ga0207678_10007454 Ga0207678_100074543 193
193 3300026078 Ga0207702_10500821 Ga0207702_105008211 193
194 3300026088 Ga0207641_10003542 Ga0207641_1000354212 193
195 3300026089 Ga0207648_10002863 Ga0207648_100028633 193
196 3300026116 Ga0207674_10090374 Ga0207674_100903742 193
197 3300026116 Ga0207674_10299750 Ga0207674_102997502 193
198 3300031548 Ga0307408_100000496 Ga0307408_1000004968 193
199 3300031731 Ga0307405_10001491 Ga0307405_100014912 193
200 3300031731 Ga0307405_10001981 Ga0307405_100019815 193
201 3300031731 Ga0307405_10040641 Ga0307405_100406413 193
202 3300031901 Ga0307406_10043805 Ga0307406_100438055 193
203 3300031911 Ga0307412_10000467 Ga0307412_100004675 193
204 3300031911 Ga0307412_10132705 Ga0307412_101327053 193
205 3300031911 Ga0307412_10133386 Ga0307412_101333862 193
206 3300031995 Ga0307409_100171431 Ga0307409_1001714314 193
207 3300032004 Ga0307414_10030312 Ga0307414_100303124 193
208 3300032005 Ga0307411_10251842 Ga0307411_102518423 193
209 3300032126 Ga0307415_100048209 Ga0307415_1000482094 193
210 3300037312 Ga0395899_0025987 Ga0395899_0025987_42_641 193
211 3300037418 Ga0395900_0023213 Ga0395900_0023213_4735_5334 193
212 3300037466 Ga0395898_0008733 Ga0395898_0008733_5352_5951 193
213 3300037471 Ga0395905_0043182 Ga0395905_0043182_3119_3718 193
214 3300037471 Ga0395905_0107598 Ga0395905_0107598_530_1120 193
215 3300037853 Ga0436364_0518085 Ga0436364_0518085_99948_100565 193
216 3300038443 Ga0395901_0016081 Ga0395901_0016081_2597_3196 193
217 3300044693 Ga0466961_0109596 Ga0466961_0109596_518_1108 193
218 3300046684 Ga0495669_0024479 Ga0495669_0024479_1499_2089 193
219 3300048907 Ga0496104_0024576 Ga0496104_0024576_3631_4257 193
220 3300048908 Ga0496105_0010311 Ga0496105_0010311_1426_2052 193
221 3300048916 Ga0496113_0026240 Ga0496113_0026240_1427_2044 193
222 3300048919 Ga0496116_0103530 Ga0496116_0103530_546_1172 193
223 3300048920 Ga0496117_0347351 Ga0496117_0347351_97_714 193
224 3300048922 Ga0496119_0008696 Ga0496119_0008696_3913_4539 193
225 3300048922 Ga0496119_0066702 Ga0496119_0066702_1411_2028 193
226 3300048923 Ga0496120_0069498 Ga0496120_0069498_1061_1687 193
227 3300048927 Ga0496124_0000011 Ga0496124_0000011_490568_491194 193
228 3300048929 Ga0496126_0000051 Ga0496126_0000051_275588_276205 193
229 3300048929 Ga0496126_0110854 Ga0496126_0110854_949_1575 193
230 3300049571 Ga0501034_0103118 Ga0501034_0103118_719_1327 193
231 3300049579 Ga0501043_0017816 Ga0501043_0017816_57_704 193
232 3300049581 Ga0501047_0001078 Ga0501047_0001078_10414_11061 193
233 3300050496 nmdc:mga07m45_28555_c1 nmdc:mga07m45_28555_c1_2302_2955 193
234 3300053108 Ga0500562_001062 Ga0500562_001062_108_725 193
235 3300053136 Ga0500559_0029603 Ga0500559_0029603_1356_1997 193
236 iso_pu_bacteria 8054302542 8054306937 193
237 3300002244 JGI24742J22300_10015794 JGI24742J22300_100157942 194
238 3300002739 JGI25158J39367_1000001 JGI25158J39367_100000167 194
239 3300002773 JGI25152J39213_1000020 JGI25152J39213_100002025 194
240 3300002987 JGI25159J45721_1000130 JGI25159J45721_100013039 194
241 3300003215 JGI25153J46596_10000174 JGI25153J46596_1000017470 194
242 3300003374 JGI25161J50226_1000101 JGI25161J50226_100010166 194
243 3300003771 Ga0055526_1000969 Ga0055526_100096921 194
244 3300003791 Ga0055530_10002751 Ga0055530_100027515 194
245 3300003792 Ga0055540_1000185 Ga0055540_10001856 194
246 3300003794 Ga0055531_10000088 Ga0055531_1000008899 194
247 3300003794 Ga0055531_10008607 Ga0055531_100086074 194
248 3300003911 JGI25405J52794_10055597 JGI25405J52794_100555972 194
249 3300004625 Ga0055543_1000186 Ga0055543_100018644 194
250 3300005262 Ga0065165_1000213 Ga0065165_100021313 194
251 3300005262 Ga0065165_1000291 Ga0065165_100029123 194
252 3300005327 Ga0070658_10006674 Ga0070658_100066745 194
253 3300005347 Ga0070668_100001223 Ga0070668_1000012233 194
254 3300005355 Ga0070671_100000065 Ga0070671_10000006572 194
255 3300005366 Ga0070659_100707715 Ga0070659_1007077152 194
256 3300005437 Ga0070710_10618093 Ga0070710_106180931 194
257 3300005439 Ga0070711_100441173 Ga0070711_1004411731 194
258 3300005548 Ga0070665_100000164 Ga0070665_10000016493 194
259 3300005548 Ga0070665_100141709 Ga0070665_1001417092 194
260 3300005614 Ga0068856_100000710 Ga0068856_10000071018 194
261 3300005719 Ga0068861_100014503 Ga0068861_1000145032 194
262 3300005841 Ga0068863_100005078 Ga0068863_10000507811 194
263 3300005843 Ga0068860_100033472 Ga0068860_1000334727 194
264 3300005937 Ga0081455_10000190 Ga0081455_1000019038 194
265 3300005937 Ga0081455_10003117 Ga0081455_1000311718 194
266 3300005937 Ga0081455_10181636 Ga0081455_101816363 194
267 3300006038 Ga0075365_10002206 Ga0075365_100022067 194
268 3300006042 Ga0075368_10000127 Ga0075368_100001272 194
269 3300006042 Ga0075368_10146774 Ga0075368_101467741 194
270 3300006051 Ga0075364_10025846 Ga0075364_100258465 194
271 3300006177 Ga0075362_10178259 Ga0075362_101782591 194
272 3300006178 Ga0075367_10002712 Ga0075367_100027128 194
273 3300006178 Ga0075367_10071474 Ga0075367_100714743 194
274 3300006186 Ga0075369_10001464 Ga0075369_1000146412 194
275 3300006195 Ga0075366_10008534 Ga0075366_100085342 194
276 3300006195 Ga0075366_10028817 Ga0075366_100288171 194
277 3300006353 Ga0075370_10004208 Ga0075370_100042083 194
278 3300006353 Ga0075370_10005338 Ga0075370_100053382 194
279 3300009093 Ga0105240_10000005 Ga0105240_10000005236 194
280 3300009177 Ga0105248_10002650 Ga0105248_1000265014 194
281 3300010375 Ga0105239_10006414 Ga0105239_1000641411 194
282 3300010375 Ga0105239_10458080 Ga0105239_104580802 194
283 3300010375 Ga0105239_10542628 Ga0105239_105426282 194
284 3300013104 Ga0157370_10000654 Ga0157370_1000065411 194
285 3300013104 Ga0157370_10003278 Ga0157370_1000327810 194
286 3300013306 Ga0163162_10000230 Ga0163162_1000023046 194
287 3300021321 Ga0214542_1026166 Ga0214542_10261662 194
288 3300021327 Ga0214543_1004720 Ga0214543_100472013 194
289 3300021384 Ga0213876_10361961 Ga0213876_103619611 194
290 3300025208 Ga0209436_100010 Ga0209436_10001059 194
291 3300025245 Ga0207425_1012990 Ga0207425_10129901 194
292 3300025258 Ga0209129_1000155 Ga0209129_100015525 194
293 3300025284 Ga0209130_1000101 Ga0209130_100010159 194
294 3300025292 Ga0209676_1000288 Ga0209676_10002884 194
295 3300025294 Ga0209025_1000062 Ga0209025_1000062225 194
296 3300025294 Ga0209025_1105425 Ga0209025_11054251 194
297 3300025297 Ga0209758_1000178 Ga0209758_1000178109 194
298 3300025297 Ga0209758_1008353 Ga0209758_10083535 194
299 3300025298 Ga0209050_1000001 Ga0209050_10000011627 194
300 3300025299 Ga0209256_1000324 Ga0209256_100032445 194
301 3300025302 Ga0207426_1000205 Ga0207426_1000205109 194
302 3300025302 Ga0207426_1000222 Ga0207426_100022253 194
303 3300025303 Ga0209051_1000129 Ga0209051_100012963 194
304 3300025303 Ga0209051_1000209 Ga0209051_1000209100 194
305 3300025304 Ga0209257_1000111 Ga0209257_1000111178 194
306 3300025315 Ga0207697_10026762 Ga0207697_100267623 194
307 3300025909 Ga0207705_10005983 Ga0207705_100059838 194
308 3300025913 Ga0207695_10000011 Ga0207695_10000011677 194
309 3300025914 Ga0207671_10587035 Ga0207671_105870352 194
310 3300025916 Ga0207663_10486929 Ga0207663_104869292 194
311 3300025928 Ga0207700_10585040 Ga0207700_105850401 194
312 3300025931 Ga0207644_10000045 Ga0207644_1000004525 194
313 3300025941 Ga0207711_10005813 Ga0207711_100058138 194
314 3300025972 Ga0207668_10026513 Ga0207668_100265133 194
315 3300026078 Ga0207702_10009551 Ga0207702_100095519 194
316 3300026078 Ga0207702_10010066 Ga0207702_100100663 194
317 3300026088 Ga0207641_10125928 Ga0207641_101259283 194
318 3300026118 Ga0207675_100025204 Ga0207675_1000252043 194
319 3300027866 Ga0209813_10000565 Ga0209813_1000056510 194
320 3300028379 Ga0268266_10000092 Ga0268266_1000009231 194
321 3300028379 Ga0268266_10055802 Ga0268266_100558024 194
322 3300028381 Ga0268264_10006595 Ga0268264_100065957 194
323 3300031238 Ga0265332_10072984 Ga0265332_100729843 194
324 3300031247 Ga0265340_10200851 Ga0265340_102008512 194
325 3300031901 Ga0307406_10034491 Ga0307406_100344912 194
326 3300035691 Ga0373931_0122095 Ga0373931_0122095_17_607 194
327 3300037418 Ga0395900_0351960 Ga0395900_0351960_82_669 194
328 3300037418 Ga0395900_0568120 Ga0395900_0568120_221_811 194
329 3300037471 Ga0395905_0000321 Ga0395905_0000321_21550_22140 194
330 3300037471 Ga0395905_0062185 Ga0395905_0062185_2595_3185 194
331 3300037853 Ga0436364_1544924 Ga0436364_1544924_1300_1896 194
332 3300038443 Ga0395901_0050990 Ga0395901_0050990_3265_3891 194
333 3300038705 Ga0237819_00364 Ga0237819_00364_1681_2307 194
334 3300039437 Ga0436365_1375549 Ga0436365_1375549_2180_2770 194
335 3300039438 Ga0436360_1007777 Ga0436360_1007777_25_615 194
336 3300046491 Ga0495584_0125713 Ga0495584_0125713_40_627 194
337 3300046506 Ga0495583_0000032 Ga0495583_0000032_83648_84271 194
338 3300046691 Ga0495670_0000008 Ga0495670_0000008_67281_67913 194
339 3300046692 Ga0495671_0000004 Ga0495671_0000004_162790_163413 194
340 3300047469 Ga0495673_0000021 Ga0495673_0000021_162790_163413 194
341 3300047470 Ga0495681_0107217 Ga0495681_0107217_426_1049 194
342 3300047472 Ga0495686_0000601 Ga0495686_0000601_42544_43134 194
343 3300047472 Ga0495686_0000764 Ga0495686_0000764_12261_12896 194
344 3300048905 Ga0496102_0000117 Ga0496102_0000117_107141_107728 194
345 3300048906 Ga0496103_0000076 Ga0496103_0000076_107148_107735 194
346 3300048909 Ga0496106_0000214 Ga0496106_0000214_26542_27132 194
347 3300048919 Ga0496116_0000189 Ga0496116_0000189_15878_16507 194
348 3300048919 Ga0496116_0002618 Ga0496116_0002618_12168_12755 194
349 3300048920 Ga0496117_0000201 Ga0496117_0000201_106955_107542 194
350 3300048920 Ga0496117_0001502 Ga0496117_0001502_5259_5849 194
351 3300048920 Ga0496117_0032242 Ga0496117_0032242_1515_2144 194
352 3300048920 Ga0496117_0086355 Ga0496117_0086355_766_1386 194
353 3300048921 Ga0496118_0000097 Ga0496118_0000097_10138_10725 194
354 3300048921 Ga0496118_0007490 Ga0496118_0007490_1513_2142 194
355 3300048921 Ga0496118_0103617 Ga0496118_0103617_511_1131 194
356 3300048922 Ga0496119_0301325 Ga0496119_0301325_42_632 194
357 3300048923 Ga0496120_0152522 Ga0496120_0152522_292_879 194
358 3300048924 Ga0496121_0001568 Ga0496121_0001568_21698_22327 194
359 3300048925 Ga0496122_0000083 Ga0496122_0000083_22320_22949 194
360 3300048925 Ga0496122_0002368 Ga0496122_0002368_18819_19409 194
361 3300048926 Ga0496123_0000356 Ga0496123_0000356_62875_63504 194
362 3300048926 Ga0496123_0002833 Ga0496123_0002833_1099_1689 194
363 3300048926 Ga0496123_0132481 Ga0496123_0132481_490_1077 194
364 3300048927 Ga0496124_0000202 Ga0496124_0000202_106926_107513 194
365 3300048927 Ga0496124_0022322 Ga0496124_0022322_2419_3048 194
366 3300048927 Ga0496124_0085854 Ga0496124_0085854_1253_1843 194
367 3300048927 Ga0496124_0226175 Ga0496124_0226175_580_1170 194
368 3300048928 Ga0496125_0000765 Ga0496125_0000765_6828_7418 194
369 3300048928 Ga0496125_0004343 Ga0496125_0004343_15776_16405 194
370 3300048928 Ga0496125_0147246 Ga0496125_0147246_451_1107 194
371 3300048929 Ga0496126_0011668 Ga0496126_0011668_137_766 194
372 3300048929 Ga0496126_0018501 Ga0496126_0018501_1673_2302 194
373 3300048929 Ga0496126_0039854 Ga0496126_0039854_3461_4051 194
374 3300049459 Ga0495678_021120 Ga0495678_021120_136_768 194
375 3300049570 Ga0501033_0135452 Ga0501033_0135452_594_1184 194
376 3300049571 Ga0501034_0028195 Ga0501034_0028195_4339_4929 194
377 3300049571 Ga0501034_0296407 Ga0501034_0296407_180_770 194
378 3300049579 Ga0501043_0447293 Ga0501043_0447293_253_843 194
379 3300049579 Ga0501043_0744814 Ga0501043_0744814_71_661 194
380 3300049822 Ga0501035_0642692 Ga0501035_0642692_16_606 194
381 3300050489 nmdc:mga03683_171227_c1 nmdc:mga03683_171227_c1_56_721 194
382 3300050489 nmdc:mga03683_45_c1 nmdc:mga03683_45_c1_4630_5262 194
383 3300050490 nmdc:mga03n38_67_c1 nmdc:mga03n38_67_c1_18624_19256 194
384 3300050491 nmdc:mga00v17_20_c1 nmdc:mga00v17_20_c1_91417_92049 194
385 3300050492 nmdc:mga0yw44_13468_c1 nmdc:mga0yw44_13468_c1_2829_3461 194
386 3300050494 nmdc:mga06z11_29_c1 nmdc:mga06z11_29_c1_53501_54133 194
387 3300050494 nmdc:mga06z11_6852_c1 nmdc:mga06z11_6852_c1_1236_1901 194
388 3300050495 nmdc:mga04h51_59_c1 nmdc:mga04h51_59_c1_18624_19256 194
389 3300050496 nmdc:mga07m45_209_c3 nmdc:mga07m45_209_c3_8434_9099 194
390 3300050496 nmdc:mga07m45_24_c1 nmdc:mga07m45_24_c1_91416_92048 194
391 3300050496 nmdc:mga07m45_3178_c1 nmdc:mga07m45_3178_c1_4550_5185 194
392 3300050516 nmdc:mga0sz30_1765_c1 nmdc:mga0sz30_1765_c1_627_1259 194
393 3300053087 Ga0500643_006498 Ga0500643_006498_3328_3963 194
394 3300053121 Ga0500607_001183 Ga0500607_001183_19480_20115 194
395 3300053136 Ga0500559_0001465 Ga0500559_0001465_8816_9451 194
396 3300053139 Ga0500568_0000317 Ga0500568_0000317_5933_6523 194
397 3300053139 Ga0500568_0033387 Ga0500568_0033387_779_1414 194
398 3300053151 Ga0500604_0047836 Ga0500604_0047836_27_728 194
399 3300053724 Ga0500570_001145 Ga0500570_001145_12_632 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

1

202

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kbz-assembly2.cif.gz_D crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7759 2 194
6kbz-assembly2.cif.gz_D crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7687 2 194
2bdv-assembly1.cif.gz_A x-ray crystal structure of phage-related protein bb2244 from bordetella bronchiseptica. northeast structural genomics consortium target bor24. 0.7662 2 193
1zn6-assembly1.cif.gz_A x-ray crystal structure of protein q7wlm8 from bordetella bronchiseptica. northeast structural genomics consortium target bor19. 0.7661 2 194
6kbu-assembly1.cif.gz_B crystal structure of yedk 0.7592 2 194
ID Description Score Start End Superfamily
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8245 1 194 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8206 1 194 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7967 1 194 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7929 1 194 3.90.1680.10
2bdvA00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7552 2 193 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A6N8TJZ9-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9937 1 194 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0M3GCT8-F1-model_v4 deleted 0.9915 1 194
AF-A0A442TGU7-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9891 1 194 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A6N8TJZ9-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9886 1 194 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0M3GCT8-F1-model_v4 deleted 0.9865 1 194

Feature Viewer

pLDDT pTM Quality
92.82 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map