F434448

General Info

Members Datasets Scaffolds Average Seq Length
399 274 281 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541281|2738745274
Length 352
Sequence SGYARGRVRIRHPASPTARRRFTRVAHDAPIDPRRSQRPPVRRVTATVILALVPIALLIGLGVLLRRNGFVADSFWAQAERLGYYVLLPALFIHGLATARLDGVPVLALAGVLVASTLAVALVLLALRPRLGLDGAAFTSVFQGGVRFNNYVGVSAAAGLFGLQGIALAAVANAAIVPTVNILCVLVFARFGSGGRLAPRAILRQLLLNPLVVACAIGIALQATGLGLPPGLEPTLKALGQASLPLGLLCVGAALDPRTVRTWLRPVVIASVAKFVLMPTVTILACLAAGLHGPAAATALLFQSLPTASSSYIMARQLGGDAPLMAGILALQTVLAGLAIPLVMLILEGFTA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2519103095 Burkholderia sp. KJ006 Isolate Nodule
4 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
7 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
8 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
11 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
12 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
13 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
14 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
15 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
16 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
17 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
18 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
19 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
20 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
21 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
22 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
23 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
24 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
25 2643221736 Bosea sp. Root483D1 Isolate Unclassified
26 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
27 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
28 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
29 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
30 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
31 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
32 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
33 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
34 2765235841 Pseudomonas putida AA7 Isolate Unclassified
35 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
36 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
37 2802429633 Rhizobium anhuiense J3 Isolate Nodule
38 2802429634 Rhizobium anhuiense S10 Isolate Nodule
39 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
40 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
41 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
42 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
43 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
44 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
45 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
46 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
47 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
48 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
49 2818991452 Burkholderia cepacia 561 Isolate Unclassified
50 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
51 2841760612 Bosea sp. Tri-49 Isolate Nodule
52 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
53 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
54 2844104063 Bosea sp. Tri-39 Isolate Nodule
55 2851182111 Bosea sp. Tri-44 Isolate Nodule
56 2851246043 Bosea sp. Tri-54 Isolate Nodule
57 2855730933 Achromobacter sp. HZ28 Isolate Nodule
58 2855767633 Achromobacter sp. HZ34 Isolate Nodule
59 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
60 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
61 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
62 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
63 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
64 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
65 2885266251 Ralstonia sp. SET104 Isolate Nodule
66 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
67 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
68 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
69 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
70 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
71 2919476304 Duganella sp. 3397 Isolate Unclassified
72 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
73 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
74 2928058823 Ralstonia sp. 1138 Isolate Unclassified
75 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
76 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
77 2928163908 Burkholderia sp. 567 Isolate Unclassified
78 2928170801 Burkholderia sp. 572 Isolate Unclassified
79 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
80 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
81 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
82 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
83 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
84 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
85 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
86 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
87 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
88 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
89 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
90 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
91 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
92 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
93 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
94 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
95 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
96 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
100 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
101 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
102 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
103 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
104 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
105 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
106 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
107 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
108 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
109 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
204 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
207 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
249 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
252 641522639 Methylobacterium sp. 4-46 Isolate Nodule
253 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
254 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
255 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
256 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
257 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
258 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
259 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
260 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
261 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
262 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
263 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
264 8052494512 Pseudomonas putida LD6 Isolate Unclassified
265 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
266 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
267 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
268 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
269 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
270 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
271 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
272 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
273 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
274 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.18
Metatranscriptomes 0.25
Isolates 29.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 17.04
Nodule 5.26
Rhizoplane 6.52
Rhizosphere 46.12
Stem 0
Stem Tuber 0.5
Unclassified 24.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4053450 2162886011 Bacteria 29154
2 JGI24740J21852_10001495 3300001979 Bacteria 10756
3 JGI25156J39149_1003003 3300002705 Bacteria 5730
4 JGI25156J39149_1011585 3300002705 Bacteria 1986
5 JGI25159J45721_1009135 3300002987 Bacteria 2646
6 JGI25151J46595_10000567 3300003187 Bacteria 33324
7 JGI25160J50197_1004000 3300003354 Bacteria 6433
8 Ga0055539_1000059 3300003752 Bacteria 146394
9 Ga0055532_1000025 3300003758 Bacteria 240145
10 Ga0055532_1001466 3300003758 Bacteria 6551
11 Ga0055532_1001984 3300003758 Bacteria 4768
12 Ga0055532_1002447 3300003758 Bacteria 3851
13 Ga0055525_1000682 3300003759 Bacteria 12767
14 Ga0055527_1000292 3300003760 Bacteria 28984
15 Ga0055527_1000561 3300003760 Bacteria 12300
16 Ga0055527_1001110 3300003760 Bacteria 6242
17 Ga0055535_1000019 3300003761 Bacteria 240145
18 Ga0055535_1000267 3300003761 Bacteria 54799
19 Ga0055535_1000345 3300003761 Bacteria 46284
20 Ga0055542_1000175 3300003762 Bacteria 79760
21 Ga0055542_1000681 3300003762 Bacteria 27200
22 Ga0055529_1000035 3300003763 Bacteria 240145
23 Ga0055529_1000131 3300003763 Bacteria 105530
24 Ga0055536_1003266 3300003781 Bacteria 8788
25 Ga0055536_1017772 3300003781 Bacteria 2311
26 Ga0058692_1000016 3300003856 Bacteria 275897
27 Ga0065165_1000218 3300005262 Bacteria 100161
28 Ga0065703_1000124 3300005272 Bacteria 46241
29 Ga0065704_10001549 3300005289 Bacteria 7525
30 Ga0065704_10002993 3300005289 Bacteria 5592
31 Ga0065704_10003232 3300005289 Bacteria 7937
32 Ga0065704_10091221 3300005289 Bacteria 2730
33 Ga0065704_10177453 3300005289 Bacteria 1254
34 Ga0065712_10067740 3300005290 Bacteria 80637
35 Ga0070658_10135330 3300005327 Bacteria 2055
36 Ga0070660_100000855 3300005339 Bacteria 20283
37 Ga0070661_100000047 3300005344 Bacteria 92087
38 Ga0070669_100000923 3300005353 Bacteria 21392
39 Ga0070659_100000064 3300005366 Bacteria 83862
40 Ga0070663_100000009 3300005455 Bacteria 187718
41 Ga0070663_100014894 3300005455 Bacteria 5001
42 Ga0068855_100214199 3300005563 Bacteria 2163
43 Ga0070664_100000011 3300005564 Bacteria 162277
44 Ga0068857_100043086 3300005577 Bacteria 4004
45 Ga0068854_100000017 3300005578 Bacteria 142796
46 Ga0068856_100001403 3300005614 Bacteria 25255
47 Ga0068852_100106727 3300005616 Bacteria 2539
48 Ga0068858_100161992 3300005842 Bacteria 2106
49 Ga0075365_10033687 3300006038 Bacteria 3303
50 Ga0075369_10053090 3300006186 Bacteria 1758
51 Ga0099823_1000017 3300006944 Bacteria 86474
52 Ga0079104_1023544 3300006946 Bacteria 1636
53 Ga0105251_10042410 3300009011 Bacteria 2209
54 Ga0105251_10050954 3300009011 Bacteria 1976
55 Ga0105244_10000533 3300009036 Bacteria 33932
56 Ga0105244_10009088 3300009036 Bacteria 6137
57 Ga0105244_10014407 3300009036 Bacteria 4572
58 Ga0105244_10015219 3300009036 Bacteria 4416
59 Ga0105244_10024211 3300009036 Bacteria 3315
60 Ga0105244_10047402 3300009036 Bacteria 2205
61 Ga0105244_10072524 3300009036 Bacteria 1715
62 Ga0105250_10008664 3300009092 Bacteria 4308
63 Ga0105250_10010311 3300009092 Bacteria 3894
64 Ga0105250_10034677 3300009092 Bacteria 2025
65 Ga0105250_10049099 3300009092 Bacteria 1692
66 Ga0105240_10002961 3300009093 Bacteria 26743
67 Ga0105240_10029699 3300009093 Bacteria 7115
68 Ga0105240_10058526 3300009093 Bacteria 4811
69 Ga0105247_10000973 3300009101 Bacteria 21633
70 Ga0105243_10000179 3300009148 Bacteria 73496
71 Ga0105243_10022252 3300009148 Bacteria 4815
72 Ga0105243_10131650 3300009148 Bacteria 2122
73 Ga0105237_10078718 3300009545 Bacteria 3286
74 Ga0105238_10038906 3300009551 Bacteria 4828
75 Ga0157373_10002760 3300013100 Bacteria 13286
76 Ga0157373_10004276 3300013100 Bacteria 10747
77 Ga0157371_10000033 3300013102 Bacteria 225328
78 Ga0157371_10121912 3300013102 Bacteria 1854
79 Ga0157371_10197186 3300013102 Bacteria 1443
80 Ga0157370_10000010 3300013104 Bacteria 218199
81 Ga0157370_10085273 3300013104 Bacteria 2967
82 Ga0157369_10000625 3300013105 Bacteria 45958
83 Ga0157372_10000176 3300013307 Bacteria 70656
84 Ga0157372_10084160 3300013307 Bacteria 3604
85 Ga0157372_10222214 3300013307 Bacteria 2189
86 Ga0182008_10004841 3300014497 Bacteria 7779
87 Ga0182006_1000055 3300015261 Bacteria 173139
88 Ga0182006_1008824 3300015261 Bacteria 4554
89 Ga0182005_1000003 3300015265 Bacteria 683269
90 Ga0182005_1005527 3300015265 Bacteria 3942
91 Ga0163161_10008293 3300017792 Bacteria 7194
92 Ga0154015_1454701 3300020610 Bacteria 2341
93 Ga0209784_100008 3300025224 Bacteria 740293
94 Ga0209566_100006 3300025225 Bacteria 789272
95 Ga0209566_100145 3300025225 Bacteria 83624
96 Ga0209566_101286 3300025225 Bacteria 8321
97 Ga0209674_100045 3300025226 Bacteria 362387
98 Ga0209674_107818 3300025226 Bacteria 1317
99 Ga0209672_100015 3300025228 Bacteria 529352
100 Ga0209672_100031 3300025228 Bacteria 332889
101 Ga0209672_100150 3300025228 Bacteria 62635
102 Ga0209672_100158 3300025228 Bacteria 58904
103 Ga0209147_100005 3300025229 Bacteria 1036530
104 Ga0209147_100016 3300025229 Bacteria 527606
105 Ga0209147_100034 3300025229 Bacteria 346646
106 Ga0209147_100040 3300025229 Bacteria 307612
107 Ga0209563_100016 3300025230 Bacteria 802091
108 Ga0209258_100007 3300025242 Bacteria 1036530
109 Ga0209258_100026 3300025242 Bacteria 527606
110 Ga0209258_100061 3300025242 Bacteria 313501
111 Ga0209677_100008 3300025253 Bacteria 802091
112 Ga0209148_1000070 3300025254 Bacteria 332889
113 Ga0209148_1000714 3300025254 Bacteria 26601
114 Ga0209148_1002367 3300025254 Bacteria 6622
115 Ga0209759_1001786 3300025256 Bacteria 10918
116 Ga0209759_1011183 3300025256 Bacteria 2571
117 Ga0209759_1014578 3300025256 Bacteria 2071
118 Ga0209455_1000011 3300025272 Bacteria 947242
119 Ga0209455_1000069 3300025272 Bacteria 308247
120 Ga0209455_1000432 3300025272 Bacteria 32656
121 Ga0209130_1000632 3300025284 Bacteria 33065
122 Ga0209676_1000522 3300025292 Bacteria 60128
123 Ga0209676_1000733 3300025292 Bacteria 44859
124 Ga0209676_1003591 3300025292 Bacteria 9354
125 Ga0209025_1000040 3300025294 Bacteria 376228
126 Ga0209025_1001538 3300025294 Bacteria 29419
127 Ga0209050_1004656 3300025298 Bacteria 9127
128 Ga0207426_1000909 3300025302 Bacteria 29658
129 Ga0207426_1005147 3300025302 Bacteria 6087
130 Ga0209051_1019307 3300025303 Bacteria 2980
131 Ga0209257_1000915 3300025304 Bacteria 41034
132 Ga0207696_1000006 3300025711 Bacteria 616498
133 Ga0207696_1002015 3300025711 Bacteria 10283
134 Ga0207696_1004492 3300025711 Bacteria 6005
135 Ga0207696_1005742 3300025711 Bacteria 5100
136 Ga0207696_1022407 3300025711 Bacteria 2008
137 Ga0207696_1051709 3300025711 Bacteria 1173
138 Ga0207655_1000143 3300025728 Bacteria 137102
139 Ga0207655_1000338 3300025728 Bacteria 68161
140 Ga0207655_1000700 3300025728 Bacteria 38875
141 Ga0207655_1000738 3300025728 Bacteria 36911
142 Ga0207655_1009446 3300025728 Bacteria 6049
143 Ga0207655_1024284 3300025728 Bacteria 2975
144 Ga0207713_1007994 3300025735 Bacteria 6150
145 Ga0207713_1008590 3300025735 Bacteria 5857
146 Ga0207713_1017856 3300025735 Bacteria 3534
147 Ga0207713_1017870 3300025735 Bacteria 3532
148 Ga0207713_1038247 3300025735 Bacteria 2037
149 Ga0207710_10000041 3300025900 Bacteria 228027
150 Ga0207705_10074075 3300025909 Bacteria 2471
151 Ga0207695_10001192 3300025913 Bacteria 44681
152 Ga0207695_10002516 3300025913 Bacteria 26927
153 Ga0207657_10000097 3300025919 Bacteria 83815
154 Ga0207649_10000123 3300025920 Bacteria 65761
155 Ga0207681_10061912 3300025923 Bacteria 2574
156 Ga0207694_10045283 3300025924 Bacteria 3398
157 Ga0207690_10000079 3300025932 Bacteria 83880
158 Ga0207709_10000166 3300025935 Bacteria 89679
159 Ga0207709_10012801 3300025935 Bacteria 4625
160 Ga0207679_10000002 3300025945 Bacteria 634491
161 Ga0207667_10006271 3300025949 Bacteria 14431
162 Ga0207640_10000138 3300025981 Bacteria 53518
163 Ga0207703_10137026 3300026035 Bacteria 2120
164 Ga0207678_10000015 3300026067 Bacteria 138937
165 Ga0207678_10001591 3300026067 Bacteria 20885
166 Ga0207702_10000084 3300026078 Bacteria 106893
167 Ga0207674_10087698 3300026116 Bacteria 3105
168 Ga0207674_10116341 3300026116 Bacteria 2645
169 Ga0207698_10050983 3300026142 Bacteria 3162
170 Ga0209281_1008828 3300027111 Bacteria 2412
171 Ga0209389_1000022 3300027296 Bacteria 166756
172 Ga0209371_1000051 3300027312 Bacteria 276935
173 Ga0209371_1000929 3300027312 Bacteria 22972
174 Ga0209371_1002025 3300027312 Bacteria 12123
175 Ga0307515_10358694 3300028794 Bacteria 1100
176 Ga0268256_1000052 3300030500 Bacteria 276525
177 Ga0268256_1000782 3300030500 Bacteria 22972
178 Ga0268256_1003024 3300030500 Bacteria 7927
179 Ga0316181_1097128 3300030744 Bacteria 1986
180 Ga0307406_10001031 3300031901 Bacteria 15518
181 Ga0307412_10081977 3300031911 Bacteria 2232
182 Ga0307414_10041327 3300032004 Bacteria 3122
183 Ga0307414_10050277 3300032004 Bacteria 2887
184 Ga0307414_10509124 3300032004 Bacteria 1066
185 Ga0307411_10108854 3300032005 Bacteria 1978
186 Ga0395900_0001077 3300037418 Bacteria 34739
187 Ga0237819_06688 3300038705 Bacteria 1711
188 Ga0400483_132244 3300039062 Unclassified 1285
189 Ga0439438_000595 3300041405 Bacteria 16370
190 Ga0439466_0003615 3300041411 Bacteria 5975
191 Ga0439466_0004008 3300041411 Bacteria 5682
192 Ga0451853_0818308 3300041512 Bacteria 1989
193 Ga0439432_001803 3300042006 Bacteria 8033
194 Ga0439432_025268 3300042006 Bacteria 1949
195 Ga0439449_0013047 3300042007 Bacteria 3125
196 Ga0439449_0025239 3300042007 Bacteria 2221
197 Ga0450900_001215 3300042136 Bacteria 2443
198 Ga0450905_001403 3300042142 Bacteria 3071
199 Ga0439464_0006993 3300042439 Bacteria 2947
200 Ga0450901_002609 3300042533 Bacteria 1928
201 Ga0466986_0187285 3300044650 Bacteria 1370
202 Ga0451576_0001712 3300045051 Bacteria 36238
203 Ga0495627_000065 3300046453 Bacteria 132414
204 Ga0495607_0037994 3300046501 Bacteria 2887
205 Ga0495620_0000074 3300046515 Bacteria 81974
206 Ga0495632_0000302 3300046519 Bacteria 47688
207 Ga0495643_0000150 3300046522 Bacteria 113560
208 Ga0495643_0000152 3300046522 Bacteria 112556
209 Ga0495643_0073245 3300046522 Bacteria 1795
210 Ga0495648_0000159 3300046524 Bacteria 80706
211 Ga0495648_0000429 3300046524 Bacteria 46065
212 Ga0495663_0003589 3300046525 Bacteria 4458
213 Ga0495609_0000287 3300046538 Bacteria 46542
214 Ga0495671_0034946 3300046692 Bacteria 2554
215 Ga0495649_0001036 3300046694 Bacteria 21787
216 Ga0495660_0001012 3300046810 Bacteria 20452
217 Ga0495660_0001331 3300046810 Bacteria 16996
218 Ga0495681_0004327 3300047470 Bacteria 9718
219 Ga0495681_0039535 3300047470 Bacteria 2302
220 Ga0495686_0006036 3300047472 Bacteria 9404
221 Ga0495593_0017583 3300047673 Bacteria 4024
222 Ga0496101_0022204 3300048904 Bacteria 4367
223 Ga0496104_0001192 3300048907 Bacteria 22364
224 Ga0496105_0024664 3300048908 Bacteria 4887
225 Ga0496105_0068477 3300048908 Bacteria 2932
226 Ga0496105_0082245 3300048908 Bacteria 2659
227 Ga0496105_0193743 3300048908 Bacteria 1661
228 Ga0496108_0030277 3300048911 Bacteria 4486
229 Ga0496110_0011218 3300048913 Bacteria 7325
230 Ga0496110_0017984 3300048913 Bacteria 5922
231 Ga0496113_0004494 3300048916 Bacteria 8586
232 Ga0496114_0003755 3300048917 Bacteria 11704
233 Ga0496114_0026858 3300048917 Bacteria 4716
234 Ga0496115_0043111 3300048918 Bacteria 3597
235 Ga0496115_0057953 3300048918 Bacteria 3116
236 Ga0496116_0006708 3300048919 Bacteria 10373
237 Ga0496116_0080438 3300048919 Bacteria 2024
238 Ga0496117_0000799 3300048920 Bacteria 48974
239 Ga0496117_0001204 3300048920 Bacteria 38876
240 Ga0496117_0010064 3300048920 Bacteria 8688
241 Ga0496118_0001786 3300048921 Bacteria 31064
242 Ga0496118_0005504 3300048921 Bacteria 14373
243 Ga0496119_0000683 3300048922 Bacteria 45351
244 Ga0496119_0001049 3300048922 Bacteria 35355
245 Ga0496119_0090191 3300048922 Bacteria 1744
246 Ga0496120_0000596 3300048923 Bacteria 54760
247 Ga0496121_0016165 3300048924 Bacteria 7726
248 Ga0496121_0036529 3300048924 Bacteria 4377
249 Ga0496122_0002506 3300048925 Bacteria 25947
250 Ga0496122_0014131 3300048925 Bacteria 7742
251 Ga0496122_0032392 3300048925 Bacteria 4324
252 Ga0496122_0056314 3300048925 Bacteria 2932
253 Ga0496122_0073413 3300048925 Bacteria 2425
254 Ga0496123_0000899 3300048926 Bacteria 47084
255 Ga0496123_0050429 3300048926 Bacteria 2781
256 Ga0496123_0060111 3300048926 Bacteria 2451
257 Ga0496123_0090144 3300048926 Bacteria 1824
258 Ga0496123_0126090 3300048926 Bacteria 1429
259 Ga0496124_0000649 3300048927 Bacteria 57400
260 Ga0496124_0001359 3300048927 Bacteria 36646
261 Ga0496124_0023779 3300048927 Bacteria 5585
262 Ga0496124_0024903 3300048927 Bacteria 5430
263 Ga0496124_0039287 3300048927 Bacteria 4103
264 Ga0496124_0123944 3300048927 Bacteria 2061
265 Ga0496125_0000080 3300048928 Bacteria 228514
266 Ga0496125_0000207 3300048928 Bacteria 122897
267 Ga0496125_0004592 3300048928 Bacteria 15784
268 Ga0496125_0025788 3300048928 Bacteria 5373
269 Ga0496125_0027862 3300048928 Bacteria 5112
270 Ga0496126_0023733 3300048929 Bacteria 5939
271 Ga0496126_0620153 3300048929 Bacteria 850
272 Ga0501034_0000685 3300049571 Bacteria 51551
273 Ga0501240_004483 3300049673 Bacteria 1623
274 nmdc:mga0yw44_33151_c1 3300050492 Bacteria 3015
275 nmdc:mga0sz30_28811_c1 3300050516 Bacteria 2286
276 Ga0500644_0003073 3300053088 Bacteria 4136
277 Ga0500651_0002299 3300053093 Bacteria 10029
278 Ga0500555_009380 3300053103 Bacteria 2800
279 Ga0500659_0001406 3300053135 Bacteria 15275
280 Ga0500622_0007724 3300053156 Bacteria 6073
281 Ga0500622_0121547 3300053156 Bacteria 1266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0620153 Ga0496126_0620153_95_823 242
2 3300048913 Ga0496110_0017984 Ga0496110_0017984_33_773 246
3 3300003856 Ga0058692_1000016 Ga0058692_100001662 265
4 3300005272 Ga0065703_1000124 Ga0065703_100012426 265
5 3300009101 Ga0105247_10000973 Ga0105247_1000097311 265
6 3300025900 Ga0207710_10000041 Ga0207710_1000004118 265
7 3300027312 Ga0209371_1000051 Ga0209371_1000051204 265
8 3300030500 Ga0268256_1000052 Ga0268256_100005262 265
9 3300005289 Ga0065704_10091221 Ga0065704_100912212 273
10 3300025735 Ga0207713_1017856 Ga0207713_10178562 274
11 3300025735 Ga0207713_1038247 Ga0207713_10382471 274
12 3300039062 Ga0400483_132244 Ga0400483_132244_180_1097 281
13 3300025735 Ga0207713_1017870 Ga0207713_10178702 282
14 3300005353 Ga0070669_100000923 Ga0070669_10000092322 283
15 3300009036 Ga0105244_10015219 Ga0105244_100152191 283
16 3300009148 Ga0105243_10000179 Ga0105243_1000017949 283
17 3300013102 Ga0157371_10121912 Ga0157371_101219122 283
18 3300017792 Ga0163161_10008293 Ga0163161_100082936 283
19 3300025711 Ga0207696_1002015 Ga0207696_10020152 283
20 3300025711 Ga0207696_1005742 Ga0207696_10057424 283
21 3300025728 Ga0207655_1000700 Ga0207655_100070012 283
22 3300025735 Ga0207713_1008590 Ga0207713_10085904 283
23 3300025935 Ga0207709_10000166 Ga0207709_1000016655 283
24 3300041411 Ga0439466_0004008 Ga0439466_0004008_3492_4397 283
25 3300046501 Ga0495607_0037994 Ga0495607_0037994_633_1538 283
26 3300046692 Ga0495671_0034946 Ga0495671_0034946_1367_2284 283
27 3300009036 Ga0105244_10014407 Ga0105244_100144071 284
28 3300009092 Ga0105250_10008664 Ga0105250_100086644 284
29 3300025711 Ga0207696_1004492 Ga0207696_10044922 284
30 3300025728 Ga0207655_1000738 Ga0207655_100073812 284
31 3300025923 Ga0207681_10061912 Ga0207681_100619123 284
32 3300031911 Ga0307412_10081977 Ga0307412_100819772 284
33 3300047470 Ga0495681_0039535 Ga0495681_0039535_1205_2170 284
34 3300048926 Ga0496123_0050429 Ga0496123_0050429_243_1166 286
35 3300003781 Ga0055536_1003266 Ga0055536_10032667 287
36 3300025292 Ga0209676_1000733 Ga0209676_10007336 287
37 3300025298 Ga0209050_1004656 Ga0209050_10046566 287
38 3300025304 Ga0209257_1000915 Ga0209257_10009157 287
39 3300031901 Ga0307406_10001031 Ga0307406_100010314 287
40 3300013102 Ga0157371_10197186 Ga0157371_101971862 288
41 3300015261 Ga0182006_1008824 Ga0182006_10088245 288
42 3300025292 Ga0209676_1003591 Ga0209676_10035916 288
43 3300046694 Ga0495649_0001036 Ga0495649_0001036_17474_18403 288
44 3300048908 Ga0496105_0068477 Ga0496105_0068477_527_1447 288
45 3300048918 Ga0496115_0043111 Ga0496115_0043111_1644_2588 288
46 3300042007 Ga0439449_0013047 Ga0439449_0013047_1121_2038 289
47 3300048904 Ga0496101_0022204 Ga0496101_0022204_1589_2509 289
48 3300048907 Ga0496104_0001192 Ga0496104_0001192_12735_13655 289
49 3300048908 Ga0496105_0082245 Ga0496105_0082245_1252_2172 289
50 3300048911 Ga0496108_0030277 Ga0496108_0030277_1829_2749 289
51 3300048916 Ga0496113_0004494 Ga0496113_0004494_5854_6774 289
52 3300042439 Ga0439464_0006993 Ga0439464_0006993_34_948 290
53 3300048925 Ga0496122_0073413 Ga0496122_0073413_1320_2249 290
54 3300048926 Ga0496123_0060111 Ga0496123_0060111_203_1132 290
55 3300048926 Ga0496123_0126090 Ga0496123_0126090_388_1302 290
56 3300053088 Ga0500644_0003073 Ga0500644_0003073_2764_3687 290
57 3300053093 Ga0500651_0002299 Ga0500651_0002299_2174_3097 290
58 3300053156 Ga0500622_0121547 Ga0500622_0121547_260_1189 291
59 3300006944 Ga0099823_1000017 Ga0099823_100001760 292
60 3300009093 Ga0105240_10002961 Ga0105240_100029613 292
61 3300025913 Ga0207695_10002516 Ga0207695_100025163 292
62 3300027296 Ga0209389_1000022 Ga0209389_100002260 292
63 3300032004 Ga0307414_10509124 Ga0307414_105091241 292
64 3300047673 Ga0495593_0017583 Ga0495593_0017583_34_912 292
65 3300049571 Ga0501034_0000685 Ga0501034_0000685_32848_33774 292
66 3300046522 Ga0495643_0000152 Ga0495643_0000152_74059_74976 293
67 3300025909 Ga0207705_10074075 Ga0207705_100740752 294
68 3300046538 Ga0495609_0000287 Ga0495609_0000287_8739_9665 295
69 iso_pu_bacteria 2551306352 2552746766 296
70 iso_pu_bacteria 2639762793 2640735453 296
71 iso_pu_bacteria 2675903507 2678232308 296
72 iso_pu_bacteria 2744054655 2745161283 296
73 iso_pu_bacteria 2773857761 2774391010 296
74 iso_pu_bacteria 2773857770 2774439071 296
75 iso_pu_bacteria 2919182534 2919185794 296
76 iso_pu_bacteria 2919506607 2919507491 296
77 3300013307 Ga0157372_10084160 Ga0157372_100841603 297
78 3300048917 Ga0496114_0003755 Ga0496114_0003755_7661_8578 297
79 3300053135 Ga0500659_0001406 Ga0500659_0001406_8385_9311 297
80 iso_pu_bacteria 2984568884 2984570700 297
81 3300048913 Ga0496110_0011218 Ga0496110_0011218_5887_6804 298
82 3300048927 Ga0496124_0001359 Ga0496124_0001359_27306_28223 298
83 3300048928 Ga0496125_0027862 Ga0496125_0027862_2449_3366 298
84 3300048925 Ga0496122_0014131 Ga0496122_0014131_5076_5993 299
85 3300048926 Ga0496123_0090144 Ga0496123_0090144_835_1752 299
86 iso_pu_bacteria 3007252601 3007253992 299
87 iso_pu_bacteria 3007315729 3007317264 299
88 3300005289 Ga0065704_10002993 Ga0065704_100029935 300
89 3300005289 Ga0065704_10177453 Ga0065704_101774531 300
90 3300009036 Ga0105244_10009088 Ga0105244_100090884 300
91 3300009093 Ga0105240_10058526 Ga0105240_100585263 300
92 3300025728 Ga0207655_1009446 Ga0207655_10094464 300
93 3300042006 Ga0439432_001803 Ga0439432_001803_100_1026 300
94 3300046525 Ga0495663_0003589 Ga0495663_0003589_2262_3167 300
95 3300046810 Ga0495660_0001331 Ga0495660_0001331_11851_12777 300
96 3300048919 Ga0496116_0080438 Ga0496116_0080438_817_1743 300
97 iso_pu_bacteria 8057160832 8057163048 300
98 3300003758 Ga0055532_1001984 Ga0055532_10019844 301
99 3300025225 Ga0209566_100145 Ga0209566_10014557 301
100 3300025226 Ga0209674_107818 Ga0209674_1078181 301
101 3300025229 Ga0209147_100034 Ga0209147_100034107 301
102 iso_pu_bacteria 2511231024 2511375059 301
103 iso_pu_bacteria 2554235231 2555248525 301
104 iso_pu_bacteria 2765235841 2765583650 301
105 iso_pu_bacteria 2806310737 2807408177 301
106 iso_pu_bacteria 2806310745 2807456490 301
107 iso_pu_bacteria 2829745981 2829747334 301
108 iso_pu_bacteria 2919155634 2919159012 301
109 iso_pu_bacteria 2997600082 2997603719 301
110 iso_pu_bacteria 3000017691 3000020201 301
111 iso_pu_bacteria 3007803356 3007808529 301
112 iso_pu_bacteria 3007872151 3007875355 301
113 iso_pu_bacteria 8025530807 8025530995 301
114 iso_pu_bacteria 8033232454 8033235066 301
115 iso_pu_bacteria 8052494512 8052496851 301
116 iso_pu_bacteria 8054929484 8054931527 301
117 iso_pu_bacteria 8056115690 8056119029 301
118 iso_pu_bacteria 8056120720 8056123576 301
119 iso_pu_bacteria 8056137416 8056140547 301
120 3300005327 Ga0070658_10135330 Ga0070658_101353302 302
121 3300005339 Ga0070660_100000855 Ga0070660_10000085510 302
122 3300005366 Ga0070659_100000064 Ga0070659_10000006461 302
123 3300005455 Ga0070663_100014894 Ga0070663_1000148944 302
124 3300005563 Ga0068855_100214199 Ga0068855_1002141992 302
125 3300005616 Ga0068852_100106727 Ga0068852_1001067271 302
126 3300009093 Ga0105240_10029699 Ga0105240_100296996 302
127 3300009545 Ga0105237_10078718 Ga0105237_100787182 302
128 3300009551 Ga0105238_10038906 Ga0105238_100389063 302
129 3300015265 Ga0182005_1005527 Ga0182005_10055274 302
130 3300025919 Ga0207657_10000097 Ga0207657_1000009713 302
131 3300025924 Ga0207694_10045283 Ga0207694_100452832 302
132 3300025932 Ga0207690_10000079 Ga0207690_1000007962 302
133 3300025949 Ga0207667_10006271 Ga0207667_1000627111 302
134 3300026067 Ga0207678_10001591 Ga0207678_1000159110 302
135 3300026142 Ga0207698_10050983 Ga0207698_100509831 302
136 3300032004 Ga0307414_10050277 Ga0307414_100502772 302
137 iso_pu_bacteria 2643221574 2643883635 302
138 iso_pu_bacteria 2643221663 2644354359 302
139 iso_pu_bacteria 2643221699 2644551832 302
140 iso_pu_bacteria 2643221699 2644553139 302
141 iso_pu_bacteria 2643221736 2644744691 302
142 iso_pu_bacteria 2802429634 2806055664 302
143 iso_pu_bacteria 2802429635 2806062621 302
144 iso_pu_bacteria 2841760612 2841763010 302
145 iso_pu_bacteria 2844104063 2844109120 302
146 iso_pu_bacteria 2851182111 2851182293 302
147 iso_pu_bacteria 2851246043 2851251227 302
148 iso_pu_bacteria 640427133 640489972 302
149 iso_pu_bacteria 8057529695 8057534979 302
150 3300005842 Ga0068858_100161992 Ga0068858_1001619921 303
151 3300026035 Ga0207703_10137026 Ga0207703_101370262 303
152 3300027312 Ga0209371_1000929 Ga0209371_10009297 303
153 3300030500 Ga0268256_1000782 Ga0268256_10007827 303
154 3300042006 Ga0439432_025268 Ga0439432_025268_345_1259 303
155 3300045051 Ga0451576_0001712 Ga0451576_0001712_15090_16010 304
156 iso_pu_bacteria 2519103095 2519461644 304
157 iso_pu_bacteria 2537561728 2538424043 304
158 iso_pu_bacteria 2582581311 2585293292 304
159 iso_pu_bacteria 2643221571 2643869642 304
160 iso_pu_bacteria 2675903515 2678263237 304
161 iso_pu_bacteria 2713897090 2715499057 304
162 iso_pu_bacteria 2744054620 2745009569 304
163 iso_pu_bacteria 2808606700 2810366035 304
164 iso_pu_bacteria 2816332253 2817258519 304
165 iso_pu_bacteria 2816332256 2817281067 304
166 iso_pu_bacteria 2816332286 2817453213 304
167 iso_pu_bacteria 2855730933 2855736612 304
168 iso_pu_bacteria 2855767633 2855773549 304
169 iso_pu_bacteria 2871272651 2871273931 304
170 iso_pu_bacteria 2881412998 2881418449 304
171 iso_pu_bacteria 2905926851 2905930318 304
172 iso_pu_bacteria 2919476304 2919479031 304
173 iso_pu_bacteria 2919481497 2919483788 304
174 iso_pu_bacteria 2931369376 2931370047 304
175 iso_pu_bacteria 2946003308 2946006641 304
176 iso_pu_bacteria 2988728565 2988733876 304
177 iso_pu_bacteria 3007315729 3007318120 304
178 iso_pu_bacteria 3007419365 3007421979 304
179 iso_pu_bacteria 8020807995 8020809199 304
180 iso_pu_bacteria 8020953355 8020957355 304
181 iso_pu_bacteria 8040167225 8040167619 304
182 iso_pu_bacteria 8040173305 8040177678 304
183 iso_pu_bacteria 8056131705 8056134027 304
184 iso_pu_bacteria 8056166840 8056169564 304
185 3300003354 JGI25160J50197_1004000 JGI25160J50197_10040008 305
186 3300003781 Ga0055536_1017772 Ga0055536_10177722 305
187 3300005289 Ga0065704_10001549 Ga0065704_100015497 305
188 3300005289 Ga0065704_10003232 Ga0065704_100032322 305
189 3300006038 Ga0075365_10033687 Ga0075365_100336872 305
190 3300009011 Ga0105251_10042410 Ga0105251_100424102 305
191 3300009011 Ga0105251_10050954 Ga0105251_100509542 305
192 3300009036 Ga0105244_10000533 Ga0105244_1000053314 305
193 3300009036 Ga0105244_10024211 Ga0105244_100242113 305
194 3300009036 Ga0105244_10047402 Ga0105244_100474022 305
195 3300009036 Ga0105244_10072524 Ga0105244_100725242 305
196 3300009092 Ga0105250_10010311 Ga0105250_100103113 305
197 3300009092 Ga0105250_10034677 Ga0105250_100346772 305
198 3300009092 Ga0105250_10049099 Ga0105250_100490992 305
199 3300009148 Ga0105243_10022252 Ga0105243_100222524 305
200 3300009148 Ga0105243_10131650 Ga0105243_101316502 305
201 3300013104 Ga0157370_10085273 Ga0157370_100852732 305
202 3300025292 Ga0209676_1000522 Ga0209676_100052214 305
203 3300025302 Ga0207426_1000909 Ga0207426_100090911 305
204 3300025711 Ga0207696_1000006 Ga0207696_1000006464 305
205 3300025711 Ga0207696_1022407 Ga0207696_10224072 305
206 3300025711 Ga0207696_1051709 Ga0207696_10517092 305
207 3300025728 Ga0207655_1000143 Ga0207655_100014315 305
208 3300025728 Ga0207655_1000338 Ga0207655_100033838 305
209 3300025728 Ga0207655_1024284 Ga0207655_10242842 305
210 3300025735 Ga0207713_1007994 Ga0207713_10079944 305
211 3300025935 Ga0207709_10012801 Ga0207709_100128013 305
212 3300027312 Ga0209371_1002025 Ga0209371_10020253 305
213 3300030500 Ga0268256_1003024 Ga0268256_10030247 305
214 3300041512 Ga0451853_0818308 Ga0451853_0818308_576_1493 305
215 3300042007 Ga0439449_0025239 Ga0439449_0025239_460_1377 305
216 3300042136 Ga0450900_001215 Ga0450900_001215_267_1184 305
217 3300042142 Ga0450905_001403 Ga0450905_001403_1121_2038 305
218 3300042533 Ga0450901_002609 Ga0450901_002609_355_1272 305
219 3300046515 Ga0495620_0000074 Ga0495620_0000074_6345_7262 305
220 3300046519 Ga0495632_0000302 Ga0495632_0000302_35966_36883 305
221 3300046522 Ga0495643_0000150 Ga0495643_0000150_61811_62728 305
222 3300046524 Ga0495648_0000159 Ga0495648_0000159_74047_74964 305
223 3300048917 Ga0496114_0026858 Ga0496114_0026858_293_1210 305
224 3300048919 Ga0496116_0006708 Ga0496116_0006708_2852_3769 305
225 3300048920 Ga0496117_0000799 Ga0496117_0000799_5749_6666 305
226 3300048920 Ga0496117_0001204 Ga0496117_0001204_26370_27287 305
227 3300048920 Ga0496117_0010064 Ga0496117_0010064_142_1059 305
228 3300048921 Ga0496118_0001786 Ga0496118_0001786_18220_19137 305
229 3300048921 Ga0496118_0005504 Ga0496118_0005504_3448_4365 305
230 3300048922 Ga0496119_0000683 Ga0496119_0000683_30628_31545 305
231 3300048922 Ga0496119_0090191 Ga0496119_0090191_598_1515 305
232 3300048923 Ga0496120_0000596 Ga0496120_0000596_13804_14721 305
233 3300048924 Ga0496121_0016165 Ga0496121_0016165_3349_4266 305
234 3300048925 Ga0496122_0002506 Ga0496122_0002506_17615_18532 305
235 3300048925 Ga0496122_0032392 Ga0496122_0032392_109_1026 305
236 3300048925 Ga0496122_0056314 Ga0496122_0056314_1844_2761 305
237 3300048926 Ga0496123_0000899 Ga0496123_0000899_28554_29471 305
238 3300048927 Ga0496124_0000649 Ga0496124_0000649_47051_47968 305
239 3300048927 Ga0496124_0024903 Ga0496124_0024903_923_1840 305
240 3300048927 Ga0496124_0039287 Ga0496124_0039287_920_1837 305
241 3300048928 Ga0496125_0000080 Ga0496125_0000080_200788_201705 305
242 3300048928 Ga0496125_0000207 Ga0496125_0000207_62190_63107 305
243 3300048928 Ga0496125_0025788 Ga0496125_0025788_1621_2538 305
244 3300048929 Ga0496126_0023733 Ga0496126_0023733_4606_5523 305
245 3300050492 nmdc:mga0yw44_33151_c1 nmdc:mga0yw44_33151_c1_196_1113 305
246 3300053103 Ga0500555_009380 Ga0500555_009380_179_1096 305
247 iso_pu_bacteria 2595698237 2596376430 305
248 iso_pu_bacteria 2599185178 2599446293 305
249 iso_pu_bacteria 2599185239 2599735116 305
250 iso_pu_bacteria 2599185240 2599743251 305
251 iso_pu_bacteria 2599185355 2600205517 305
252 iso_pu_bacteria 2675903129 2676740814 305
253 iso_pu_bacteria 2802429633 2806048209 305
254 iso_pu_bacteria 2808606384 2808970983 305
255 iso_pu_bacteria 2808606390 2809005814 305
256 iso_pu_bacteria 2808606391 2809012429 305
257 iso_pu_bacteria 2818991452 2819632024 305
258 iso_pu_bacteria 2842775625 2842779374 305
259 iso_pu_bacteria 2857710386 2857711637 305
260 iso_pu_bacteria 2863421361 2863422418 305
261 iso_pu_bacteria 2870068957 2870072642 305
262 iso_pu_bacteria 2885266251 2885266678 305
263 iso_pu_bacteria 2902405164 2902408209 305
264 iso_pu_bacteria 2917699015 2917700316 305
265 iso_pu_bacteria 2928058823 2928059439 305
266 iso_pu_bacteria 2928125067 2928128138 305
267 iso_pu_bacteria 2928157003 2928157126 305
268 iso_pu_bacteria 2928163908 2928168957 305
269 iso_pu_bacteria 2928170801 2928172193 305
270 iso_pu_bacteria 2929199973 2929201873 305
271 iso_pu_bacteria 3000405567 3000408751 305
272 iso_pu_bacteria 3003665799 3003666831 305
273 iso_pu_bacteria 643348564 643604401 305
274 iso_pu_bacteria 8018845410 8018852059 305
275 iso_pu_bacteria 8020938398 8020939736 305
276 iso_pu_bacteria 8020945358 8020945767 305
277 iso_pu_bacteria 8021120328 8021120464 305
278 iso_pu_bacteria 8054563764 8054567858 305
279 iso_pu_bacteria 8055909800 8055910863 305
280 3300002987 JGI25159J45721_1009135 JGI25159J45721_10091351 306
281 3300005262 Ga0065165_1000218 Ga0065165_100021877 306
282 3300025284 Ga0209130_1000632 Ga0209130_10006321 306
283 3300025294 Ga0209025_1001538 Ga0209025_100153825 306
284 3300025302 Ga0207426_1005147 Ga0207426_10051473 306
285 3300032004 Ga0307414_10041327 Ga0307414_100413273 306
286 3300038705 Ga0237819_06688 Ga0237819_06688_698_1618 306
287 3300048908 Ga0496105_0024664 Ga0496105_0024664_1747_2667 306
288 3300048908 Ga0496105_0193743 Ga0496105_0193743_52_972 306
289 3300048918 Ga0496115_0057953 Ga0496115_0057953_539_1483 306
290 3300048922 Ga0496119_0001049 Ga0496119_0001049_29664_30608 306
291 iso_pu_bacteria 2545555834 2545677313 306
292 iso_pu_bacteria 2599185302 2599941499 306
293 iso_pu_bacteria 2599185304 2599952981 306
294 iso_pu_bacteria 2599185309 2599982765 306
295 iso_pu_bacteria 2599185310 2599989634 306
296 iso_pu_bacteria 2599185312 2599998531 306
297 iso_pu_bacteria 2599185320 2600047209 306
298 iso_pu_bacteria 2842698319 2842701560 306
299 iso_pu_bacteria 641522639 641640717 306
300 3300046453 Ga0495627_000065 Ga0495627_000065_34030_34956 307
301 3300046522 Ga0495643_0073245 Ga0495643_0073245_37_963 307
302 3300046810 Ga0495660_0001012 Ga0495660_0001012_7071_7997 307
303 3300047470 Ga0495681_0004327 Ga0495681_0004327_1823_2749 307
304 3300048924 Ga0496121_0036529 Ga0496121_0036529_3106_4029 307
305 3300003187 JGI25151J46595_10000567 JGI25151J46595_100005674 308
306 3300006946 Ga0079104_1023544 Ga0079104_10235442 308
307 3300013100 Ga0157373_10002760 Ga0157373_1000276010 308
308 3300013307 Ga0157372_10222214 Ga0157372_102222142 308
309 3300015261 Ga0182006_1000055 Ga0182006_100005546 308
310 3300015265 Ga0182005_1000003 Ga0182005_1000003255 308
311 3300025294 Ga0209025_1000040 Ga0209025_100004028 308
312 3300027111 Ga0209281_1008828 Ga0209281_10088283 308
313 3300032005 Ga0307411_10108854 Ga0307411_101088542 308
314 3300041405 Ga0439438_000595 Ga0439438_000595_5261_6232 308
315 3300041411 Ga0439466_0003615 Ga0439466_0003615_847_1773 308
316 3300046524 Ga0495648_0000429 Ga0495648_0000429_10674_11600 308
317 3300047472 Ga0495686_0006036 Ga0495686_0006036_6352_7278 308
318 3300048927 Ga0496124_0023779 Ga0496124_0023779_2200_3126 308
319 3300048927 Ga0496124_0123944 Ga0496124_0123944_308_1234 308
320 3300049673 Ga0501240_004483 Ga0501240_004483_99_1025 308
321 iso_pu_bacteria 2858466076 2858467462 308
322 3300001979 JGI24740J21852_10001495 JGI24740J21852_100014959 309
323 3300002705 JGI25156J39149_1003003 JGI25156J39149_10030036 309
324 3300002705 JGI25156J39149_1011585 JGI25156J39149_10115852 309
325 3300003752 Ga0055539_1000059 Ga0055539_100005948 309
326 3300003758 Ga0055532_1000025 Ga0055532_1000025122 309
327 3300003758 Ga0055532_1001466 Ga0055532_10014664 309
328 3300003758 Ga0055532_1002447 Ga0055532_10024472 309
329 3300003759 Ga0055525_1000682 Ga0055525_100068210 309
330 3300003760 Ga0055527_1000292 Ga0055527_100029223 309
331 3300003760 Ga0055527_1000561 Ga0055527_10005616 309
332 3300003760 Ga0055527_1001110 Ga0055527_10011105 309
333 3300003761 Ga0055535_1000019 Ga0055535_1000019122 309
334 3300003761 Ga0055535_1000267 Ga0055535_100026733 309
335 3300003761 Ga0055535_1000345 Ga0055535_100034523 309
336 3300003762 Ga0055542_1000175 Ga0055542_100017560 309
337 3300003762 Ga0055542_1000681 Ga0055542_100068123 309
338 3300003763 Ga0055529_1000035 Ga0055529_100003585 309
339 3300003763 Ga0055529_1000131 Ga0055529_100013133 309
340 3300005344 Ga0070661_100000047 Ga0070661_10000004728 309
341 3300005455 Ga0070663_100000009 Ga0070663_100000009134 309
342 3300005564 Ga0070664_100000011 Ga0070664_100000011122 309
343 3300005577 Ga0068857_100043086 Ga0068857_1000430862 309
344 3300005578 Ga0068854_100000017 Ga0068854_10000001746 309
345 3300005614 Ga0068856_100001403 Ga0068856_1000014036 309
346 3300006186 Ga0075369_10053090 Ga0075369_100530902 309
347 3300013100 Ga0157373_10004276 Ga0157373_1000427611 309
348 3300013102 Ga0157371_10000033 Ga0157371_10000033122 309
349 3300013104 Ga0157370_10000010 Ga0157370_10000010121 309
350 3300013105 Ga0157369_10000625 Ga0157369_1000062543 309
351 3300013307 Ga0157372_10000176 Ga0157372_1000017643 309
352 3300020610 Ga0154015_1454701 Ga0154015_14547012 309
353 3300025224 Ga0209784_100008 Ga0209784_100008308 309
354 3300025225 Ga0209566_100006 Ga0209566_100006308 309
355 3300025225 Ga0209566_101286 Ga0209566_1012866 309
356 3300025226 Ga0209674_100045 Ga0209674_1000453 309
357 3300025228 Ga0209672_100015 Ga0209672_10001537 309
358 3300025228 Ga0209672_100031 Ga0209672_10003198 309
359 3300025228 Ga0209672_100150 Ga0209672_1001509 309
360 3300025228 Ga0209672_100158 Ga0209672_1001584 309
361 3300025229 Ga0209147_100005 Ga0209147_100005303 309
362 3300025229 Ga0209147_100016 Ga0209147_100016427 309
363 3300025229 Ga0209147_100040 Ga0209147_100040180 309
364 3300025230 Ga0209563_100016 Ga0209563_100016308 309
365 3300025242 Ga0209258_100007 Ga0209258_100007303 309
366 3300025242 Ga0209258_100026 Ga0209258_10002637 309
367 3300025242 Ga0209258_100061 Ga0209258_100061184 309
368 3300025253 Ga0209677_100008 Ga0209677_100008384 309
369 3300025254 Ga0209148_1000070 Ga0209148_1000070201 309
370 3300025254 Ga0209148_1000714 Ga0209148_10007149 309
371 3300025254 Ga0209148_1002367 Ga0209148_10023677 309
372 3300025256 Ga0209759_1001786 Ga0209759_100178612 309
373 3300025256 Ga0209759_1011183 Ga0209759_10111832 309
374 3300025256 Ga0209759_1014578 Ga0209759_10145782 309
375 3300025272 Ga0209455_1000011 Ga0209455_1000011228 309
376 3300025272 Ga0209455_1000069 Ga0209455_100006978 309
377 3300025272 Ga0209455_1000432 Ga0209455_10004323 309
378 3300025303 Ga0209051_1019307 Ga0209051_10193073 309
379 3300025913 Ga0207695_10001192 Ga0207695_1000119227 309
380 3300025920 Ga0207649_10000123 Ga0207649_1000012323 309
381 3300025945 Ga0207679_10000002 Ga0207679_10000002411 309
382 3300025981 Ga0207640_10000138 Ga0207640_1000013820 309
383 3300026067 Ga0207678_10000015 Ga0207678_1000001541 309
384 3300026078 Ga0207702_10000084 Ga0207702_1000008472 309
385 3300026116 Ga0207674_10087698 Ga0207674_100876982 309
386 3300026116 Ga0207674_10116341 Ga0207674_101163413 309
387 3300028794 Ga0307515_10358694 Ga0307515_103586941 309
388 3300037418 Ga0395900_0001077 Ga0395900_0001077_27479_28432 309
389 3300044650 Ga0466986_0187285 Ga0466986_0187285_279_1232 309
390 3300048928 Ga0496125_0004592 Ga0496125_0004592_12181_13134 309
391 3300050516 nmdc:mga0sz30_28811_c1 nmdc:mga0sz30_28811_c1_863_1792 309
392 3300053156 Ga0500622_0007724 Ga0500622_0007724_2491_3420 309
393 iso_pu_bacteria 2738541281 2738745274 309
394 iso_pu_bacteria 2738543032 2739354504 309
395 iso_pu_bacteria 2981990288 2981994972 309
396 2162886011 MRS1b_contig_4053450 MRS1b_0763.00002300 310
397 3300005290 Ga0065712_10067740 Ga0065712_1006774047 310
398 3300014497 Ga0182008_10004841 Ga0182008_100048414 310
399 3300030744 Ga0316181_1097128 Ga0316181_10971282 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03547

Mem_trans

Membrane transport protein

195

344

0.95

PF01758

SBF

Sodium Bile acid symporter family

244

351

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7766 2 307
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7657 2 307
7y9u-assembly1.cif.gz_A structure of the auxin exporter pin1 in arabidopsis thaliana in the npa-bound state 0.7329 4 310
7y9u-assembly1.cif.gz_A structure of the auxin exporter pin1 in arabidopsis thaliana in the npa-bound state 0.7248 4 310
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.722 4 310
ID Description Score Start End Superfamily
af_Q9C9K5_10_382_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8139 8 300 1.20.1530.20
af_Q9LFP6_9_362_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.808 5 304 1.20.1530.20
af_Q5JLM1_10_355_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7981 8 301 1.20.1530.20
af_Q0JJV0_10_302_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7896 6 304 1.20.1530.20
af_K7LKA4_9_392_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7841 5 300 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A077LIX6-F1-model_v4 Auxin efflux carrier 0.9773 1 308 GO:0005886
GO:0055085
AF-A0A077LIX6-F1-model_v4 Auxin efflux carrier 0.9742 1 308 GO:0005886
GO:0055085
AF-A0A3S1A5E8-F1-model_v4 deleted 0.9704 2 306
AF-A0A2N3EKR8-F1-model_v4 AEC family transporter 0.9654 3 250 GO:0016020
AF-A0A4V3YR70-F1-model_v4 AEC family transporter 0.9649 4 302 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
92.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map