F434489

General Info

Members Datasets Scaffolds Average Seq Length
400 213 800 172

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10001862|Ga0070676_100018627
Length 177
Sequence MNFEYKSLLNHEFDPGSRVWIYQSSRLFTISEALQIEEMINQFAANWDSHGVPVKAAAYLFFGQFVVLMADETATGVSGCSTDSSVRLIKEIEKTFAVNMFDRLALAFIVKDRSESYRIQIVPMPQLKYAVEHGFITADTLFFNNVVLTKEELENNWIVPAKDSWLAKKISFPNTVS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 1.25
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10001862 3300005328 Bacteria 10739
2 MRS1b_contig_4285567 2162886011 Unclassified 868
3 JGI24033J26618_1031365 3300002155 Unclassified 716
4 rootH1_10055331 3300003316 Bacteria 13942
5 rootH1_10144783 3300003316 Bacteria 1566
6 rootH2_10011844 3300003320 Bacteria 47214
7 rootH2_10042039 3300003320 Bacteria 5114
8 rootH2_10156130 3300003320 Bacteria 2136
9 rootH2_10177383 3300003320 Bacteria 1304
10 JGI25160J50197_1001859 3300003354 Bacteria 10131
11 JGI25160J50197_1006232 3300003354 Bacteria 4850
12 Ga0055526_1020612 3300003771 Bacteria 2335
13 Ga0055528_1000434 3300003790 Bacteria 33559
14 Ga0055530_10002451 3300003791 Bacteria 11926
15 Ga0065165_1000012 3300005262 Bacteria 303241
16 Ga0065714_10218078 3300005288 Bacteria 848
17 Ga0065712_10004562 3300005290 Bacteria 3402
18 Ga0065712_10108886 3300005290 Bacteria 1865
19 Ga0065712_10189136 3300005290 Bacteria 1156
20 Ga0065712_10276151 3300005290 Unclassified 905
21 Ga0065715_10569046 3300005293 Bacteria 728
22 Ga0065715_10701251 3300005293 Bacteria 653
23 Ga0070683_100000211 3300005329 Bacteria 39486
24 Ga0070683_100003981 3300005329 Bacteria 12096
25 Ga0070683_100035474 3300005329 Bacteria 4559
26 Ga0070690_100369629 3300005330 Bacteria 1046
27 Ga0070670_100023878 3300005331 Bacteria 5260
28 Ga0070670_100131414 3300005331 Bacteria 2162
29 Ga0068869_100055434 3300005334 Unclassified 2889
30 Ga0068869_100957732 3300005334 Bacteria 743
31 Ga0070666_10046730 3300005335 Bacteria 2905
32 Ga0070666_10102400 3300005335 Bacteria 1975
33 Ga0070666_10258883 3300005335 Bacteria 1233
34 Ga0070666_10669538 3300005335 Bacteria 760
35 Ga0068868_100006735 3300005338 Bacteria 8157
36 Ga0068868_100038859 3300005338 Bacteria 3694
37 Ga0070689_100004082 3300005340 Bacteria 9834
38 Ga0070689_100138841 3300005340 Bacteria 1953
39 Ga0070689_100319798 3300005340 Bacteria 1296
40 Ga0070689_100964490 3300005340 Bacteria 757
41 Ga0070689_101350194 3300005340 Bacteria 643
42 Ga0070691_10008404 3300005341 Bacteria 4728
43 Ga0070661_100006697 3300005344 Bacteria 7947
44 Ga0070661_100007080 3300005344 Bacteria 7738
45 Ga0070661_101173000 3300005344 Bacteria 642
46 Ga0070668_100010123 3300005347 Bacteria 6990
47 Ga0070669_100002091 3300005353 Bacteria 14439
48 Ga0070669_100134446 3300005353 Bacteria 1901
49 Ga0070675_100005185 3300005354 Bacteria 9936
50 Ga0070675_100053677 3300005354 Bacteria 3315
51 Ga0070675_100839946 3300005354 Bacteria 840
52 Ga0070675_101012592 3300005354 Bacteria 763
53 Ga0070671_100083827 3300005355 Bacteria 2666
54 Ga0070671_100528338 3300005355 Unclassified 1016
55 Ga0070671_101156050 3300005355 Unclassified 680
56 Ga0070674_100370875 3300005356 Bacteria 1162
57 Ga0070673_100007156 3300005364 Bacteria 7331
58 Ga0070673_100011359 3300005364 Bacteria 6077
59 Ga0070673_100099711 3300005364 Bacteria 2390
60 Ga0070673_100474104 3300005364 Bacteria 1129
61 Ga0070688_100012960 3300005365 Bacteria 4689
62 Ga0070688_100030958 3300005365 Bacteria 3215
63 Ga0070688_100076784 3300005365 Bacteria 2151
64 Ga0070659_100148669 3300005366 Bacteria 1910
65 Ga0070667_100061418 3300005367 Unclassified 3182
66 Ga0070700_100331321 3300005441 Bacteria 1122
67 Ga0070678_100254984 3300005456 Bacteria 1472
68 Ga0070662_100002740 3300005457 Bacteria 10892
69 Ga0070662_100002963 3300005457 Bacteria 10548
70 Ga0070662_100888980 3300005457 Unclassified 760
71 Ga0068867_100026915 3300005459 Unclassified 4132
72 Ga0068867_100076052 3300005459 Bacteria 2520
73 Ga0068867_100470333 3300005459 Bacteria 1075
74 Ga0068867_100541406 3300005459 Bacteria 1007
75 Ga0070684_100000568 3300005535 Bacteria 25497
76 Ga0070684_100006999 3300005535 Bacteria 8761
77 Ga0070684_100018337 3300005535 Bacteria 5764
78 Ga0070684_100048387 3300005535 Bacteria 3689
79 Ga0068853_100589843 3300005539 Bacteria 1055
80 Ga0068853_101112531 3300005539 Unclassified 762
81 Ga0070672_100073108 3300005543 Bacteria 2732
82 Ga0070672_100127800 3300005543 Bacteria 2086
83 Ga0070672_100288215 3300005543 Bacteria 1390
84 Ga0070693_100245424 3300005547 Bacteria 1185
85 Ga0070665_100000009 3300005548 Bacteria 562640
86 Ga0070665_100069649 3300005548 Bacteria 3526
87 Ga0070665_101262981 3300005548 Bacteria 749
88 Ga0070704_100633209 3300005549 Bacteria 943
89 Ga0070704_100708197 3300005549 Unclassified 893
90 Ga0068855_100000420 3300005563 Bacteria 52301
91 Ga0068855_101209827 3300005563 Bacteria 785
92 Ga0070664_100003902 3300005564 Bacteria 12033
93 Ga0070664_100038086 3300005564 Bacteria 4046
94 Ga0070664_100356373 3300005564 Unclassified 1332
95 Ga0070664_100641492 3300005564 Bacteria 987
96 Ga0070664_101382383 3300005564 Bacteria 665
97 Ga0068857_100019417 3300005577 Bacteria 5967
98 Ga0068857_100092047 3300005577 Bacteria 2715
99 Ga0068857_100118697 3300005577 Bacteria 2381
100 Ga0068854_100010782 3300005578 Bacteria 5930
101 Ga0068854_100122753 3300005578 Unclassified 1974
102 Ga0068852_100024963 3300005616 Bacteria 4837
103 Ga0068852_100027265 3300005616 Bacteria 4655
104 Ga0068852_100890242 3300005616 Bacteria 907
105 Ga0068859_100012192 3300005617 Bacteria 8641
106 Ga0068859_100014826 3300005617 Bacteria 7828
107 Ga0068859_100029379 3300005617 Bacteria 5516
108 Ga0068859_100610591 3300005617 Bacteria 1183
109 Ga0068859_100797554 3300005617 Bacteria 1032
110 Ga0068859_101603986 3300005617 Unclassified 719
111 Ga0068864_100011587 3300005618 Bacteria 7281
112 Ga0068864_101831620 3300005618 Unclassified 612
113 Ga0068866_10544930 3300005718 Bacteria 775
114 Ga0068861_100003143 3300005719 Bacteria 10914
115 Ga0068861_100447305 3300005719 Bacteria 1157
116 Ga0068851_10423279 3300005834 Bacteria 787
117 Ga0068851_10542744 3300005834 Unclassified 702
118 Ga0068870_10022215 3300005840 Bacteria 3115
119 Ga0068870_10196916 3300005840 Bacteria 1219
120 Ga0068863_100675915 3300005841 Bacteria 1025
121 Ga0068858_101909583 3300005842 Bacteria 587
122 Ga0068860_100002588 3300005843 Bacteria 18925
123 Ga0068860_100208123 3300005843 Bacteria 1897
124 Ga0068860_100386317 3300005843 Bacteria 1383
125 Ga0068862_100008262 3300005844 Bacteria 8611
126 Ga0068862_100406926 3300005844 Bacteria 1274
127 Ga0081540_1021508 3300005983 Bacteria 3837
128 Ga0070715_10145418 3300006163 Unclassified 1156
129 Ga0097621_100052642 3300006237 Bacteria 3317
130 Ga0097621_100057466 3300006237 Bacteria 3182
131 Ga0097621_100126154 3300006237 Unclassified 2174
132 Ga0097621_100458439 3300006237 Bacteria 1149
133 Ga0068871_100102663 3300006358 Bacteria 2397
134 Ga0068871_100199992 3300006358 Unclassified 1725
135 Ga0068865_100094281 3300006881 Bacteria 2178
136 Ga0068865_101173217 3300006881 Bacteria 679
137 Ga0097620_100012190 3300006931 Bacteria 8641
138 Ga0097620_100014825 3300006931 Bacteria 7828
139 Ga0097620_100029379 3300006931 Bacteria 5516
140 Ga0097620_100610612 3300006931 Bacteria 1183
141 Ga0097620_100797528 3300006931 Bacteria 1032
142 Ga0097620_101603941 3300006931 Unclassified 719
143 Ga0105251_10086077 3300009011 Unclassified 1448
144 Ga0105240_10001038 3300009093 Bacteria 49382
145 Ga0105240_10002800 3300009093 Bacteria 27570
146 Ga0105240_10021663 3300009093 Bacteria 8544
147 Ga0105240_10055254 3300009093 Bacteria 4972
148 Ga0105240_10056004 3300009093 Bacteria 4935
149 Ga0111539_10003454 3300009094 Bacteria 20812
150 Ga0105247_10042855 3300009101 Bacteria 2772
151 Ga0105247_10452117 3300009101 Bacteria 926
152 Ga0105243_12310399 3300009148 Bacteria 575
153 Ga0105241_10002316 3300009174 Bacteria 14311
154 Ga0105241_10031420 3300009174 Bacteria 3976
155 Ga0105241_10682759 3300009174 Bacteria 936
156 Ga0105242_10119045 3300009176 Bacteria 2263
157 Ga0105242_10279118 3300009176 Bacteria 1517
158 Ga0105242_11075480 3300009176 Bacteria 817
159 Ga0105242_11761973 3300009176 Unclassified 657
160 Ga0105248_10174430 3300009177 Bacteria 2423
161 Ga0105237_10011712 3300009545 Bacteria 9274
162 Ga0105238_10011425 3300009551 Bacteria 8943
163 Ga0105238_10633630 3300009551 Bacteria 1078
164 Ga0105249_10178213 3300009553 Bacteria 2066
165 Ga0105249_10316891 3300009553 Bacteria 1570
166 Ga0105249_11244534 3300009553 Unclassified 816
167 Ga0105249_11655256 3300009553 Bacteria 712
168 Ga0105239_10436936 3300010375 Bacteria 1484
169 Ga0105239_11345580 3300010375 Bacteria 824
170 Ga0157373_10023654 3300013100 Bacteria 4453
171 Ga0157371_10276471 3300013102 Bacteria 1212
172 Ga0157371_10921366 3300013102 Bacteria 663
173 Ga0157370_10003477 3300013104 Bacteria 18480
174 Ga0157370_10144485 3300013104 Bacteria 2216
175 Ga0157370_10758258 3300013104 Unclassified 884
176 Ga0157369_10035029 3300013105 Bacteria 5505
177 Ga0157369_10310655 3300013105 Bacteria 1639
178 Ga0157374_10008376 3300013296 Bacteria 8829
179 Ga0157374_10014583 3300013296 Bacteria 6879
180 Ga0157374_10041964 3300013296 Bacteria 4219
181 Ga0157374_10085372 3300013296 Bacteria 3002
182 Ga0157374_10588081 3300013296 Bacteria 1122
183 Ga0157378_10085627 3300013297 Bacteria 2855
184 Ga0157378_10169072 3300013297 Bacteria 2049
185 Ga0157378_10907548 3300013297 Unclassified 912
186 Ga0163162_10001119 3300013306 Bacteria 24928
187 Ga0163162_10004586 3300013306 Bacteria 13309
188 Ga0163162_10030596 3300013306 Bacteria 5334
189 Ga0163162_10042898 3300013306 Bacteria 4528
190 Ga0163162_10059108 3300013306 Unclassified 3865
191 Ga0163162_10112703 3300013306 Bacteria 2818
192 Ga0163162_10210084 3300013306 Bacteria 2076
193 Ga0163162_11012808 3300013306 Unclassified 939
194 Ga0163162_11131428 3300013306 Bacteria 887
195 Ga0157372_10001229 3300013307 Bacteria 27743
196 Ga0157372_10084009 3300013307 Bacteria 3607
197 Ga0157375_10005137 3300013308 Bacteria 11365
198 Ga0157375_10062903 3300013308 Bacteria 3689
199 Ga0157375_10146074 3300013308 Bacteria 2496
200 Ga0157375_10390186 3300013308 Bacteria 1559
201 Ga0157375_10984479 3300013308 Bacteria 984
202 Ga0157375_11105043 3300013308 Bacteria 928
203 Ga0157375_11129612 3300013308 Unclassified 918
204 Ga0157375_12347063 3300013308 Bacteria 636
205 Ga0163163_10000462 3300014325 Bacteria 37124
206 Ga0163163_10387571 3300014325 Bacteria 1455
207 Ga0163163_11018518 3300014325 Bacteria 891
208 Ga0157380_10001175 3300014326 Bacteria 16963
209 Ga0157380_10396958 3300014326 Bacteria 1307
210 Ga0157380_10469041 3300014326 Bacteria 1214
211 Ga0157380_11099866 3300014326 Bacteria 834
212 Ga0157377_10003472 3300014745 Bacteria 7142
213 Ga0157377_10010978 3300014745 Bacteria 4503
214 Ga0157377_10157403 3300014745 Unclassified 1410
215 Ga0157379_10110547 3300014968 Bacteria 2468
216 Ga0157379_10151626 3300014968 Bacteria 2091
217 Ga0157379_10412900 3300014968 Bacteria 1242
218 Ga0157376_10005255 3300014969 Bacteria 9041
219 Ga0157376_10078192 3300014969 Bacteria 2832
220 Ga0157376_10695611 3300014969 Bacteria 1021
221 Ga0157376_10915220 3300014969 Bacteria 896
222 Ga0163161_10193242 3300017792 Bacteria 1565
223 Ga0163161_10297614 3300017792 Bacteria 1270
224 Ga0163161_10776880 3300017792 Bacteria 803
225 Ga0209673_1000515 3300025273 Bacteria 63365
226 Ga0209564_1005082 3300025295 Bacteria 7672
227 Ga0209758_1153406 3300025297 Unclassified 581
228 Ga0209050_1000887 3300025298 Bacteria 39898
229 Ga0207426_1000019 3300025302 Bacteria 558579
230 Ga0207426_1004429 3300025302 Bacteria 6855
231 Ga0209051_1114816 3300025303 Unclassified 695
232 Ga0209257_1002689 3300025304 Bacteria 17008
233 Ga0207697_10045638 3300025315 Bacteria 1804
234 Ga0207642_10322016 3300025899 Bacteria 903
235 Ga0207688_10396109 3300025901 Bacteria 856
236 Ga0207685_10347102 3300025905 Unclassified 747
237 Ga0207643_10027207 3300025908 Bacteria 3169
238 Ga0207654_10011114 3300025911 Bacteria 4582
239 Ga0207707_10179491 3300025912 Bacteria 1849
240 Ga0207695_10000060 3300025913 Bacteria 360217
241 Ga0207695_10005392 3300025913 Bacteria 16989
242 Ga0207695_10130845 3300025913 Bacteria 2467
243 Ga0207695_10295585 3300025913 Bacteria 1511
244 Ga0207695_10461528 3300025913 Bacteria 1153
245 Ga0207671_10015766 3300025914 Bacteria 5901
246 Ga0207649_10005106 3300025920 Bacteria 7094
247 Ga0207649_10005653 3300025920 Bacteria 6769
248 Ga0207681_10125317 3300025923 Bacteria 1890
249 Ga0207694_10019559 3300025924 Bacteria 5120
250 Ga0207694_10886479 3300025924 Bacteria 754
251 Ga0207650_10137224 3300025925 Bacteria 1920
252 Ga0207650_10412478 3300025925 Bacteria 1119
253 Ga0207659_10019428 3300025926 Bacteria 4474
254 Ga0207644_10291786 3300025931 Unclassified 1312
255 Ga0207644_10591952 3300025931 Bacteria 920
256 Ga0207706_10015309 3300025933 Bacteria 6933
257 Ga0207706_10029962 3300025933 Bacteria 4857
258 Ga0207706_10032827 3300025933 Bacteria 4620
259 Ga0207706_10873781 3300025933 Unclassified 760
260 Ga0207670_10020660 3300025936 Bacteria 4050
261 Ga0207670_10343934 3300025936 Bacteria 1179
262 Ga0207691_10126450 3300025940 Bacteria 2261
263 Ga0207691_10316906 3300025940 Bacteria 1337
264 Ga0207691_10567806 3300025940 Bacteria 961
265 Ga0207689_10003496 3300025942 Bacteria 14357
266 Ga0207689_10013015 3300025942 Bacteria 7104
267 Ga0207689_10400559 3300025942 Unclassified 1144
268 Ga0207661_10003519 3300025944 Bacteria 10883
269 Ga0207661_10013659 3300025944 Bacteria 5929
270 Ga0207679_10000391 3300025945 Bacteria 31474
271 Ga0207679_10031399 3300025945 Bacteria 3718
272 Ga0207679_10290393 3300025945 Bacteria 1406
273 Ga0207679_10735465 3300025945 Unclassified 897
274 Ga0207667_10000241 3300025949 Bacteria 76753
275 Ga0207667_10938043 3300025949 Bacteria 855
276 Ga0207651_10120370 3300025960 Bacteria 1990
277 Ga0207651_10211558 3300025960 Bacteria 1561
278 Ga0207651_10244964 3300025960 Unclassified 1463
279 Ga0207712_10334239 3300025961 Bacteria 1254
280 Ga0207668_10057455 3300025972 Bacteria 2714
281 Ga0207668_10474149 3300025972 Bacteria 1072
282 Ga0207640_10607027 3300025981 Bacteria 927
283 Ga0207658_10057839 3300025986 Bacteria 2883
284 Ga0207677_10019332 3300026023 Bacteria 4112
285 Ga0207677_10024930 3300026023 Bacteria 3724
286 Ga0207677_10489812 3300026023 Unclassified 1061
287 Ga0207703_10236491 3300026035 Bacteria 1640
288 Ga0207703_11929419 3300026035 Unclassified 567
289 Ga0207639_10104081 3300026041 Bacteria 2301
290 Ga0207639_10122332 3300026041 Bacteria 2140
291 Ga0207639_10801377 3300026041 Bacteria 878
292 Ga0207678_10401140 3300026067 Bacteria 1187
293 Ga0207708_10248820 3300026075 Bacteria 1432
294 Ga0207648_10006979 3300026089 Bacteria 11173
295 Ga0207648_10066441 3300026089 Bacteria 3145
296 Ga0207648_10163339 3300026089 Unclassified 1967
297 Ga0207648_10437858 3300026089 Bacteria 1189
298 Ga0207648_10493055 3300026089 Bacteria 1120
299 Ga0207676_10002355 3300026095 Bacteria 13499
300 Ga0207676_11079762 3300026095 Bacteria 793
301 Ga0207676_11275954 3300026095 Bacteria 729
302 Ga0207674_10001890 3300026116 Bacteria 26652
303 Ga0207674_10004509 3300026116 Bacteria 16740
304 Ga0207674_10122406 3300026116 Bacteria 2568
305 Ga0207674_10291369 3300026116 Bacteria 1581
306 Ga0207675_100000359 3300026118 Bacteria 43729
307 Ga0207683_10125395 3300026121 Bacteria 2307
308 Ga0207698_10040174 3300026142 Bacteria 3473
309 Ga0207698_10181425 3300026142 Bacteria 1865
310 Ga0207698_10314011 3300026142 Bacteria 1465
311 Ga0268266_10000105 3300028379 Bacteria 176691
312 Ga0268266_10036019 3300028379 Bacteria 4210
313 Ga0268265_10004817 3300028380 Bacteria 9303
314 Ga0268265_10873490 3300028380 Bacteria 881
315 Ga0268264_10001619 3300028381 Bacteria 20805
316 Ga0307517_10000963 3300028786 Bacteria 48832
317 Ga0307511_10000135 3300030521 Bacteria 67934
318 Ga0307508_10000446 3300031616 Bacteria 49383
319 Ga0307516_10042048 3300031730 Bacteria 4536
320 Ga0307518_10208793 3300031838 Bacteria 1288
321 Ga0307510_10000555 3300033180 Bacteria 37450
322 Ga0373936_0182889 3300035113 Bacteria 920
323 Ga0373954_0165696 3300035118 Bacteria 1082
324 Ga0373956_0269588 3300035119 Bacteria 810
325 Ga0373957_0323890 3300035120 Bacteria 656
326 Ga0373946_0211011 3300035171 Bacteria 934
327 Ga0373955_0008913 3300035172 Bacteria 4679
328 Ga0373924_0099576 3300035410 Bacteria 1249
329 Ga0373935_0074191 3300035692 Bacteria 2199
330 Ga0373933_0160969 3300035724 Bacteria 1425
331 Ga0373937_0016236 3300036401 Bacteria 6607
332 Ga0373937_0845507 3300036401 Bacteria 863
333 Ga0436365_1079918 3300039437 Bacteria 37760
334 Ga0439465_0039189 3300041413 Bacteria 1529
335 Ga0451807_2329102 3300041486 Bacteria 718
336 Ga0451843_1645753 3300041509 Unclassified 528
337 Ga0466972_0034851 3300044658 Bacteria 2464
338 Ga0466961_0131645 3300044693 Bacteria 1567
339 Ga0466971_0124147 3300044719 Bacteria 1196
340 Ga0466968_0033338 3300044735 Bacteria 2146
341 Ga0466970_0017449 3300044765 Bacteria 3710
342 Ga0466959_0145688 3300045049 Bacteria 1671
343 Ga0466958_0159131 3300045836 Bacteria 1426
344 Ga0495592_0092667 3300046454 Bacteria 2165
345 Ga0495638_0019515 3300046460 Bacteria 4486
346 Ga0495638_0070770 3300046460 Bacteria 2135
347 Ga0495653_0246440 3300046463 Unclassified 1188
348 Ga0495582_0089763 3300046473 Bacteria 1713
349 Ga0495594_0614933 3300046499 Bacteria 616
350 Ga0495628_0006489 3300046516 Bacteria 10215
351 Ga0495630_0178656 3300046517 Bacteria 1618
352 Ga0495630_0853362 3300046517 Bacteria 694
353 Ga0495648_0005425 3300046524 Bacteria 10597
354 Ga0495640_0729215 3300046533 Unclassified 593
355 Ga0495586_0048876 3300046535 Bacteria 2287
356 Ga0495586_0057600 3300046535 Bacteria 2109
357 Ga0495667_0245972 3300046559 Bacteria 1139
358 Ga0495634_0074194 3300046642 Bacteria 2236
359 Ga0495625_0104050 3300046660 Unclassified 1946
360 Ga0495625_0534757 3300046660 Bacteria 712
361 Ga0495635_0640948 3300046663 Bacteria 692
362 Ga0495657_0067426 3300046675 Bacteria 2349
363 Ga0495599_0489286 3300046678 Bacteria 725
364 Ga0495623_0086750 3300046679 Bacteria 1929
365 Ga0495658_0046672 3300046683 Bacteria 2436
366 Ga0495674_0119110 3300047319 Bacteria 2232
367 Ga0495674_0371113 3300047319 Bacteria 1159
368 Ga0495672_0023122 3300047320 Bacteria 4030
369 Ga0495672_0084088 3300047320 Bacteria 1766
370 Ga0495676_0274830 3300047321 Bacteria 1142
371 Ga0495684_0329752 3300047471 Bacteria 1089
372 Ga0495684_0361331 3300047471 Unclassified 1028
373 Ga0496104_0409679 3300048907 Bacteria 1268
374 Ga0496110_0108822 3300048913 Bacteria 2489
375 Ga0496114_0652794 3300048917 Unclassified 925
376 Ga0496115_0237337 3300048918 Bacteria 1503
377 Ga0501034_0000017 3300049571 Bacteria 285938
378 Ga0501034_0051387 3300049571 Bacteria 4156
379 Ga0501036_0929195 3300049572 Unclassified 713
380 Ga0501037_0090592 3300049573 Bacteria 2212
381 Ga0501038_0233554 3300049574 Bacteria 1462
382 Ga0501039_0568273 3300049575 Bacteria 889
383 Ga0501043_0028122 3300049579 Bacteria 4413
384 Ga0501046_0088565 3300049580 Bacteria 2384
385 Ga0501073_0307305 3300049589 Bacteria 1094
386 Ga0501035_0123439 3300049822 Bacteria 2262
387 Ga0501044_0537311 3300049823 Bacteria 1067
388 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
389 Ga0500644_0356917 3300053088 Bacteria 633
390 Ga0500646_0001531 3300053090 Bacteria 6095
391 Ga0500583_0001398 3300053092 Bacteria 6911
392 Ga0500562_000010 3300053108 Bacteria 183815
393 Ga0500642_0052915 3300053130 Bacteria 1799
394 Ga0500568_0103112 3300053139 Bacteria 1069
395 Ga0500616_0015241 3300053153 Unclassified 4400
396 Ga0500622_0001907 3300053156 Bacteria 15724
397 Ga0500645_024504 3300053730 Bacteria 1844
398 Ga0500661_004290 3300055283 Bacteria 2666
399 Ga0466962_0104595 3300061719 Bacteria 1360
400 2929156807 2929154850 Bacteria 6753285
401 Ga0070676_10001862
402 MRS1b_contig_4285567
403 JGI24033J26618_1031365
404 rootH1_10055331
405 rootH1_10144783
406 rootH2_10011844
407 rootH2_10042039
408 rootH2_10156130
409 rootH2_10177383
410 JGI25160J50197_1001859
411 JGI25160J50197_1006232
412 Ga0055526_1020612
413 Ga0055528_1000434
414 Ga0055530_10002451
415 Ga0065165_1000012
416 Ga0065714_10218078
417 Ga0065712_10004562
418 Ga0065712_10108886
419 Ga0065712_10189136
420 Ga0065712_10276151
421 Ga0065715_10569046
422 Ga0065715_10701251
423 Ga0070683_100000211
424 Ga0070683_100003981
425 Ga0070683_100035474
426 Ga0070690_100369629
427 Ga0070670_100023878
428 Ga0070670_100131414
429 Ga0068869_100055434
430 Ga0068869_100957732
431 Ga0070666_10046730
432 Ga0070666_10102400
433 Ga0070666_10258883
434 Ga0070666_10669538
435 Ga0068868_100006735
436 Ga0068868_100038859
437 Ga0070689_100004082
438 Ga0070689_100138841
439 Ga0070689_100319798
440 Ga0070689_100964490
441 Ga0070689_101350194
442 Ga0070691_10008404
443 Ga0070661_100006697
444 Ga0070661_100007080
445 Ga0070661_101173000
446 Ga0070668_100010123
447 Ga0070669_100002091
448 Ga0070669_100134446
449 Ga0070675_100005185
450 Ga0070675_100053677
451 Ga0070675_100839946
452 Ga0070675_101012592
453 Ga0070671_100083827
454 Ga0070671_100528338
455 Ga0070671_101156050
456 Ga0070674_100370875
457 Ga0070673_100007156
458 Ga0070673_100011359
459 Ga0070673_100099711
460 Ga0070673_100474104
461 Ga0070688_100012960
462 Ga0070688_100030958
463 Ga0070688_100076784
464 Ga0070659_100148669
465 Ga0070667_100061418
466 Ga0070700_100331321
467 Ga0070678_100254984
468 Ga0070662_100002740
469 Ga0070662_100002963
470 Ga0070662_100888980
471 Ga0068867_100026915
472 Ga0068867_100076052
473 Ga0068867_100470333
474 Ga0068867_100541406
475 Ga0070684_100000568
476 Ga0070684_100006999
477 Ga0070684_100018337
478 Ga0070684_100048387
479 Ga0068853_100589843
480 Ga0068853_101112531
481 Ga0070672_100073108
482 Ga0070672_100127800
483 Ga0070672_100288215
484 Ga0070693_100245424
485 Ga0070665_100000009
486 Ga0070665_100069649
487 Ga0070665_101262981
488 Ga0070704_100633209
489 Ga0070704_100708197
490 Ga0068855_100000420
491 Ga0068855_101209827
492 Ga0070664_100003902
493 Ga0070664_100038086
494 Ga0070664_100356373
495 Ga0070664_100641492
496 Ga0070664_101382383
497 Ga0068857_100019417
498 Ga0068857_100092047
499 Ga0068857_100118697
500 Ga0068854_100010782
501 Ga0068854_100122753
502 Ga0068852_100024963
503 Ga0068852_100027265
504 Ga0068852_100890242
505 Ga0068859_100012192
506 Ga0068859_100014826
507 Ga0068859_100029379
508 Ga0068859_100610591
509 Ga0068859_100797554
510 Ga0068859_101603986
511 Ga0068864_100011587
512 Ga0068864_101831620
513 Ga0068866_10544930
514 Ga0068861_100003143
515 Ga0068861_100447305
516 Ga0068851_10423279
517 Ga0068851_10542744
518 Ga0068870_10022215
519 Ga0068870_10196916
520 Ga0068863_100675915
521 Ga0068858_101909583
522 Ga0068860_100002588
523 Ga0068860_100208123
524 Ga0068860_100386317
525 Ga0068862_100008262
526 Ga0068862_100406926
527 Ga0081540_1021508
528 Ga0070715_10145418
529 Ga0097621_100052642
530 Ga0097621_100057466
531 Ga0097621_100126154
532 Ga0097621_100458439
533 Ga0068871_100102663
534 Ga0068871_100199992
535 Ga0068865_100094281
536 Ga0068865_101173217
537 Ga0097620_100012190
538 Ga0097620_100014825
539 Ga0097620_100029379
540 Ga0097620_100610612
541 Ga0097620_100797528
542 Ga0097620_101603941
543 Ga0105251_10086077
544 Ga0105240_10001038
545 Ga0105240_10002800
546 Ga0105240_10021663
547 Ga0105240_10055254
548 Ga0105240_10056004
549 Ga0111539_10003454
550 Ga0105247_10042855
551 Ga0105247_10452117
552 Ga0105243_12310399
553 Ga0105241_10002316
554 Ga0105241_10031420
555 Ga0105241_10682759
556 Ga0105242_10119045
557 Ga0105242_10279118
558 Ga0105242_11075480
559 Ga0105242_11761973
560 Ga0105248_10174430
561 Ga0105237_10011712
562 Ga0105238_10011425
563 Ga0105238_10633630
564 Ga0105249_10178213
565 Ga0105249_10316891
566 Ga0105249_11244534
567 Ga0105249_11655256
568 Ga0105239_10436936
569 Ga0105239_11345580
570 Ga0157373_10023654
571 Ga0157371_10276471
572 Ga0157371_10921366
573 Ga0157370_10003477
574 Ga0157370_10144485
575 Ga0157370_10758258
576 Ga0157369_10035029
577 Ga0157369_10310655
578 Ga0157374_10008376
579 Ga0157374_10014583
580 Ga0157374_10041964
581 Ga0157374_10085372
582 Ga0157374_10588081
583 Ga0157378_10085627
584 Ga0157378_10169072
585 Ga0157378_10907548
586 Ga0163162_10001119
587 Ga0163162_10004586
588 Ga0163162_10030596
589 Ga0163162_10042898
590 Ga0163162_10059108
591 Ga0163162_10112703
592 Ga0163162_10210084
593 Ga0163162_11012808
594 Ga0163162_11131428
595 Ga0157372_10001229
596 Ga0157372_10084009
597 Ga0157375_10005137
598 Ga0157375_10062903
599 Ga0157375_10146074
600 Ga0157375_10390186
601 Ga0157375_10984479
602 Ga0157375_11105043
603 Ga0157375_11129612
604 Ga0157375_12347063
605 Ga0163163_10000462
606 Ga0163163_10387571
607 Ga0163163_11018518
608 Ga0157380_10001175
609 Ga0157380_10396958
610 Ga0157380_10469041
611 Ga0157380_11099866
612 Ga0157377_10003472
613 Ga0157377_10010978
614 Ga0157377_10157403
615 Ga0157379_10110547
616 Ga0157379_10151626
617 Ga0157379_10412900
618 Ga0157376_10005255
619 Ga0157376_10078192
620 Ga0157376_10695611
621 Ga0157376_10915220
622 Ga0163161_10193242
623 Ga0163161_10297614
624 Ga0163161_10776880
625 Ga0209673_1000515
626 Ga0209564_1005082
627 Ga0209758_1153406
628 Ga0209050_1000887
629 Ga0207426_1000019
630 Ga0207426_1004429
631 Ga0209051_1114816
632 Ga0209257_1002689
633 Ga0207697_10045638
634 Ga0207642_10322016
635 Ga0207688_10396109
636 Ga0207685_10347102
637 Ga0207643_10027207
638 Ga0207654_10011114
639 Ga0207707_10179491
640 Ga0207695_10000060
641 Ga0207695_10005392
642 Ga0207695_10130845
643 Ga0207695_10295585
644 Ga0207695_10461528
645 Ga0207671_10015766
646 Ga0207649_10005106
647 Ga0207649_10005653
648 Ga0207681_10125317
649 Ga0207694_10019559
650 Ga0207694_10886479
651 Ga0207650_10137224
652 Ga0207650_10412478
653 Ga0207659_10019428
654 Ga0207644_10291786
655 Ga0207644_10591952
656 Ga0207706_10015309
657 Ga0207706_10029962
658 Ga0207706_10032827
659 Ga0207706_10873781
660 Ga0207670_10020660
661 Ga0207670_10343934
662 Ga0207691_10126450
663 Ga0207691_10316906
664 Ga0207691_10567806
665 Ga0207689_10003496
666 Ga0207689_10013015
667 Ga0207689_10400559
668 Ga0207661_10003519
669 Ga0207661_10013659
670 Ga0207679_10000391
671 Ga0207679_10031399
672 Ga0207679_10290393
673 Ga0207679_10735465
674 Ga0207667_10000241
675 Ga0207667_10938043
676 Ga0207651_10120370
677 Ga0207651_10211558
678 Ga0207651_10244964
679 Ga0207712_10334239
680 Ga0207668_10057455
681 Ga0207668_10474149
682 Ga0207640_10607027
683 Ga0207658_10057839
684 Ga0207677_10019332
685 Ga0207677_10024930
686 Ga0207677_10489812
687 Ga0207703_10236491
688 Ga0207703_11929419
689 Ga0207639_10104081
690 Ga0207639_10122332
691 Ga0207639_10801377
692 Ga0207678_10401140
693 Ga0207708_10248820
694 Ga0207648_10006979
695 Ga0207648_10066441
696 Ga0207648_10163339
697 Ga0207648_10437858
698 Ga0207648_10493055
699 Ga0207676_10002355
700 Ga0207676_11079762
701 Ga0207676_11275954
702 Ga0207674_10001890
703 Ga0207674_10004509
704 Ga0207674_10122406
705 Ga0207674_10291369
706 Ga0207675_100000359
707 Ga0207683_10125395
708 Ga0207698_10040174
709 Ga0207698_10181425
710 Ga0207698_10314011
711 Ga0268266_10000105
712 Ga0268266_10036019
713 Ga0268265_10004817
714 Ga0268265_10873490
715 Ga0268264_10001619
716 Ga0307517_10000963
717 Ga0307511_10000135
718 Ga0307508_10000446
719 Ga0307516_10042048
720 Ga0307518_10208793
721 Ga0307510_10000555
722 Ga0373936_0182889
723 Ga0373954_0165696
724 Ga0373956_0269588
725 Ga0373957_0323890
726 Ga0373946_0211011
727 Ga0373955_0008913
728 Ga0373924_0099576
729 Ga0373935_0074191
730 Ga0373933_0160969
731 Ga0373937_0016236
732 Ga0373937_0845507
733 Ga0436365_1079918
734 Ga0439465_0039189
735 Ga0451807_2329102
736 Ga0451843_1645753
737 Ga0466972_0034851
738 Ga0466961_0131645
739 Ga0466971_0124147
740 Ga0466968_0033338
741 Ga0466970_0017449
742 Ga0466959_0145688
743 Ga0466958_0159131
744 Ga0495592_0092667
745 Ga0495638_0019515
746 Ga0495638_0070770
747 Ga0495653_0246440
748 Ga0495582_0089763
749 Ga0495594_0614933
750 Ga0495628_0006489
751 Ga0495630_0178656
752 Ga0495630_0853362
753 Ga0495648_0005425
754 Ga0495640_0729215
755 Ga0495586_0048876
756 Ga0495586_0057600
757 Ga0495667_0245972
758 Ga0495634_0074194
759 Ga0495625_0104050
760 Ga0495625_0534757
761 Ga0495635_0640948
762 Ga0495657_0067426
763 Ga0495599_0489286
764 Ga0495623_0086750
765 Ga0495658_0046672
766 Ga0495674_0119110
767 Ga0495674_0371113
768 Ga0495672_0023122
769 Ga0495672_0084088
770 Ga0495676_0274830
771 Ga0495684_0329752
772 Ga0495684_0361331
773 Ga0496104_0409679
774 Ga0496110_0108822
775 Ga0496114_0652794
776 Ga0496115_0237337
777 Ga0501034_0000017
778 Ga0501034_0051387
779 Ga0501036_0929195
780 Ga0501037_0090592
781 Ga0501038_0233554
782 Ga0501039_0568273
783 Ga0501043_0028122
784 Ga0501046_0088565
785 Ga0501073_0307305
786 Ga0501035_0123439
787 Ga0501044_0537311
788 nmdc:mga08y16_3350_c1
789 Ga0500644_0356917
790 Ga0500646_0001531
791 Ga0500583_0001398
792 Ga0500562_000010
793 Ga0500642_0052915
794 Ga0500568_0103112
795 Ga0500616_0015241
796 Ga0500622_0001907
797 Ga0500645_024504
798 Ga0500661_004290
799 Ga0466962_0104595
800 2929156807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ng3-assembly1.cif.gz_D structure of inactive kinase rip2k(k47r) 0.7017 19 71
5ng3-assembly2.cif.gz_B structure of inactive kinase rip2k(k47r) 0.7012 19 71
1im4-assembly1.cif.gz_A crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus 0.6794 31 100
1kqk-assembly1.cif.gz_A solution structure of the n-terminal domain of a potential copper-translocating p-type atpase from bacillus subtilis in the cu(i)loaded state 0.6667 17 100
3j09-assembly1.cif.gz_A high resolution helical reconstruction of the bacterial p-type atpase copper transporter copa 0.6656 102 137
ID Description Score Start End Superfamily
af_Q86ME2_118_392_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.749 17 70 1.10.510.10
af_P9WPS7_255_365_2.70.150.10 Mainly Beta;Distorted Sandwich;Calcium-transporting ATPase, cytoplasmic transduction domain A;Calcium-transporting ATPase, cytoplasmic transduction domain A 0.7239 103 137 2.70.150.10
1x0pA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6421 17 91 3.30.70.100
4pquC02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.6364 9 102 3.30.70.270
af_K7M9R3_64_144_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.632 14 99 3.30.70.100
ID Description Score Start End GO Terms
AF-Q84CU7-F1-model_v4 ABC transporter ATPase 0.9755 1 153
AF-A0A7Y2BCL2-F1-model_v4 ABC transporter ATPase 0.9734 12 163
AF-A0A7Y2FV79-F1-model_v4 ABC transporter ATPase 0.9693 12 163
AF-Q84CU7-F1-model_v4 ABC transporter ATPase 0.9693 1 153
AF-A0A522QVJ2-F1-model_v4 ABC transporter ATPase 0.9663 1 164

Map