F434438

General Info

Members Datasets Scaffolds Average Seq Length
399 222 399 390

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0286261|Ga0501082_0286261_211_1398
Length 395
Sequence LTDELLKWRSEFPILEKTVYLISHSLGAMPKATYDSLHEYADMWATRGVRAWAEGWWDMPITIGDEVGRVIGADPGTVVMHQNVSICQSLILSCIEPTPERNKIVYSELNFPSVMYVYEAHARDGRLRIETVKSDDGITVPLERMLEAIDEQTLLVPFSHVLFKSAFLQDAKAITGRAHEVGARVVLDTYQSAGTVPFSVKDLNVDFATGGSVKWLCGGPGAGYLYVRPDLHEELTPKTTGWMAHASPFSFETELRYATGIARFLHGSPAIPALFAARPGYKIINELGVDRIRAKSVRQTGRLIQLAQEAGFKVTSPKNPEQRGGTITVWHEEAAAITRELIRREFIVDFRPGAGVRISPHFYTKDDELDLVINEMKKIRDARAYDRAEHVGAAF

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.52
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000638 3300001976 Bacteria 4690
2 JGI24751J29686_10000808 3300002459 Bacteria 7306
3 Ga0065715_10091370 3300005293 Bacteria 5847
4 Ga0070690_100177871 3300005330 Bacteria 1469
5 Ga0068869_100066571 3300005334 Bacteria 2655
6 Ga0068869_100232210 3300005334 Bacteria 1466
7 Ga0070680_100231078 3300005336 Unclassified 1562
8 Ga0068868_100023467 3300005338 Bacteria 4669
9 Ga0068868_100068222 3300005338 Bacteria 2832
10 Ga0068868_100180492 3300005338 Unclassified 1751
11 Ga0070660_100226473 3300005339 Bacteria 1520
12 Ga0070689_100005861 3300005340 Bacteria 8438
13 Ga0070687_100000582 3300005343 Bacteria 12165
14 Ga0070661_100138872 3300005344 Bacteria 1830
15 Ga0070668_100136174 3300005347 Bacteria 1976
16 Ga0070673_100011001 3300005364 Bacteria 6159
17 Ga0070659_100057136 3300005366 Bacteria 3076
18 Ga0070667_100087750 3300005367 Bacteria 2670
19 Ga0070709_10049410 3300005434 Bacteria 2630
20 Ga0070709_10080021 3300005434 Bacteria 2130
21 Ga0070714_100026866 3300005435 Unclassified 4761
22 Ga0070714_100074659 3300005435 Bacteria 2940
23 Ga0070714_100139882 3300005435 Bacteria 2171
24 Ga0070713_100035427 3300005436 Bacteria 4017
25 Ga0070713_100060555 3300005436 Bacteria 3165
26 Ga0070713_100073063 3300005436 Unclassified 2902
27 Ga0070713_100077505 3300005436 Bacteria 2826
28 Ga0070711_100002684 3300005439 Bacteria 10211
29 Ga0070711_100035366 3300005439 Bacteria 3339
30 Ga0070711_100125252 3300005439 Bacteria 1906
31 Ga0070708_100002291 3300005445 Bacteria 14814
32 Ga0070708_100005869 3300005445 Bacteria 9748
33 Ga0070708_100046476 3300005445 Bacteria 3830
34 Ga0070708_100057617 3300005445 Unclassified 3459
35 Ga0070708_100149853 3300005445 Bacteria 2169
36 Ga0070708_100316242 3300005445 Bacteria 1471
37 Ga0070678_100059639 3300005456 Bacteria 2805
38 Ga0070662_100156662 3300005457 Unclassified 1778
39 Ga0070662_100178541 3300005457 Bacteria 1672
40 Ga0070681_10005023 3300005458 Bacteria 12750
41 Ga0068867_100025620 3300005459 Bacteria 4233
42 Ga0070685_10006809 3300005466 Bacteria 5835
43 Ga0070706_100000434 3300005467 Bacteria 50174
44 Ga0070706_100001372 3300005467 Bacteria 25863
45 Ga0070706_100039142 3300005467 Unclassified 4378
46 Ga0070707_100001963 3300005468 Bacteria 19671
47 Ga0070707_100009400 3300005468 Bacteria 9074
48 Ga0070698_100000584 3300005471 Bacteria 39203
49 Ga0070698_100002687 3300005471 Bacteria 19596
50 Ga0070698_100009906 3300005471 Bacteria 10190
51 Ga0070699_100005233 3300005518 Bacteria 11396
52 Ga0070679_100013550 3300005530 Bacteria 7811
53 Ga0070684_100003906 3300005535 Bacteria 11288
54 Ga0070697_100000814 3300005536 Bacteria 23385
55 Ga0070697_100000951 3300005536 Bacteria 21825
56 Ga0070697_100002081 3300005536 Bacteria 15305
57 Ga0070697_100005798 3300005536 Bacteria 9524
58 Ga0070697_100007211 3300005536 Bacteria 8646
59 Ga0070697_100023293 3300005536 Bacteria 4924
60 Ga0070697_100045573 3300005536 Bacteria 3554
61 Ga0070697_100083544 3300005536 Bacteria 2633
62 Ga0070697_100127350 3300005536 Bacteria 2133
63 Ga0070697_100276591 3300005536 Bacteria 1440
64 Ga0068853_100119446 3300005539 Bacteria 2350
65 Ga0070695_100019863 3300005545 Bacteria 4097
66 Ga0070696_100035796 3300005546 Unclassified 3419
67 Ga0068855_100133582 3300005563 Bacteria 2832
68 Ga0070664_100016056 3300005564 Bacteria 6135
69 Ga0070664_100022499 3300005564 Bacteria 5198
70 Ga0068856_100151329 3300005614 Bacteria 2329
71 Ga0068856_100189106 3300005614 Bacteria 2073
72 Ga0068859_100035804 3300005617 Bacteria 4981
73 Ga0068866_10027378 3300005718 Bacteria 2702
74 Ga0068851_10001808 3300005834 Bacteria 9364
75 Ga0068851_10012496 3300005834 Bacteria 4004
76 Ga0068870_10079569 3300005840 Unclassified 1808
77 Ga0068858_100085681 3300005842 Bacteria 2931
78 Ga0068858_100227796 3300005842 Bacteria 1766
79 Ga0068860_100074378 3300005843 Bacteria 3231
80 Ga0070717_10001776 3300006028 Bacteria 15038
81 Ga0070717_10017160 3300006028 Bacteria 5626
82 Ga0070717_10075614 3300006028 Bacteria 2817
83 Ga0070715_10005647 3300006163 Bacteria 4190
84 Ga0070716_100000124 3300006173 Bacteria 30516
85 Ga0070716_100007839 3300006173 Bacteria 5279
86 Ga0070716_100090330 3300006173 Unclassified 1852
87 Ga0070712_100000302 3300006175 Bacteria 27828
88 Ga0070712_100250093 3300006175 Bacteria 1416
89 Ga0097621_100020148 3300006237 Bacteria 5136
90 Ga0097621_100073825 3300006237 Bacteria 2824
91 Ga0068871_100032583 3300006358 Bacteria 4118
92 Ga0068871_100059920 3300006358 Bacteria 3103
93 Ga0068871_100127676 3300006358 Bacteria 2154
94 Ga0075428_100140346 3300006844 Bacteria 2627
95 Ga0075428_100513532 3300006844 Bacteria 1282
96 Ga0075433_10080996 3300006852 Bacteria 2862
97 Ga0075433_10145736 3300006852 Bacteria 2105
98 Ga0075434_100000005 3300006871 Bacteria 104425
99 Ga0075434_100003427 3300006871 Bacteria 14182
100 Ga0075434_100010866 3300006871 Bacteria 8558
101 Ga0075434_100074243 3300006871 Bacteria 3394
102 Ga0075429_100187654 3300006880 Bacteria 1812
103 Ga0075436_100000991 3300006914 Bacteria 19044
104 Ga0075436_100003843 3300006914 Bacteria 10294
105 Ga0075436_100004864 3300006914 Bacteria 9232
106 Ga0097620_100035806 3300006931 Bacteria 4981
107 Ga0075435_100004233 3300007076 Bacteria 9857
108 Ga0075435_100024237 3300007076 Bacteria 4706
109 Ga0075435_100048309 3300007076 Bacteria 3418
110 Ga0075435_100116263 3300007076 Bacteria 2228
111 Ga0099794_10010263 3300007265 Bacteria 3969
112 Ga0099794_10038393 3300007265 Bacteria 2269
113 Ga0105250_10041594 3300009092 Unclassified 1842
114 Ga0105240_10036101 3300009093 Bacteria 6362
115 Ga0105240_10085017 3300009093 Bacteria 3878
116 Ga0105240_10103929 3300009093 Unclassified 3450
117 Ga0111539_10269338 3300009094 Bacteria 1983
118 Ga0105245_10009826 3300009098 Bacteria 8337
119 Ga0105245_10084767 3300009098 Unclassified 2903
120 Ga0105245_10271730 3300009098 Bacteria 1653
121 Ga0105247_10065062 3300009101 Bacteria 2267
122 Ga0114129_10076519 3300009147 Bacteria 4659
123 Ga0114129_10261117 3300009147 Bacteria 2321
124 Ga0114129_10484121 3300009147 Bacteria 1618
125 Ga0114129_10688478 3300009147 Unclassified 1315
126 Ga0105241_10039238 3300009174 Bacteria 3571
127 Ga0105241_10087427 3300009174 Unclassified 2454
128 Ga0105242_10073256 3300009176 Bacteria 2847
129 Ga0105248_10162596 3300009177 Bacteria 2517
130 Ga0105248_10284246 3300009177 Unclassified 1862
131 Ga0105237_10219737 3300009545 Unclassified 1900
132 Ga0105238_10062825 3300009551 Bacteria 3714
133 Ga0105238_10303336 3300009551 Bacteria 1581
134 Ga0105249_10086754 3300009553 Bacteria 2919
135 Ga0105249_10153387 3300009553 Bacteria 2220
136 Ga0105239_10050296 3300010375 Bacteria 4572
137 Ga0105246_10002297 3300011119 Bacteria 11534
138 Ga0157373_10007252 3300013100 Bacteria 8267
139 Ga0157373_10028592 3300013100 Bacteria 4022
140 Ga0157373_10194729 3300013100 Bacteria 1428
141 Ga0157371_10025443 3300013102 Unclassified 4313
142 Ga0157371_10063963 3300013102 Bacteria 2608
143 Ga0157369_10000638 3300013105 Bacteria 45239
144 Ga0157369_10042083 3300013105 Bacteria 4984
145 Ga0157374_10089455 3300013296 Bacteria 2934
146 Ga0157374_10171390 3300013296 Bacteria 2117
147 Ga0157378_10044565 3300013297 Bacteria 3940
148 Ga0163162_10032008 3300013306 Bacteria 5220
149 Ga0163162_10099073 3300013306 Bacteria 3005
150 Ga0157372_10067428 3300013307 Bacteria 4021
151 Ga0157375_10065565 3300013308 Unclassified 3620
152 Ga0163163_10006273 3300014325 Bacteria 10378
153 Ga0157379_10008128 3300014968 Bacteria 9113
154 Ga0157379_10049076 3300014968 Bacteria 3768
155 Ga0157379_10160436 3300014968 Bacteria 2029
156 Ga0157379_10199119 3300014968 Bacteria 1811
157 Ga0157376_10028103 3300014969 Unclassified 4467
158 Ga0157376_10101993 3300014969 Bacteria 2509
159 Ga0157376_10170595 3300014969 Bacteria 1981
160 Ga0182007_10006669 3300015262 Bacteria 4935
161 Ga0163161_10009682 3300017792 Bacteria 6669
162 Ga0213876_10046845 3300021384 Unclassified 2286
163 Ga0228598_1000043 3300024227 Bacteria 17812
164 Ga0207697_10007820 3300025315 Bacteria 4732
165 Ga0207642_10018266 3300025899 Unclassified 2687
166 Ga0207680_10052856 3300025903 Bacteria 2436
167 Ga0207680_10095560 3300025903 Bacteria 1899
168 Ga0207647_10009445 3300025904 Bacteria 6930
169 Ga0207699_10020494 3300025906 Bacteria 3545
170 Ga0207699_10034971 3300025906 Bacteria 2855
171 Ga0207699_10036809 3300025906 Bacteria 2793
172 Ga0207699_10113379 3300025906 Unclassified 1742
173 Ga0207645_10003048 3300025907 Bacteria 12889
174 Ga0207643_10000363 3300025908 Bacteria 30460
175 Ga0207684_10000966 3300025910 Bacteria 32224
176 Ga0207684_10003721 3300025910 Bacteria 14769
177 Ga0207684_10141562 3300025910 Unclassified 2068
178 Ga0207654_10035546 3300025911 Bacteria 2777
179 Ga0207654_10042820 3300025911 Bacteria 2564
180 Ga0207707_10003557 3300025912 Bacteria 13804
181 Ga0207695_10200670 3300025913 Bacteria 1909
182 Ga0207671_10054220 3300025914 Bacteria 2971
183 Ga0207693_10000373 3300025915 Bacteria 41202
184 Ga0207693_10005083 3300025915 Bacteria 11026
185 Ga0207693_10064971 3300025915 Bacteria 2858
186 Ga0207663_10002079 3300025916 Bacteria 9538
187 Ga0207663_10007496 3300025916 Bacteria 5660
188 Ga0207663_10015835 3300025916 Bacteria 4169
189 Ga0207663_10046547 3300025916 Bacteria 2673
190 Ga0207660_10000546 3300025917 Bacteria 25285
191 Ga0207660_10154720 3300025917 Bacteria 1764
192 Ga0207662_10000664 3300025918 Bacteria 15610
193 Ga0207657_10001432 3300025919 Bacteria 25493
194 Ga0207657_10001455 3300025919 Bacteria 25319
195 Ga0207657_10006629 3300025919 Bacteria 11986
196 Ga0207649_10000794 3300025920 Bacteria 20366
197 Ga0207652_10004236 3300025921 Bacteria 11704
198 Ga0207652_10048251 3300025921 Unclassified 3639
199 Ga0207652_10324696 3300025921 Unclassified 1389
200 Ga0207646_10000020 3300025922 Bacteria 272909
201 Ga0207646_10006006 3300025922 Bacteria 12647
202 Ga0207646_10056647 3300025922 Unclassified 3503
203 Ga0207646_10073770 3300025922 Bacteria 3048
204 Ga0207646_10286435 3300025922 Bacteria 1489
205 Ga0207681_10152732 3300025923 Bacteria 1732
206 Ga0207694_10039766 3300025924 Unclassified 3620
207 Ga0207694_10045564 3300025924 Bacteria 3387
208 Ga0207694_10058027 3300025924 Bacteria 3011
209 Ga0207650_10000051 3300025925 Bacteria 168652
210 Ga0207650_10168790 3300025925 Bacteria 1738
211 Ga0207659_10202813 3300025926 Bacteria 1585
212 Ga0207687_10051976 3300025927 Unclassified 2858
213 Ga0207700_10007857 3300025928 Bacteria 6560
214 Ga0207700_10028451 3300025928 Bacteria 3930
215 Ga0207700_10228087 3300025928 Bacteria 1582
216 Ga0207664_10001175 3300025929 Bacteria 17418
217 Ga0207664_10234153 3300025929 Bacteria 1597
218 Ga0207644_10206743 3300025931 Bacteria 1550
219 Ga0207706_10000783 3300025933 Bacteria 32931
220 Ga0207706_10002653 3300025933 Bacteria 17425
221 Ga0207686_10163376 3300025934 Bacteria 1563
222 Ga0207665_10000034 3300025939 Bacteria 88735
223 Ga0207665_10000774 3300025939 Bacteria 21536
224 Ga0207665_10096800 3300025939 Bacteria 2053
225 Ga0207691_10002900 3300025940 Bacteria 16716
226 Ga0207711_10002266 3300025941 Bacteria 17271
227 Ga0207711_10009607 3300025941 Bacteria 8062
228 Ga0207711_10191931 3300025941 Unclassified 1862
229 Ga0207689_10000860 3300025942 Bacteria 29295
230 Ga0207689_10025762 3300025942 Bacteria 4928
231 Ga0207661_10000969 3300025944 Bacteria 18902
232 Ga0207661_10065645 3300025944 Bacteria 2947
233 Ga0207679_10000203 3300025945 Bacteria 47291
234 Ga0207679_10116747 3300025945 Unclassified 2116
235 Ga0207667_10028798 3300025949 Bacteria 6030
236 Ga0207667_10035271 3300025949 Bacteria 5366
237 Ga0207667_10375707 3300025949 Unclassified 1448
238 Ga0207651_10216760 3300025960 Unclassified 1544
239 Ga0207712_10027192 3300025961 Bacteria 3819
240 Ga0207658_10002771 3300025986 Bacteria 12627
241 Ga0207658_10127984 3300025986 Bacteria 2035
242 Ga0207677_10068238 3300026023 Bacteria 2494
243 Ga0207677_10081221 3300026023 Bacteria 2325
244 Ga0207639_10025861 3300026041 Bacteria 4259
245 Ga0207639_10044425 3300026041 Bacteria 3341
246 Ga0207678_10001066 3300026067 Bacteria 25100
247 Ga0207678_10078153 3300026067 Bacteria 2834
248 Ga0207702_10010773 3300026078 Bacteria 7633
249 Ga0207641_10000025 3300026088 Bacteria 247727
250 Ga0207641_10000673 3300026088 Bacteria 37086
251 Ga0207641_10164866 3300026088 Unclassified 2017
252 Ga0207648_10000966 3300026089 Bacteria 32474
253 Ga0207648_10126832 3300026089 Bacteria 2245
254 Ga0207676_10007622 3300026095 Bacteria 7685
255 Ga0207674_10001451 3300026116 Bacteria 30625
256 Ga0207683_10000742 3300026121 Bacteria 29663
257 Ga0207698_10156965 3300026142 Bacteria 1984
258 Ga0209588_1002403 3300027671 Bacteria 5071
259 Ga0207428_10115114 3300027907 Unclassified 2066
260 Ga0268266_10110925 3300028379 Unclassified 2430
261 Ga0268265_10048950 3300028380 Bacteria 3176
262 Ga0265338_10001594 3300028800 Bacteria 36404
263 Ga0265760_10000004 3300031090 Bacteria 149429
264 Ga0265328_10018666 3300031239 Unclassified 2671
265 Ga0265325_10001997 3300031241 Bacteria 14019
266 Ga0265340_10032621 3300031247 Bacteria 2599
267 Ga0265339_10002485 3300031249 Bacteria 13174
268 Ga0265331_10025146 3300031250 Bacteria 3007
269 Ga0265316_10021295 3300031344 Bacteria 5496
270 Ga0307408_100102317 3300031548 Bacteria 2185
271 Ga0265313_10018209 3300031595 Bacteria 3953
272 Ga0265314_10018014 3300031711 Bacteria 5523
273 Ga0265314_10038305 3300031711 Unclassified 3465
274 Ga0316212_1000774 3300033547 Bacteria 4078
275 Ga0373926_0005094 3300035083 Bacteria 4314
276 Ga0373926_0006273 3300035083 Bacteria 3946
277 Ga0373936_0022483 3300035113 Bacteria 2455
278 Ga0373945_0001300 3300035116 Bacteria 7577
279 Ga0373943_0094942 3300035170 Bacteria 1550
280 Ga0373946_0013990 3300035171 Bacteria 3021
281 Ga0373955_0014183 3300035172 Unclassified 3871
282 Ga0373924_0003090 3300035410 Bacteria 5681
283 Ga0373931_0007267 3300035691 Bacteria 5212
284 Ga0373931_0081574 3300035691 Unclassified 1786
285 Ga0373935_0026882 3300035692 Bacteria 3555
286 Ga0373927_0000357 3300035695 Bacteria 35562
287 Ga0373927_0012132 3300035695 Bacteria 5733
288 Ga0373933_0016913 3300035724 Unclassified 4087
289 Ga0373933_0038510 3300035724 Bacteria 2809
290 Ga0373947_0015095 3300035725 Bacteria 4434
291 Ga0373947_0030526 3300035725 Bacteria 3167
292 Ga0373947_0043281 3300035725 Unclassified 2690
293 Ga0373937_0000437 3300036401 Bacteria 38580
294 Ga0373937_0007462 3300036401 Bacteria 9461
295 Ga0373937_0034816 3300036401 Bacteria 4581
296 Ga0373937_0176727 3300036401 Unclassified 2004
297 Ga0373925_0001733 3300037068 Bacteria 18312
298 Ga0373925_0029998 3300037068 Bacteria 3989
299 Ga0373925_0249716 3300037068 Bacteria 1422
300 Ga0436365_0639242 3300039437 Bacteria 2379
301 Ga0436363_1080746 3300039450 Bacteria 3028
302 Ga0436362_0509378 3300039453 Bacteria 3394
303 Ga0453683_0178527 3300044673 Bacteria 1346
304 Ga0466963_0001758 3300044694 Bacteria 11808
305 Ga0466957_0004769 3300044842 Bacteria 7589
306 Ga0466959_0070703 3300045049 Bacteria 2528
307 Ga0466958_0090759 3300045836 Bacteria 1891
308 Ga0466967_0052715 3300045976 Unclassified 3572
309 Ga0466967_0094727 3300045976 Bacteria 2719
310 Ga0466967_0110385 3300045976 Bacteria 2526
311 Ga0495603_0035110 3300046455 Bacteria 3013
312 Ga0495603_0077010 3300046455 Bacteria 1957
313 Ga0495629_0063245 3300046459 Bacteria 2584
314 Ga0495580_0017762 3300046472 Bacteria 5309
315 Ga0495580_0025417 3300046472 Bacteria 4328
316 Ga0495580_0035513 3300046472 Unclassified 3585
317 Ga0495580_0055297 3300046472 Bacteria 2797
318 Ga0495580_0069932 3300046472 Unclassified 2452
319 Ga0495580_0184402 3300046472 Bacteria 1440
320 Ga0495639_0018162 3300046475 Bacteria 3059
321 Ga0495639_0023273 3300046475 Unclassified 2722
322 Ga0495664_0117536 3300046477 Bacteria 1607
323 Ga0495584_0054324 3300046491 Bacteria 2016
324 Ga0495628_0065819 3300046516 Bacteria 2834
325 Ga0495630_0000659 3300046517 Bacteria 24979
326 Ga0495630_0032747 3300046517 Bacteria 3875
327 Ga0495630_0174689 3300046517 Bacteria 1637
328 Ga0495666_0029428 3300046526 Bacteria 2702
329 Ga0495652_0087189 3300046529 Bacteria 2561
330 Ga0495665_0025910 3300046531 Bacteria 3149
331 Ga0495665_0044922 3300046531 Unclassified 2347
332 Ga0495640_0029025 3300046533 Unclassified 3976
333 Ga0495586_0011377 3300046535 Bacteria 4733
334 Ga0495645_0006585 3300046543 Bacteria 8068
335 Ga0495622_0057495 3300046557 Bacteria 1803
336 Ga0495635_0074618 3300046663 Bacteria 2324
337 Ga0495635_0103476 3300046663 Bacteria 1946
338 Ga0495658_0083644 3300046683 Bacteria 1877
339 Ga0495581_0062127 3300047315 Bacteria 2158
340 Ga0495676_0073073 3300047321 Bacteria 2631
341 Ga0495680_0055063 3300047322 Bacteria 3086
342 Ga0495614_0018551 3300048089 Bacteria 3014
343 Ga0496100_0040425 3300048903 Bacteria 2967
344 Ga0496102_0065906 3300048905 Bacteria 3320
345 Ga0496102_0119784 3300048905 Unclassified 2458
346 Ga0496102_0144020 3300048905 Bacteria 2235
347 Ga0496102_0149775 3300048905 Bacteria 2192
348 Ga0496102_0188331 3300048905 Unclassified 1944
349 Ga0496102_0242992 3300048905 Unclassified 1697
350 Ga0496103_0040135 3300048906 Bacteria 2876
351 Ga0496103_0055838 3300048906 Bacteria 2450
352 Ga0496104_0058617 3300048907 Unclassified 3645
353 Ga0496104_0131047 3300048907 Bacteria 2408
354 Ga0496105_0001474 3300048908 Bacteria 16594
355 Ga0496105_0054121 3300048908 Bacteria 3314
356 Ga0496105_0059384 3300048908 Bacteria 3156
357 Ga0496106_0040558 3300048909 Unclassified 3487
358 Ga0496106_0203247 3300048909 Bacteria 1577
359 Ga0496107_0054202 3300048910 Bacteria 2894
360 Ga0496108_0000169 3300048911 Bacteria 61406
361 Ga0496109_0000072 3300048912 Bacteria 107549
362 Ga0496109_0155443 3300048912 Bacteria 2142
363 Ga0496109_0279661 3300048912 Unclassified 1573
364 Ga0496110_0001865 3300048913 Bacteria 15574
365 Ga0496111_0005773 3300048914 Bacteria 7985
366 Ga0496111_0058229 3300048914 Bacteria 2797
367 Ga0496112_0000064 3300048915 Bacteria 72159
368 Ga0496112_0011741 3300048915 Bacteria 8020
369 Ga0496112_0047008 3300048915 Bacteria 4233
370 Ga0496112_0055168 3300048915 Bacteria 3906
371 Ga0496112_0093212 3300048915 Unclassified 2982
372 Ga0496113_0000253 3300048916 Bacteria 25196
373 Ga0496113_0002474 3300048916 Bacteria 10759
374 Ga0496113_0040955 3300048916 Bacteria 3416
375 Ga0496113_0086159 3300048916 Bacteria 2413
376 Ga0496115_0015307 3300048918 Bacteria 5816
377 Ga0501040_0223524 3300049576 Unclassified 1340
378 Ga0501076_0376463 3300049592 Unclassified 1167
379 nmdc:mga05p37_192067_c1 3300050507 Bacteria 2478
380 nmdc:mga05p37_336749_c1 3300050507 Bacteria 1780
381 nmdc:mga08y16_41250_c1 3300050511 Bacteria 4836
382 nmdc:mga0n895_1582_c1 3300050512 Bacteria 17128
383 nmdc:mga0n895_24203_c1 3300050512 Bacteria 5721
384 nmdc:mga0n895_603_c1 3300050512 Bacteria 24849
385 nmdc:mga0rr50_105602_c1 3300050513 Bacteria 2221
386 nmdc:mga0rr50_132213_c1 3300050513 Bacteria 1999
387 nmdc:mga0rr50_260_c1 3300050513 Bacteria 28597
388 nmdc:mga0rr50_6220_c1 3300050513 Bacteria 7237
389 nmdc:mga08x19_129749_c1 3300050514 Bacteria 1695
390 nmdc:mga08x19_1446_c1 3300050514 Bacteria 14687
391 nmdc:mga08x19_14588_c1 3300050514 Bacteria 4767
392 nmdc:mga08x19_35364_c1 3300050514 Bacteria 3160
393 nmdc:mga08x19_978_c1 3300050514 Bacteria 17873
394 nmdc:mga0a205_136_c1 3300050515 Bacteria 46162
395 nmdc:mga0a205_143043_c1 3300050515 Bacteria 2292
396 nmdc:mga0a205_329744_c1 3300050515 Unclassified 1396
397 Ga0495601_0026187 3300053077 Unclassified 3599
398 Ga0501084_0128756 3300054114 Bacteria 2131
399 Ga0501082_0286261 3300060353 Bacteria 1435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0376463 Ga0501076_0376463_14_964 307
2 3300049576 Ga0501040_0223524 Ga0501040_0223524_24_1127 358
3 3300005439 Ga0070711_100035366 Ga0070711_1000353662 381
4 3300025915 Ga0207693_10005083 Ga0207693_100050839 381
5 3300025916 Ga0207663_10015835 Ga0207663_100158351 381
6 3300009147 Ga0114129_10261117 Ga0114129_102611172 383
7 3300046472 Ga0495580_0055297 Ga0495580_0055297_1238_2392 384
8 3300005334 Ga0068869_100232210 Ga0068869_1002322101 385
9 3300009094 Ga0111539_10269338 Ga0111539_102693383 385
10 3300026088 Ga0207641_10164866 Ga0207641_101648662 385
11 3300031548 Ga0307408_100102317 Ga0307408_1001023172 385
12 3300048905 Ga0496102_0188331 Ga0496102_0188331_295_1455 385
13 3300048915 Ga0496112_0011741 Ga0496112_0011741_2211_3371 385
14 3300005436 Ga0070713_100060555 Ga0070713_1000605552 386
15 3300005471 Ga0070698_100002687 Ga0070698_10000268716 386
16 3300005471 Ga0070698_100009906 Ga0070698_1000099063 386
17 3300005536 Ga0070697_100023293 Ga0070697_1000232936 386
18 3300005843 Ga0068860_100074378 Ga0068860_1000743782 386
19 3300006173 Ga0070716_100000124 Ga0070716_10000012421 386
20 3300006173 Ga0070716_100007839 Ga0070716_1000078392 386
21 3300006871 Ga0075434_100000005 Ga0075434_10000000560 386
22 3300006871 Ga0075434_100010866 Ga0075434_1000108668 386
23 3300006914 Ga0075436_100003843 Ga0075436_1000038436 386
24 3300007076 Ga0075435_100004233 Ga0075435_1000042332 386
25 3300007076 Ga0075435_100116263 Ga0075435_1001162632 386
26 3300007265 Ga0099794_10010263 Ga0099794_100102633 386
27 3300007265 Ga0099794_10038393 Ga0099794_100383932 386
28 3300009147 Ga0114129_10484121 Ga0114129_104841212 386
29 3300009177 Ga0105248_10284246 Ga0105248_102842461 386
30 3300013308 Ga0157375_10065565 Ga0157375_100655652 386
31 3300021384 Ga0213876_10046845 Ga0213876_100468453 386
32 3300025906 Ga0207699_10020494 Ga0207699_100204942 386
33 3300025916 Ga0207663_10002079 Ga0207663_100020792 386
34 3300025916 Ga0207663_10007496 Ga0207663_100074965 386
35 3300025922 Ga0207646_10000020 Ga0207646_10000020155 386
36 3300025928 Ga0207700_10028451 Ga0207700_100284512 386
37 3300025939 Ga0207665_10000034 Ga0207665_1000003452 386
38 3300025939 Ga0207665_10000774 Ga0207665_1000077420 386
39 3300025941 Ga0207711_10191931 Ga0207711_101919312 386
40 3300026088 Ga0207641_10000673 Ga0207641_1000067327 386
41 3300027671 Ga0209588_1002403 Ga0209588_10024032 386
42 3300031090 Ga0265760_10000004 Ga0265760_1000000466 386
43 3300033547 Ga0316212_1000774 Ga0316212_10007742 386
44 3300035691 Ga0373931_0081574 Ga0373931_0081574_474_1667 386
45 3300035695 Ga0373927_0000357 Ga0373927_0000357_19629_20813 386
46 3300037068 Ga0373925_0001733 Ga0373925_0001733_16019_17203 386
47 3300039437 Ga0436365_0639242 Ga0436365_0639242_99_1301 386
48 3300044673 Ga0453683_0178527 Ga0453683_0178527_63_1250 386
49 3300046455 Ga0495603_0077010 Ga0495603_0077010_592_1782 386
50 3300046459 Ga0495629_0063245 Ga0495629_0063245_540_1733 386
51 3300046472 Ga0495580_0017762 Ga0495580_0017762_4055_5218 386
52 3300046472 Ga0495580_0184402 Ga0495580_0184402_130_1293 386
53 3300046475 Ga0495639_0018162 Ga0495639_0018162_1567_2760 386
54 3300046477 Ga0495664_0117536 Ga0495664_0117536_261_1448 386
55 3300046491 Ga0495584_0054324 Ga0495584_0054324_628_1791 386
56 3300046516 Ga0495628_0065819 Ga0495628_0065819_223_1410 386
57 3300046517 Ga0495630_0000659 Ga0495630_0000659_780_1964 386
58 3300046517 Ga0495630_0174689 Ga0495630_0174689_383_1576 386
59 3300046526 Ga0495666_0029428 Ga0495666_0029428_529_1713 386
60 3300046531 Ga0495665_0044922 Ga0495665_0044922_332_1525 386
61 3300046533 Ga0495640_0029025 Ga0495640_0029025_1122_2315 386
62 3300046543 Ga0495645_0006585 Ga0495645_0006585_3708_4895 386
63 3300046557 Ga0495622_0057495 Ga0495622_0057495_403_1596 386
64 3300046663 Ga0495635_0103476 Ga0495635_0103476_700_1893 386
65 3300046683 Ga0495658_0083644 Ga0495658_0083644_203_1396 386
66 3300047321 Ga0495676_0073073 Ga0495676_0073073_443_1636 386
67 3300048089 Ga0495614_0018551 Ga0495614_0018551_1087_2280 386
68 3300048908 Ga0496105_0059384 Ga0496105_0059384_498_1691 386
69 3300048918 Ga0496115_0015307 Ga0496115_0015307_2854_4047 386
70 3300050512 nmdc:mga0n895_603_c1 nmdc:mga0n895_603_c1_2703_3866 386
71 3300050513 nmdc:mga0rr50_105602_c1 nmdc:mga0rr50_105602_c1_299_1501 386
72 3300050513 nmdc:mga0rr50_260_c1 nmdc:mga0rr50_260_c1_7334_8497 386
73 3300050514 nmdc:mga08x19_1446_c1 nmdc:mga08x19_1446_c1_5033_6217 386
74 3300050515 nmdc:mga0a205_136_c1 nmdc:mga0a205_136_c1_25227_26390 386
75 3300054114 Ga0501084_0128756 Ga0501084_0128756_121_1308 386
76 3300060353 Ga0501082_0286261 Ga0501082_0286261_211_1398 386
77 3300001976 JGI24752J21851_1000638 JGI24752J21851_10006382 387
78 3300002459 JGI24751J29686_10000808 JGI24751J29686_100008083 387
79 3300005293 Ga0065715_10091370 Ga0065715_100913702 387
80 3300005330 Ga0070690_100177871 Ga0070690_1001778711 387
81 3300005334 Ga0068869_100066571 Ga0068869_1000665713 387
82 3300005336 Ga0070680_100231078 Ga0070680_1002310782 387
83 3300005338 Ga0068868_100023467 Ga0068868_1000234672 387
84 3300005338 Ga0068868_100068222 Ga0068868_1000682221 387
85 3300005338 Ga0068868_100180492 Ga0068868_1001804922 387
86 3300005339 Ga0070660_100226473 Ga0070660_1002264732 387
87 3300005340 Ga0070689_100005861 Ga0070689_1000058613 387
88 3300005343 Ga0070687_100000582 Ga0070687_1000005822 387
89 3300005344 Ga0070661_100138872 Ga0070661_1001388722 387
90 3300005347 Ga0070668_100136174 Ga0070668_1001361743 387
91 3300005364 Ga0070673_100011001 Ga0070673_1000110012 387
92 3300005366 Ga0070659_100057136 Ga0070659_1000571362 387
93 3300005367 Ga0070667_100087750 Ga0070667_1000877501 387
94 3300005434 Ga0070709_10049410 Ga0070709_100494103 387
95 3300005434 Ga0070709_10080021 Ga0070709_100800212 387
96 3300005435 Ga0070714_100026866 Ga0070714_1000268661 387
97 3300005435 Ga0070714_100074659 Ga0070714_1000746593 387
98 3300005435 Ga0070714_100139882 Ga0070714_1001398822 387
99 3300005436 Ga0070713_100035427 Ga0070713_1000354271 387
100 3300005436 Ga0070713_100073063 Ga0070713_1000730634 387
101 3300005436 Ga0070713_100077505 Ga0070713_1000775051 387
102 3300005439 Ga0070711_100002684 Ga0070711_1000026847 387
103 3300005439 Ga0070711_100125252 Ga0070711_1001252521 387
104 3300005445 Ga0070708_100002291 Ga0070708_1000022912 387
105 3300005445 Ga0070708_100005869 Ga0070708_1000058695 387
106 3300005445 Ga0070708_100046476 Ga0070708_1000464762 387
107 3300005445 Ga0070708_100057617 Ga0070708_1000576173 387
108 3300005445 Ga0070708_100149853 Ga0070708_1001498531 387
109 3300005445 Ga0070708_100316242 Ga0070708_1003162421 387
110 3300005456 Ga0070678_100059639 Ga0070678_1000596392 387
111 3300005457 Ga0070662_100156662 Ga0070662_1001566622 387
112 3300005457 Ga0070662_100178541 Ga0070662_1001785412 387
113 3300005458 Ga0070681_10005023 Ga0070681_100050237 387
114 3300005459 Ga0068867_100025620 Ga0068867_1000256203 387
115 3300005466 Ga0070685_10006809 Ga0070685_100068095 387
116 3300005467 Ga0070706_100000434 Ga0070706_10000043412 387
117 3300005467 Ga0070706_100001372 Ga0070706_10000137219 387
118 3300005467 Ga0070706_100039142 Ga0070706_1000391425 387
119 3300005468 Ga0070707_100001963 Ga0070707_10000196313 387
120 3300005468 Ga0070707_100009400 Ga0070707_1000094004 387
121 3300005471 Ga0070698_100000584 Ga0070698_10000058414 387
122 3300005518 Ga0070699_100005233 Ga0070699_1000052334 387
123 3300005530 Ga0070679_100013550 Ga0070679_1000135503 387
124 3300005535 Ga0070684_100003906 Ga0070684_1000039064 387
125 3300005536 Ga0070697_100000814 Ga0070697_10000081418 387
126 3300005536 Ga0070697_100000951 Ga0070697_10000095113 387
127 3300005536 Ga0070697_100002081 Ga0070697_1000020814 387
128 3300005536 Ga0070697_100005798 Ga0070697_1000057982 387
129 3300005536 Ga0070697_100007211 Ga0070697_1000072114 387
130 3300005536 Ga0070697_100045573 Ga0070697_1000455732 387
131 3300005536 Ga0070697_100083544 Ga0070697_1000835442 387
132 3300005536 Ga0070697_100127350 Ga0070697_1001273502 387
133 3300005536 Ga0070697_100276591 Ga0070697_1002765911 387
134 3300005539 Ga0068853_100119446 Ga0068853_1001194463 387
135 3300005545 Ga0070695_100019863 Ga0070695_1000198632 387
136 3300005546 Ga0070696_100035796 Ga0070696_1000357963 387
137 3300005563 Ga0068855_100133582 Ga0068855_1001335822 387
138 3300005564 Ga0070664_100016056 Ga0070664_1000160563 387
139 3300005564 Ga0070664_100022499 Ga0070664_1000224993 387
140 3300005614 Ga0068856_100151329 Ga0068856_1001513292 387
141 3300005614 Ga0068856_100189106 Ga0068856_1001891063 387
142 3300005617 Ga0068859_100035804 Ga0068859_1000358042 387
143 3300005718 Ga0068866_10027378 Ga0068866_100273782 387
144 3300005834 Ga0068851_10001808 Ga0068851_100018082 387
145 3300005834 Ga0068851_10012496 Ga0068851_100124965 387
146 3300005840 Ga0068870_10079569 Ga0068870_100795692 387
147 3300005842 Ga0068858_100085681 Ga0068858_1000856812 387
148 3300005842 Ga0068858_100227796 Ga0068858_1002277962 387
149 3300006028 Ga0070717_10001776 Ga0070717_100017764 387
150 3300006028 Ga0070717_10017160 Ga0070717_100171602 387
151 3300006028 Ga0070717_10075614 Ga0070717_100756142 387
152 3300006163 Ga0070715_10005647 Ga0070715_100056473 387
153 3300006173 Ga0070716_100090330 Ga0070716_1000903302 387
154 3300006175 Ga0070712_100000302 Ga0070712_10000030229 387
155 3300006175 Ga0070712_100250093 Ga0070712_1002500931 387
156 3300006237 Ga0097621_100020148 Ga0097621_1000201482 387
157 3300006237 Ga0097621_100073825 Ga0097621_1000738252 387
158 3300006358 Ga0068871_100032583 Ga0068871_1000325835 387
159 3300006358 Ga0068871_100059920 Ga0068871_1000599202 387
160 3300006358 Ga0068871_100127676 Ga0068871_1001276762 387
161 3300006844 Ga0075428_100140346 Ga0075428_1001403462 387
162 3300006844 Ga0075428_100513532 Ga0075428_1005135321 387
163 3300006852 Ga0075433_10080996 Ga0075433_100809962 387
164 3300006852 Ga0075433_10145736 Ga0075433_101457361 387
165 3300006871 Ga0075434_100003427 Ga0075434_10000342712 387
166 3300006871 Ga0075434_100074243 Ga0075434_1000742434 387
167 3300006880 Ga0075429_100187654 Ga0075429_1001876542 387
168 3300006914 Ga0075436_100000991 Ga0075436_1000009912 387
169 3300006914 Ga0075436_100004864 Ga0075436_1000048646 387
170 3300006931 Ga0097620_100035806 Ga0097620_1000358064 387
171 3300007076 Ga0075435_100024237 Ga0075435_1000242372 387
172 3300007076 Ga0075435_100048309 Ga0075435_1000483092 387
173 3300009092 Ga0105250_10041594 Ga0105250_100415941 387
174 3300009093 Ga0105240_10036101 Ga0105240_100361013 387
175 3300009093 Ga0105240_10085017 Ga0105240_100850172 387
176 3300009093 Ga0105240_10103929 Ga0105240_101039294 387
177 3300009098 Ga0105245_10009826 Ga0105245_100098263 387
178 3300009098 Ga0105245_10084767 Ga0105245_100847672 387
179 3300009098 Ga0105245_10271730 Ga0105245_102717302 387
180 3300009101 Ga0105247_10065062 Ga0105247_100650622 387
181 3300009147 Ga0114129_10076519 Ga0114129_100765193 387
182 3300009147 Ga0114129_10688478 Ga0114129_106884781 387
183 3300009174 Ga0105241_10039238 Ga0105241_100392384 387
184 3300009174 Ga0105241_10087427 Ga0105241_100874272 387
185 3300009176 Ga0105242_10073256 Ga0105242_100732563 387
186 3300009177 Ga0105248_10162596 Ga0105248_101625961 387
187 3300009545 Ga0105237_10219737 Ga0105237_102197372 387
188 3300009551 Ga0105238_10062825 Ga0105238_100628253 387
189 3300009551 Ga0105238_10303336 Ga0105238_103033362 387
190 3300009553 Ga0105249_10086754 Ga0105249_100867542 387
191 3300009553 Ga0105249_10153387 Ga0105249_101533871 387
192 3300010375 Ga0105239_10050296 Ga0105239_100502962 387
193 3300011119 Ga0105246_10002297 Ga0105246_100022978 387
194 3300013100 Ga0157373_10007252 Ga0157373_100072524 387
195 3300013100 Ga0157373_10028592 Ga0157373_100285925 387
196 3300013100 Ga0157373_10194729 Ga0157373_101947291 387
197 3300013102 Ga0157371_10025443 Ga0157371_100254434 387
198 3300013102 Ga0157371_10063963 Ga0157371_100639631 387
199 3300013105 Ga0157369_10000638 Ga0157369_1000063843 387
200 3300013105 Ga0157369_10042083 Ga0157369_100420835 387
201 3300013296 Ga0157374_10089455 Ga0157374_100894551 387
202 3300013296 Ga0157374_10171390 Ga0157374_101713901 387
203 3300013297 Ga0157378_10044565 Ga0157378_100445652 387
204 3300013306 Ga0163162_10032008 Ga0163162_100320084 387
205 3300013306 Ga0163162_10099073 Ga0163162_100990733 387
206 3300013307 Ga0157372_10067428 Ga0157372_100674283 387
207 3300014325 Ga0163163_10006273 Ga0163163_100062735 387
208 3300014968 Ga0157379_10008128 Ga0157379_100081282 387
209 3300014968 Ga0157379_10049076 Ga0157379_100490761 387
210 3300014968 Ga0157379_10160436 Ga0157379_101604362 387
211 3300014968 Ga0157379_10199119 Ga0157379_101991192 387
212 3300014969 Ga0157376_10028103 Ga0157376_100281034 387
213 3300014969 Ga0157376_10101993 Ga0157376_101019932 387
214 3300014969 Ga0157376_10170595 Ga0157376_101705952 387
215 3300015262 Ga0182007_10006669 Ga0182007_100066692 387
216 3300017792 Ga0163161_10009682 Ga0163161_100096824 387
217 3300024227 Ga0228598_1000043 Ga0228598_10000433 387
218 3300025315 Ga0207697_10007820 Ga0207697_100078202 387
219 3300025899 Ga0207642_10018266 Ga0207642_100182662 387
220 3300025903 Ga0207680_10052856 Ga0207680_100528562 387
221 3300025903 Ga0207680_10095560 Ga0207680_100955602 387
222 3300025904 Ga0207647_10009445 Ga0207647_100094453 387
223 3300025906 Ga0207699_10034971 Ga0207699_100349712 387
224 3300025906 Ga0207699_10036809 Ga0207699_100368092 387
225 3300025906 Ga0207699_10113379 Ga0207699_101133792 387
226 3300025907 Ga0207645_10003048 Ga0207645_100030485 387
227 3300025908 Ga0207643_10000363 Ga0207643_1000036312 387
228 3300025910 Ga0207684_10000966 Ga0207684_100009668 387
229 3300025910 Ga0207684_10003721 Ga0207684_100037218 387
230 3300025910 Ga0207684_10141562 Ga0207684_101415621 387
231 3300025911 Ga0207654_10035546 Ga0207654_100355462 387
232 3300025911 Ga0207654_10042820 Ga0207654_100428201 387
233 3300025912 Ga0207707_10003557 Ga0207707_100035573 387
234 3300025913 Ga0207695_10200670 Ga0207695_102006702 387
235 3300025914 Ga0207671_10054220 Ga0207671_100542201 387
236 3300025915 Ga0207693_10000373 Ga0207693_1000037312 387
237 3300025915 Ga0207693_10064971 Ga0207693_100649712 387
238 3300025916 Ga0207663_10046547 Ga0207663_100465472 387
239 3300025917 Ga0207660_10000546 Ga0207660_1000054613 387
240 3300025917 Ga0207660_10154720 Ga0207660_101547202 387
241 3300025918 Ga0207662_10000664 Ga0207662_100006643 387
242 3300025919 Ga0207657_10001432 Ga0207657_1000143212 387
243 3300025919 Ga0207657_10001455 Ga0207657_1000145521 387
244 3300025919 Ga0207657_10006629 Ga0207657_100066293 387
245 3300025920 Ga0207649_10000794 Ga0207649_1000079415 387
246 3300025921 Ga0207652_10004236 Ga0207652_100042364 387
247 3300025921 Ga0207652_10048251 Ga0207652_100482512 387
248 3300025921 Ga0207652_10324696 Ga0207652_103246962 387
249 3300025922 Ga0207646_10006006 Ga0207646_100060069 387
250 3300025922 Ga0207646_10056647 Ga0207646_100566472 387
251 3300025922 Ga0207646_10073770 Ga0207646_100737702 387
252 3300025922 Ga0207646_10286435 Ga0207646_102864352 387
253 3300025923 Ga0207681_10152732 Ga0207681_101527322 387
254 3300025924 Ga0207694_10039766 Ga0207694_100397663 387
255 3300025924 Ga0207694_10045564 Ga0207694_100455642 387
256 3300025924 Ga0207694_10058027 Ga0207694_100580273 387
257 3300025925 Ga0207650_10000051 Ga0207650_1000005114 387
258 3300025925 Ga0207650_10168790 Ga0207650_101687901 387
259 3300025926 Ga0207659_10202813 Ga0207659_102028132 387
260 3300025927 Ga0207687_10051976 Ga0207687_100519762 387
261 3300025928 Ga0207700_10007857 Ga0207700_100078573 387
262 3300025928 Ga0207700_10228087 Ga0207700_102280871 387
263 3300025929 Ga0207664_10001175 Ga0207664_100011759 387
264 3300025929 Ga0207664_10234153 Ga0207664_102341532 387
265 3300025931 Ga0207644_10206743 Ga0207644_102067431 387
266 3300025933 Ga0207706_10000783 Ga0207706_1000078323 387
267 3300025933 Ga0207706_10002653 Ga0207706_1000265315 387
268 3300025934 Ga0207686_10163376 Ga0207686_101633762 387
269 3300025939 Ga0207665_10096800 Ga0207665_100968002 387
270 3300025940 Ga0207691_10002900 Ga0207691_100029002 387
271 3300025941 Ga0207711_10002266 Ga0207711_1000226613 387
272 3300025941 Ga0207711_10009607 Ga0207711_100096072 387
273 3300025942 Ga0207689_10000860 Ga0207689_1000086018 387
274 3300025942 Ga0207689_10025762 Ga0207689_100257624 387
275 3300025944 Ga0207661_10000969 Ga0207661_1000096912 387
276 3300025944 Ga0207661_10065645 Ga0207661_100656452 387
277 3300025945 Ga0207679_10000203 Ga0207679_1000020335 387
278 3300025945 Ga0207679_10116747 Ga0207679_101167472 387
279 3300025949 Ga0207667_10028798 Ga0207667_100287983 387
280 3300025949 Ga0207667_10035271 Ga0207667_100352714 387
281 3300025949 Ga0207667_10375707 Ga0207667_103757071 387
282 3300025960 Ga0207651_10216760 Ga0207651_102167602 387
283 3300025961 Ga0207712_10027192 Ga0207712_100271924 387
284 3300025986 Ga0207658_10002771 Ga0207658_100027717 387
285 3300025986 Ga0207658_10127984 Ga0207658_101279843 387
286 3300026023 Ga0207677_10068238 Ga0207677_100682382 387
287 3300026023 Ga0207677_10081221 Ga0207677_100812213 387
288 3300026041 Ga0207639_10025861 Ga0207639_100258615 387
289 3300026041 Ga0207639_10044425 Ga0207639_100444252 387
290 3300026067 Ga0207678_10001066 Ga0207678_1000106612 387
291 3300026067 Ga0207678_10078153 Ga0207678_100781532 387
292 3300026078 Ga0207702_10010773 Ga0207702_100107732 387
293 3300026088 Ga0207641_10000025 Ga0207641_10000025207 387
294 3300026089 Ga0207648_10000966 Ga0207648_1000096620 387
295 3300026089 Ga0207648_10126832 Ga0207648_101268322 387
296 3300026095 Ga0207676_10007622 Ga0207676_100076223 387
297 3300026116 Ga0207674_10001451 Ga0207674_1000145119 387
298 3300026121 Ga0207683_10000742 Ga0207683_1000074217 387
299 3300026142 Ga0207698_10156965 Ga0207698_101569652 387
300 3300027907 Ga0207428_10115114 Ga0207428_101151142 387
301 3300028379 Ga0268266_10110925 Ga0268266_101109252 387
302 3300028380 Ga0268265_10048950 Ga0268265_100489503 387
303 3300028800 Ga0265338_10001594 Ga0265338_100015945 387
304 3300031239 Ga0265328_10018666 Ga0265328_100186663 387
305 3300031241 Ga0265325_10001997 Ga0265325_100019973 387
306 3300031247 Ga0265340_10032621 Ga0265340_100326212 387
307 3300031249 Ga0265339_10002485 Ga0265339_100024852 387
308 3300031250 Ga0265331_10025146 Ga0265331_100251462 387
309 3300031344 Ga0265316_10021295 Ga0265316_100212953 387
310 3300031595 Ga0265313_10018209 Ga0265313_100182092 387
311 3300031711 Ga0265314_10018014 Ga0265314_100180144 387
312 3300031711 Ga0265314_10038305 Ga0265314_100383053 387
313 3300035083 Ga0373926_0005094 Ga0373926_0005094_676_1845 387
314 3300035083 Ga0373926_0006273 Ga0373926_0006273_2634_3806 387
315 3300035113 Ga0373936_0022483 Ga0373936_0022483_824_1993 387
316 3300035116 Ga0373945_0001300 Ga0373945_0001300_802_1971 387
317 3300035170 Ga0373943_0094942 Ga0373943_0094942_119_1291 387
318 3300035171 Ga0373946_0013990 Ga0373946_0013990_808_1980 387
319 3300035172 Ga0373955_0014183 Ga0373955_0014183_203_1375 387
320 3300035410 Ga0373924_0003090 Ga0373924_0003090_1014_2183 387
321 3300035691 Ga0373931_0007267 Ga0373931_0007267_3739_4905 387
322 3300035692 Ga0373935_0026882 Ga0373935_0026882_176_1348 387
323 3300035695 Ga0373927_0012132 Ga0373927_0012132_584_1756 387
324 3300035724 Ga0373933_0016913 Ga0373933_0016913_499_1671 387
325 3300035724 Ga0373933_0038510 Ga0373933_0038510_220_1392 387
326 3300035725 Ga0373947_0015095 Ga0373947_0015095_145_1317 387
327 3300035725 Ga0373947_0030526 Ga0373947_0030526_72_1244 387
328 3300035725 Ga0373947_0043281 Ga0373947_0043281_1347_2510 387
329 3300036401 Ga0373937_0000437 Ga0373937_0000437_18202_19374 387
330 3300036401 Ga0373937_0007462 Ga0373937_0007462_4634_5806 387
331 3300036401 Ga0373937_0034816 Ga0373937_0034816_474_1640 387
332 3300036401 Ga0373937_0176727 Ga0373937_0176727_467_1639 387
333 3300037068 Ga0373925_0029998 Ga0373925_0029998_2746_3918 387
334 3300037068 Ga0373925_0249716 Ga0373925_0249716_179_1351 387
335 3300039450 Ga0436363_1080746 Ga0436363_1080746_98_1267 387
336 3300039453 Ga0436362_0509378 Ga0436362_0509378_1495_2661 387
337 3300044694 Ga0466963_0001758 Ga0466963_0001758_5909_7087 387
338 3300044842 Ga0466957_0004769 Ga0466957_0004769_1321_2493 387
339 3300045049 Ga0466959_0070703 Ga0466959_0070703_1094_2263 387
340 3300045836 Ga0466958_0090759 Ga0466958_0090759_285_1448 387
341 3300045976 Ga0466967_0052715 Ga0466967_0052715_1982_3154 387
342 3300045976 Ga0466967_0094727 Ga0466967_0094727_39_1217 387
343 3300045976 Ga0466967_0110385 Ga0466967_0110385_700_1872 387
344 3300046455 Ga0495603_0035110 Ga0495603_0035110_1606_2769 387
345 3300046472 Ga0495580_0025417 Ga0495580_0025417_521_1684 387
346 3300046472 Ga0495580_0035513 Ga0495580_0035513_1168_2343 387
347 3300046472 Ga0495580_0069932 Ga0495580_0069932_835_2001 387
348 3300046475 Ga0495639_0023273 Ga0495639_0023273_435_1604 387
349 3300046517 Ga0495630_0032747 Ga0495630_0032747_961_2130 387
350 3300046529 Ga0495652_0087189 Ga0495652_0087189_476_1648 387
351 3300046531 Ga0495665_0025910 Ga0495665_0025910_278_1450 387
352 3300046535 Ga0495586_0011377 Ga0495586_0011377_790_1962 387
353 3300046663 Ga0495635_0074618 Ga0495635_0074618_145_1317 387
354 3300047315 Ga0495581_0062127 Ga0495581_0062127_829_1998 387
355 3300047322 Ga0495680_0055063 Ga0495680_0055063_1130_2374 387
356 3300048903 Ga0496100_0040425 Ga0496100_0040425_639_1805 387
357 3300048905 Ga0496102_0065906 Ga0496102_0065906_906_2072 387
358 3300048905 Ga0496102_0119784 Ga0496102_0119784_1196_2359 387
359 3300048905 Ga0496102_0144020 Ga0496102_0144020_400_1566 387
360 3300048905 Ga0496102_0149775 Ga0496102_0149775_1012_2178 387
361 3300048905 Ga0496102_0242992 Ga0496102_0242992_154_1320 387
362 3300048906 Ga0496103_0040135 Ga0496103_0040135_1328_2494 387
363 3300048906 Ga0496103_0055838 Ga0496103_0055838_312_1484 387
364 3300048907 Ga0496104_0058617 Ga0496104_0058617_2064_3230 387
365 3300048907 Ga0496104_0131047 Ga0496104_0131047_923_2089 387
366 3300048908 Ga0496105_0001474 Ga0496105_0001474_7299_8471 387
367 3300048908 Ga0496105_0054121 Ga0496105_0054121_1610_2776 387
368 3300048909 Ga0496106_0040558 Ga0496106_0040558_987_2153 387
369 3300048909 Ga0496106_0203247 Ga0496106_0203247_22_1188 387
370 3300048910 Ga0496107_0054202 Ga0496107_0054202_836_2002 387
371 3300048911 Ga0496108_0000169 Ga0496108_0000169_46095_47258 387
372 3300048912 Ga0496109_0000072 Ga0496109_0000072_15129_16292 387
373 3300048912 Ga0496109_0155443 Ga0496109_0155443_955_2121 387
374 3300048912 Ga0496109_0279661 Ga0496109_0279661_150_1316 387
375 3300048913 Ga0496110_0001865 Ga0496110_0001865_11402_12565 387
376 3300048914 Ga0496111_0005773 Ga0496111_0005773_6422_7594 387
377 3300048914 Ga0496111_0058229 Ga0496111_0058229_1554_2717 387
378 3300048915 Ga0496112_0000064 Ga0496112_0000064_55934_57097 387
379 3300048915 Ga0496112_0047008 Ga0496112_0047008_2042_3208 387
380 3300048915 Ga0496112_0055168 Ga0496112_0055168_1823_2995 387
381 3300048915 Ga0496112_0093212 Ga0496112_0093212_1703_2866 387
382 3300048916 Ga0496113_0000253 Ga0496113_0000253_4502_5665 387
383 3300048916 Ga0496113_0002474 Ga0496113_0002474_4004_5176 387
384 3300048916 Ga0496113_0040955 Ga0496113_0040955_1594_2760 387
385 3300048916 Ga0496113_0086159 Ga0496113_0086159_929_2095 387
386 3300050507 nmdc:mga05p37_192067_c1 nmdc:mga05p37_192067_c1_1285_2463 387
387 3300050507 nmdc:mga05p37_336749_c1 nmdc:mga05p37_336749_c1_519_1700 387
388 3300050511 nmdc:mga08y16_41250_c1 nmdc:mga08y16_41250_c1_1627_2808 387
389 3300050512 nmdc:mga0n895_1582_c1 nmdc:mga0n895_1582_c1_8450_9613 387
390 3300050512 nmdc:mga0n895_24203_c1 nmdc:mga0n895_24203_c1_1590_2756 387
391 3300050513 nmdc:mga0rr50_132213_c1 nmdc:mga0rr50_132213_c1_695_1861 387
392 3300050513 nmdc:mga0rr50_6220_c1 nmdc:mga0rr50_6220_c1_4245_5408 387
393 3300050514 nmdc:mga08x19_129749_c1 nmdc:mga08x19_129749_c1_233_1399 387
394 3300050514 nmdc:mga08x19_14588_c1 nmdc:mga08x19_14588_c1_164_1330 387
395 3300050514 nmdc:mga08x19_35364_c1 nmdc:mga08x19_35364_c1_1703_2866 387
396 3300050514 nmdc:mga08x19_978_c1 nmdc:mga08x19_978_c1_6382_7545 387
397 3300050515 nmdc:mga0a205_143043_c1 nmdc:mga0a205_143043_c1_161_1324 387
398 3300050515 nmdc:mga0a205_329744_c1 nmdc:mga0a205_329744_c1_167_1363 387
399 3300053077 Ga0495601_0026187 Ga0495601_0026187_202_1374 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

292

376

0.93

PF00266

Aminotran_5

Aminotransferase class-V

19

371

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9214 3 384
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9077 3 384
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.8973 3 381
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.891 2 381
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.8909 9 376
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9061 290 384 3.90.1150.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9009 30 286 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8885 30 286 3.40.640.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8843 30 286 3.40.640.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8825 33 279 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A831WSC0-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9785 2 384 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7R7Y6N2-F1-model_v4 deleted 0.9772 1 379
AF-E6PIA1-F1-model_v4 Aminotransferase class V domain-containing protein 0.9735 9 381 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A538SAS1-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.972 29 384 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A1G0LMQ1-F1-model_v4 Aminotransferase class V domain-containing protein 0.9686 1 382 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420

Feature Viewer

pLDDT pTM Quality
93.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map