F434533

General Info

Members Datasets Scaffolds Average Seq Length
400 223 400 336

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100076107|Ga0068855_1000761073
Length 317
Sequence MKTKWIVAVVSWILSATAAVAQNAPVVVRVGYFPNVTHSQALVGRARGDFDRAVGPSARIEWKTFNAGPSVIEALFAGALDLAYVGPNPTINGYVRSHGEALRVIAGATSGGASLVVRPGANINKAEDFHGKRIASPQLGNTQDVALRSWLAAHNLKLREKGGDVQVIPIANPDQLTLFQKGEIDAAWAPEPWASRLIEEAGARLFLDERDLWPSRQFVTTNLIVTEWIRKTPRAAQAVVNEQIQKDTGKALPPKVLESAFSRLEVTYDPLRGSLLRSAQTAYDLGLLGRVPPNLDGLYELSPLNEVLREKKALPIQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_483180 2162886011 Unclassified 3143
2 LJNas_1000489 3300000546 Bacteria 6934
3 JGI24747J21853_1005364 3300001978 Bacteria 1181
4 JGI24743J22301_10000793 3300001991 Bacteria 3976
5 JGI24034J26672_10000449 3300002239 Bacteria 5318
6 JGI24751J29686_10007194 3300002459 Bacteria 2274
7 Ga0065715_10119057 3300005293 Bacteria 2288
8 Ga0070658_10199275 3300005327 Bacteria 1689
9 Ga0070676_10017135 3300005328 Bacteria 4008
10 Ga0070683_100009516 3300005329 Bacteria 8317
11 Ga0070690_100005169 3300005330 Bacteria 7305
12 Ga0070670_100083400 3300005331 Unclassified 2746
13 Ga0070670_100224227 3300005331 Bacteria 1636
14 Ga0070677_10002354 3300005333 Bacteria 6041
15 Ga0068869_100030930 3300005334 Bacteria 3763
16 Ga0068869_100109041 3300005334 Bacteria 2104
17 Ga0070666_10023824 3300005335 Bacteria 3985
18 Ga0070682_100016901 3300005337 Bacteria 4247
19 Ga0068868_100003111 3300005338 Bacteria 11551
20 Ga0070660_100003557 3300005339 Bacteria 10759
21 Ga0070689_100042906 3300005340 Bacteria 3474
22 Ga0070687_100014073 3300005343 Bacteria 3584
23 Ga0070661_100041894 3300005344 Bacteria 3341
24 Ga0070669_100017651 3300005353 Bacteria 5090
25 Ga0070669_100329841 3300005353 Bacteria 1234
26 Ga0070675_100067553 3300005354 Bacteria 2958
27 Ga0070671_100054051 3300005355 Bacteria 3338
28 Ga0070674_100022066 3300005356 Bacteria 4101
29 Ga0070673_100060420 3300005364 Bacteria 3003
30 Ga0070659_100022927 3300005366 Bacteria 4772
31 Ga0070667_100166658 3300005367 Unclassified 1943
32 Ga0070709_10001571 3300005434 Bacteria 12327
33 Ga0070709_10011001 3300005434 Bacteria 5027
34 Ga0070709_10029691 3300005434 Bacteria 3274
35 Ga0070709_10074461 3300005434 Bacteria 2200
36 Ga0070709_10098268 3300005434 Bacteria 1945
37 Ga0070709_10236375 3300005434 Bacteria 1310
38 Ga0070714_100000211 3300005435 Bacteria 46913
39 Ga0070714_100032355 3300005435 Bacteria 4365
40 Ga0070714_100186313 3300005435 Bacteria 1891
41 Ga0070714_100209709 3300005435 Bacteria 1785
42 Ga0070714_100323744 3300005435 Unclassified 1442
43 Ga0070714_100435779 3300005435 Unclassified 1243
44 Ga0070713_100000084 3300005436 Bacteria 59438
45 Ga0070713_100028305 3300005436 Bacteria 4424
46 Ga0070713_100029007 3300005436 Bacteria 4376
47 Ga0070713_100029331 3300005436 Bacteria 4356
48 Ga0070713_100030673 3300005436 Bacteria 4272
49 Ga0070713_100068457 3300005436 Bacteria 2991
50 Ga0070710_10021880 3300005437 Bacteria 3338
51 Ga0070710_10040278 3300005437 Bacteria 2575
52 Ga0070711_100012633 3300005439 Bacteria 5281
53 Ga0070711_100083305 3300005439 Bacteria 2285
54 Ga0070708_100002005 3300005445 Bacteria 15668
55 Ga0070708_100004717 3300005445 Bacteria 10741
56 Ga0070708_100015788 3300005445 Bacteria 6243
57 Ga0070708_100086923 3300005445 Bacteria 2840
58 Ga0070663_100038054 3300005455 Bacteria 3353
59 Ga0070678_100017905 3300005456 Bacteria 4576
60 Ga0070662_100004500 3300005457 Bacteria 8831
61 Ga0070681_10070893 3300005458 Bacteria 3449
62 Ga0068867_100013981 3300005459 Bacteria 5683
63 Ga0070685_10012151 3300005466 Bacteria 4517
64 Ga0070706_100002168 3300005467 Bacteria 19959
65 Ga0070706_100003312 3300005467 Bacteria 15905
66 Ga0070706_100061960 3300005467 Bacteria 3455
67 Ga0070707_100010644 3300005468 Bacteria 8569
68 Ga0070707_100046910 3300005468 Unclassified 4135
69 Ga0070707_100229183 3300005468 Bacteria 1809
70 Ga0070698_100007279 3300005471 Bacteria 11988
71 Ga0070698_100010519 3300005471 Bacteria 9862
72 Ga0070698_100284119 3300005471 Bacteria 1586
73 Ga0070699_100001122 3300005518 Bacteria 24931
74 Ga0070679_100039953 3300005530 Bacteria 4664
75 Ga0070684_100001029 3300005535 Bacteria 19881
76 Ga0070697_100000113 3300005536 Bacteria 63284
77 Ga0070697_100001895 3300005536 Bacteria 15983
78 Ga0070697_100003932 3300005536 Bacteria 11419
79 Ga0070697_100051840 3300005536 Bacteria 3334
80 Ga0070697_100068609 3300005536 Bacteria 2903
81 Ga0070697_100103355 3300005536 Bacteria 2368
82 Ga0068853_100014734 3300005539 Bacteria 6416
83 Ga0070672_100021012 3300005543 Bacteria 4772
84 Ga0070686_100055363 3300005544 Bacteria 2541
85 Ga0070693_100005731 3300005547 Bacteria 5999
86 Ga0068855_100007705 3300005563 Bacteria 13003
87 Ga0068855_100076107 3300005563 Bacteria 3896
88 Ga0070664_100028212 3300005564 Bacteria 4669
89 Ga0070664_100099512 3300005564 Bacteria 2527
90 Ga0068857_100044186 3300005577 Bacteria 3951
91 Ga0068854_100013331 3300005578 Bacteria 5392
92 Ga0068856_100004317 3300005614 Bacteria 14185
93 Ga0068856_100028316 3300005614 Bacteria 5470
94 Ga0068856_100043165 3300005614 Bacteria 4437
95 Ga0068856_100134047 3300005614 Bacteria 2482
96 Ga0068852_100168762 3300005616 Unclassified 2049
97 Ga0068852_100298643 3300005616 Unclassified 1558
98 Ga0068859_100012693 3300005617 Bacteria 8471
99 Ga0068864_100042535 3300005618 Bacteria 3888
100 Ga0068866_10002988 3300005718 Bacteria 6979
101 Ga0068851_10002764 3300005834 Bacteria 7732
102 Ga0068851_10067814 3300005834 Bacteria 1841
103 Ga0068870_10004267 3300005840 Bacteria 6144
104 Ga0068863_100100702 3300005841 Unclassified 2746
105 Ga0068860_100251439 3300005843 Bacteria 1721
106 Ga0068862_100032586 3300005844 Bacteria 4403
107 Ga0070717_10001346 3300006028 Bacteria 16894
108 Ga0070717_10005388 3300006028 Bacteria 9339
109 Ga0070717_10026174 3300006028 Bacteria 4651
110 Ga0070717_10028247 3300006028 Bacteria 4489
111 Ga0070717_10096139 3300006028 Unclassified 2508
112 Ga0070717_10115430 3300006028 Unclassified 2295
113 Ga0070717_10143846 3300006028 Bacteria 2058
114 Ga0070717_10172579 3300006028 Bacteria 1881
115 Ga0070717_10176147 3300006028 Bacteria 1862
116 Ga0070717_10176931 3300006028 Bacteria 1858
117 Ga0070715_10030993 3300006163 Archaea 2167
118 Ga0070716_100000274 3300006173 Bacteria 20780
119 Ga0070716_100004401 3300006173 Bacteria 6734
120 Ga0070716_100033987 3300006173 Bacteria 2793
121 Ga0070712_100000106 3300006175 Bacteria 43079
122 Ga0070712_100003376 3300006175 Bacteria 9818
123 Ga0070712_100004726 3300006175 Bacteria 8423
124 Ga0070712_100008733 3300006175 Bacteria 6380
125 Ga0097621_100001385 3300006237 Bacteria 16681
126 Ga0097621_100091669 3300006237 Unclassified 2544
127 Ga0097621_100474960 3300006237 Bacteria 1129
128 Ga0068871_100009154 3300006358 Bacteria 7157
129 Ga0068871_100065405 3300006358 Bacteria 2978
130 Ga0075433_10000913 3300006852 Bacteria 20789
131 Ga0075434_100000253 3300006871 Bacteria 37649
132 Ga0068865_100035676 3300006881 Bacteria 3347
133 Ga0075436_100000619 3300006914 Bacteria 23292
134 Ga0075436_100003061 3300006914 Bacteria 11456
135 Ga0075436_100017510 3300006914 Bacteria 4907
136 Ga0097620_100012693 3300006931 Bacteria 8471
137 Ga0075435_100000234 3300007076 Bacteria 34046
138 Ga0075435_100001191 3300007076 Bacteria 16636
139 Ga0105250_10026365 3300009092 Bacteria 2341
140 Ga0105240_10010114 3300009093 Bacteria 13274
141 Ga0105240_10021993 3300009093 Bacteria 8471
142 Ga0105240_10440199 3300009093 Bacteria 1461
143 Ga0105240_10459146 3300009093 Bacteria 1424
144 Ga0105245_10016297 3300009098 Bacteria 6480
145 Ga0105245_10153136 3300009098 Bacteria 2182
146 Ga0105241_10004717 3300009174 Bacteria 10052
147 Ga0105241_10005045 3300009174 Bacteria 9744
148 Ga0105241_10112117 3300009174 Bacteria 2185
149 Ga0105242_10200791 3300009176 Bacteria 1771
150 Ga0105248_10143437 3300009177 Bacteria 2695
151 Ga0105248_10169118 3300009177 Unclassified 2464
152 Ga0105237_10011974 3300009545 Bacteria 9168
153 Ga0105237_10093251 3300009545 Bacteria 3000
154 Ga0105237_10110057 3300009545 Unclassified 2747
155 Ga0105238_10088815 3300009551 Bacteria 3077
156 Ga0105238_10109055 3300009551 Bacteria 2750
157 Ga0105249_10003240 3300009553 Bacteria 14099
158 Ga0099796_10003148 3300010159 Bacteria 3770
159 Ga0105239_10265482 3300010375 Unclassified 1930
160 Ga0105239_10331679 3300010375 Unclassified 1716
161 Ga0105246_10010534 3300011119 Bacteria 5726
162 Ga0157373_10003878 3300013100 Bacteria 11302
163 Ga0157373_10028714 3300013100 Bacteria 4012
164 Ga0157373_10254693 3300013100 Unclassified 1242
165 Ga0157371_10074416 3300013102 Unclassified 2406
166 Ga0157370_10027500 3300013104 Bacteria 5608
167 Ga0157369_10049206 3300013105 Bacteria 4570
168 Ga0157369_10088489 3300013105 Bacteria 3305
169 Ga0157374_10059353 3300013296 Bacteria 3577
170 Ga0157374_10095010 3300013296 Unclassified 2850
171 Ga0157378_10105103 3300013297 Bacteria 2581
172 Ga0157378_10122734 3300013297 Bacteria 2397
173 Ga0163162_10073072 3300013306 Unclassified 3485
174 Ga0163162_10146571 3300013306 Bacteria 2477
175 Ga0157372_10004816 3300013307 Bacteria 14345
176 Ga0157372_10006638 3300013307 Bacteria 12316
177 Ga0157372_10013707 3300013307 Bacteria 8665
178 Ga0157372_10049751 3300013307 Bacteria 4662
179 Ga0157372_10053274 3300013307 Bacteria 4509
180 Ga0157372_10083636 3300013307 Bacteria 3615
181 Ga0157375_10036107 3300013308 Bacteria 4724
182 Ga0163163_10039950 3300014325 Bacteria 4580
183 Ga0163163_10138561 3300014325 Unclassified 2475
184 Ga0182008_10009504 3300014497 Bacteria 5244
185 Ga0157377_10005879 3300014745 Bacteria 5805
186 Ga0157379_10027874 3300014968 Bacteria 5027
187 Ga0157376_10017049 3300014969 Bacteria 5531
188 Ga0157376_10032920 3300014969 Bacteria 4167
189 Ga0157376_10119650 3300014969 Bacteria 2332
190 Ga0182006_1063625 3300015261 Unclassified 1385
191 Ga0182007_10006678 3300015262 Bacteria 4931
192 Ga0182005_1017700 3300015265 Bacteria 1971
193 Ga0163161_10000977 3300017792 Bacteria 21864
194 Ga0207656_10013597 3300025321 Bacteria 3115
195 Ga0207682_10024359 3300025893 Bacteria 2396
196 Ga0207692_10015719 3300025898 Bacteria 3338
197 Ga0207692_10029775 3300025898 Bacteria 2598
198 Ga0207642_10003864 3300025899 Bacteria 4776
199 Ga0207710_10009158 3300025900 Bacteria 4166
200 Ga0207688_10010126 3300025901 Bacteria 5128
201 Ga0207680_10011955 3300025903 Bacteria 4407
202 Ga0207647_10007134 3300025904 Bacteria 8103
203 Ga0207685_10021383 3300025905 Archaea 2167
204 Ga0207699_10000756 3300025906 Bacteria 15451
205 Ga0207699_10015216 3300025906 Bacteria 3991
206 Ga0207699_10050071 3300025906 Bacteria 2462
207 Ga0207699_10127655 3300025906 Bacteria 1654
208 Ga0207645_10000827 3300025907 Bacteria 25955
209 Ga0207643_10004808 3300025908 Bacteria 7237
210 Ga0207684_10003036 3300025910 Bacteria 16639
211 Ga0207684_10016187 3300025910 Bacteria 6407
212 Ga0207684_10038482 3300025910 Bacteria 4058
213 Ga0207654_10018198 3300025911 Bacteria 3683
214 Ga0207654_10064359 3300025911 Unclassified 2156
215 Ga0207707_10077769 3300025912 Bacteria 2896
216 Ga0207695_10007980 3300025913 Bacteria 13347
217 Ga0207695_10017288 3300025913 Bacteria 8397
218 Ga0207671_10032357 3300025914 Bacteria 3894
219 Ga0207693_10000033 3300025915 Bacteria 114840
220 Ga0207693_10012562 3300025915 Bacteria 6840
221 Ga0207693_10018610 3300025915 Bacteria 5530
222 Ga0207693_10028808 3300025915 Bacteria 4389
223 Ga0207693_10068859 3300025915 Bacteria 2770
224 Ga0207693_10112809 3300025915 Bacteria 2132
225 Ga0207663_10051509 3300025916 Bacteria 2564
226 Ga0207663_10144649 3300025916 Bacteria 1660
227 Ga0207662_10011115 3300025918 Bacteria 4981
228 Ga0207657_10000981 3300025919 Bacteria 30269
229 Ga0207649_10000206 3300025920 Bacteria 49224
230 Ga0207652_10329555 3300025921 Bacteria 1378
231 Ga0207646_10006985 3300025922 Bacteria 11566
232 Ga0207646_10011050 3300025922 Bacteria 8768
233 Ga0207646_10142218 3300025922 Unclassified 2161
234 Ga0207646_10338655 3300025922 Bacteria 1359
235 Ga0207681_10011122 3300025923 Bacteria 5527
236 Ga0207650_10000036 3300025925 Bacteria 214579
237 Ga0207700_10000902 3300025928 Bacteria 17046
238 Ga0207700_10013431 3300025928 Bacteria 5328
239 Ga0207700_10016833 3300025928 Bacteria 4868
240 Ga0207700_10042396 3300025928 Bacteria 3336
241 Ga0207700_10052715 3300025928 Bacteria 3043
242 Ga0207700_10155693 3300025928 Unclassified 1893
243 Ga0207700_10181977 3300025928 Bacteria 1760
244 Ga0207664_10000097 3300025929 Bacteria 80906
245 Ga0207664_10030702 3300025929 Bacteria 4106
246 Ga0207664_10164966 3300025929 Bacteria 1892
247 Ga0207664_10264485 3300025929 Unclassified 1505
248 Ga0207664_10297983 3300025929 Unclassified 1418
249 Ga0207644_10057231 3300025931 Bacteria 2814
250 Ga0207690_10008746 3300025932 Bacteria 6011
251 Ga0207690_10098520 3300025932 Bacteria 2082
252 Ga0207706_10001158 3300025933 Bacteria 26753
253 Ga0207706_10032159 3300025933 Unclassified 4672
254 Ga0207670_10070448 3300025936 Bacteria 2415
255 Ga0207669_10016699 3300025937 Bacteria 3739
256 Ga0207704_10052609 3300025938 Bacteria 2469
257 Ga0207665_10000176 3300025939 Bacteria 42953
258 Ga0207665_10007817 3300025939 Bacteria 7057
259 Ga0207665_10027189 3300025939 Bacteria 3780
260 Ga0207665_10098386 3300025939 Unclassified 2038
261 Ga0207665_10108733 3300025939 Bacteria 1945
262 Ga0207665_10115035 3300025939 Bacteria 1894
263 Ga0207691_10005865 3300025940 Bacteria 11872
264 Ga0207711_10019319 3300025941 Bacteria 5674
265 Ga0207711_10152761 3300025941 Unclassified 2084
266 Ga0207689_10001551 3300025942 Bacteria 21793
267 Ga0207689_10253033 3300025942 Bacteria 1457
268 Ga0207661_10000089 3300025944 Bacteria 61118
269 Ga0207679_10000399 3300025945 Bacteria 31167
270 Ga0207667_10051641 3300025949 Bacteria 4333
271 Ga0207667_10097700 3300025949 Bacteria 3031
272 Ga0207651_10005990 3300025960 Bacteria 6302
273 Ga0207640_10028242 3300025981 Bacteria 3428
274 Ga0207640_10171210 3300025981 Unclassified 1618
275 Ga0207640_10312032 3300025981 Bacteria 1248
276 Ga0207658_10015612 3300025986 Bacteria 5211
277 Ga0207677_10001995 3300026023 Bacteria 10790
278 Ga0207677_10030232 3300026023 Bacteria 3454
279 Ga0207703_10018149 3300026035 Bacteria 5495
280 Ga0207678_10023232 3300026067 Bacteria 5424
281 Ga0207702_10002313 3300026078 Bacteria 18218
282 Ga0207702_10049670 3300026078 Bacteria 3540
283 Ga0207702_10060618 3300026078 Bacteria 3225
284 Ga0207702_10099241 3300026078 Bacteria 2567
285 Ga0207641_10000153 3300026088 Bacteria 97933
286 Ga0207648_10001917 3300026089 Bacteria 22732
287 Ga0207676_10000309 3300026095 Bacteria 41763
288 Ga0207674_10004291 3300026116 Bacteria 17191
289 Ga0207683_10000927 3300026121 Bacteria 26980
290 Ga0207698_10034971 3300026142 Bacteria 3670
291 Ga0207698_10257890 3300026142 Unclassified 1600
292 Ga0268266_10016703 3300028379 Bacteria 6273
293 Ga0268265_10009211 3300028380 Bacteria 6672
294 Ga0268264_10008478 3300028381 Bacteria 8549
295 Ga0265338_10016633 3300028800 Bacteria 7981
296 Ga0265338_10034702 3300028800 Bacteria 4869
297 Ga0265338_10082919 3300028800 Bacteria 2683
298 Ga0265330_10020678 3300031235 Bacteria 3008
299 Ga0265328_10028447 3300031239 Bacteria 2091
300 Ga0265340_10067703 3300031247 Bacteria 1697
301 Ga0265339_10027165 3300031249 Bacteria 3271
302 Ga0265339_10050555 3300031249 Bacteria 2273
303 Ga0265316_10196781 3300031344 Bacteria 1495
304 Ga0265314_10124507 3300031711 Unclassified 1617
305 Ga0373926_0030443 3300035083 Bacteria 1901
306 Ga0373934_0022330 3300035086 Bacteria 2441
307 Ga0373923_0000899 3300035111 Bacteria 7926
308 Ga0373936_0007613 3300035113 Bacteria 4070
309 Ga0373936_0055257 3300035113 Bacteria 1612
310 Ga0373956_0011918 3300035119 Bacteria 3594
311 Ga0373943_0000199 3300035170 Bacteria 24471
312 Ga0373943_0002028 3300035170 Bacteria 9183
313 Ga0373946_0005157 3300035171 Bacteria 4709
314 Ga0373955_0043092 3300035172 Bacteria 2426
315 Ga0373924_0029402 3300035410 Bacteria 2196
316 Ga0373931_0030533 3300035691 Bacteria 2775
317 Ga0373931_0042297 3300035691 Unclassified 2396
318 Ga0373935_0000576 3300035692 Bacteria 19099
319 Ga0373935_0025042 3300035692 Bacteria 3676
320 Ga0373935_0113945 3300035692 Bacteria 1798
321 Ga0373927_0000041 3300035695 Bacteria 94763
322 Ga0373927_0011500 3300035695 Bacteria 5897
323 Ga0373927_0029951 3300035695 Bacteria 3551
324 Ga0373927_0034939 3300035695 Bacteria 3269
325 Ga0373927_0065121 3300035695 Unclassified 2358
326 Ga0373927_0103325 3300035695 Bacteria 1854
327 Ga0373933_0104516 3300035724 Bacteria 1760
328 Ga0373947_0000315 3300035725 Bacteria 27406
329 Ga0373947_0005539 3300035725 Bacteria 7363
330 Ga0373947_0016874 3300035725 Unclassified 4195
331 Ga0373937_0047814 3300036401 Bacteria 3915
332 Ga0373937_0125809 3300036401 Bacteria 2391
333 Ga0373937_0161852 3300036401 Bacteria 2098
334 Ga0373937_0238456 3300036401 Unclassified 1713
335 Ga0373925_0000923 3300037068 Bacteria 26790
336 Ga0373925_0016110 3300037068 Bacteria 5413
337 Ga0373925_0017680 3300037068 Bacteria 5173
338 Ga0373925_0032449 3300037068 Bacteria 3844
339 Ga0373925_0165921 3300037068 Unclassified 1741
340 Ga0436363_0231280 3300039450 Bacteria 3476
341 Ga0436363_1545174 3300039450 Unclassified 1553
342 Ga0436362_0889942 3300039453 Bacteria 3023
343 Ga0466967_0200335 3300045976 Bacteria 1890
344 Ga0495580_0000777 3300046472 Bacteria 27451
345 Ga0495580_0001086 3300046472 Bacteria 23878
346 Ga0495580_0005310 3300046472 Bacteria 10685
347 Ga0495580_0006105 3300046472 Bacteria 9852
348 Ga0495580_0007498 3300046472 Bacteria 8766
349 Ga0495580_0010227 3300046472 Bacteria 7319
350 Ga0495580_0011825 3300046472 Bacteria 6736
351 Ga0495580_0026939 3300046472 Bacteria 4186
352 Ga0495580_0040743 3300046472 Viruses 3316
353 Ga0495580_0136337 3300046472 Bacteria 1702
354 Ga0495582_0000160 3300046473 Bacteria 36317
355 Ga0495582_0007681 3300046473 Bacteria 5960
356 Ga0495639_0126307 3300046475 Unclassified 1222
357 Ga0495664_0037519 3300046477 Bacteria 2860
358 Ga0495594_0042236 3300046499 Bacteria 2497
359 Ga0495630_0032462 3300046517 Bacteria 3891
360 Ga0495630_0066264 3300046517 Bacteria 2714
361 Ga0495630_0152247 3300046517 Bacteria 1760
362 Ga0495652_0097421 3300046529 Unclassified 2393
363 Ga0495665_0003186 3300046531 Bacteria 8886
364 Ga0495665_0027070 3300046531 Bacteria 3078
365 Ga0495665_0047043 3300046531 Bacteria 2289
366 Ga0495665_0110793 3300046531 Bacteria 1440
367 Ga0495623_0134587 3300046679 Bacteria 1476
368 Ga0495669_0005031 3300046684 Bacteria 5496
369 Ga0495613_0076813 3300046689 Unclassified 2430
370 Ga0495624_0080555 3300046690 Unclassified 2018
371 Ga0495581_0039218 3300047315 Bacteria 2742
372 Ga0495674_0005974 3300047319 Bacteria 11683
373 Ga0495674_0106212 3300047319 Bacteria 2385
374 Ga0495602_0080015 3300048088 Bacteria 2754
375 Ga0496100_0099934 3300048903 Unclassified 1997
376 Ga0496102_0065596 3300048905 Bacteria 3328
377 Ga0496102_0298873 3300048905 Bacteria 1517
378 Ga0496103_0129507 3300048906 Bacteria 1611
379 Ga0496104_0050388 3300048907 Bacteria 3929
380 Ga0496106_0138816 3300048909 Bacteria 1911
381 Ga0496107_0098010 3300048910 Bacteria 2147
382 Ga0496108_0000119 3300048911 Bacteria 77850
383 Ga0496109_0000020 3300048912 Bacteria 189962
384 Ga0496110_0025072 3300048913 Bacteria 5092
385 Ga0496110_0091697 3300048913 Bacteria 2718
386 Ga0496112_0000134 3300048915 Bacteria 46014
387 Ga0496112_0071571 3300048915 Bacteria 3427
388 Ga0496112_0449377 3300048915 Bacteria 1226
389 Ga0496113_0004478 3300048916 Bacteria 8596
390 Ga0496114_0209905 3300048917 Bacteria 1708
391 Ga0496115_0024554 3300048918 Bacteria 4687
392 Ga0496115_0051168 3300048918 Bacteria 3312
393 nmdc:mga0n895_237_c1 3300050512 Bacteria 34922
394 nmdc:mga0rr50_683_c1 3300050513 Bacteria 18182
395 nmdc:mga08x19_1248_c1 3300050514 Bacteria 15767
396 nmdc:mga08x19_2178_c1 3300050514 Bacteria 11961
397 nmdc:mga08x19_21990_c1 3300050514 Bacteria 3945
398 nmdc:mga0a205_221_c2 3300050515 Bacteria 25103
399 Ga0495601_0002278 3300053077 Bacteria 10834
400 Ga0495601_0033186 3300053077 Bacteria 3216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0039218 Ga0495581_0039218_1417_2310 259
2 3300005563 Ga0068855_100076107 Ga0068855_1000761073 311
3 3300005614 Ga0068856_100134047 Ga0068856_1001340472 311
4 3300005616 Ga0068852_100298643 Ga0068852_1002986432 311
5 3300025949 Ga0207667_10097700 Ga0207667_100977002 311
6 3300026078 Ga0207702_10099241 Ga0207702_100992411 311
7 3300026142 Ga0207698_10257890 Ga0207698_102578902 311
8 3300000546 LJNas_1000489 LJNas_10004894 312
9 3300035119 Ga0373956_0011918 Ga0373956_0011918_875_1942 313
10 3300035695 Ga0373927_0103325 Ga0373927_0103325_568_1635 313
11 3300036401 Ga0373937_0161852 Ga0373937_0161852_371_1438 313
12 3300046475 Ga0495639_0126307 Ga0495639_0126307_61_1128 313
13 3300035691 Ga0373931_0042297 Ga0373931_0042297_1427_2383 317
14 3300009093 Ga0105240_10440199 Ga0105240_104401992 320
15 3300009177 Ga0105248_10169118 Ga0105248_101691182 320
16 3300009545 Ga0105237_10093251 Ga0105237_100932512 320
17 3300010375 Ga0105239_10331679 Ga0105239_103316792 320
18 3300013102 Ga0157371_10074416 Ga0157371_100744163 320
19 3300013306 Ga0163162_10073072 Ga0163162_100730725 320
20 3300013307 Ga0157372_10013707 Ga0157372_100137077 320
21 3300015265 Ga0182005_1017700 Ga0182005_10177002 320
22 3300025941 Ga0207711_10152761 Ga0207711_101527612 320
23 3300025981 Ga0207640_10312032 Ga0207640_103120322 320
24 3300036401 Ga0373937_0125809 Ga0373937_0125809_804_1799 320
25 3300048905 Ga0496102_0298873 Ga0496102_0298873_336_1352 320
26 3300048915 Ga0496112_0449377 Ga0496112_0449377_82_1098 320
27 3300005434 Ga0070709_10011001 Ga0070709_100110014 321
28 3300005436 Ga0070713_100029331 Ga0070713_1000293314 321
29 3300005536 Ga0070697_100068609 Ga0070697_1000686093 321
30 3300025906 Ga0207699_10050071 Ga0207699_100500713 321
31 3300025916 Ga0207663_10051509 Ga0207663_100515093 321
32 3300025939 Ga0207665_10108733 Ga0207665_101087333 321
33 3300035113 Ga0373936_0055257 Ga0373936_0055257_20_991 321
34 3300035695 Ga0373927_0065121 Ga0373927_0065121_429_1400 321
35 3300035725 Ga0373947_0016874 Ga0373947_0016874_2785_3756 321
36 3300037068 Ga0373925_0016110 Ga0373925_0016110_163_1134 321
37 3300046472 Ga0495580_0005310 Ga0495580_0005310_9520_10491 321
38 3300046473 Ga0495582_0007681 Ga0495582_0007681_1900_2871 321
39 3300046689 Ga0495613_0076813 Ga0495613_0076813_162_1133 321
40 3300048907 Ga0496104_0050388 Ga0496104_0050388_1191_2162 321
41 3300048917 Ga0496114_0209905 Ga0496114_0209905_209_1180 321
42 3300048918 Ga0496115_0024554 Ga0496115_0024554_155_1126 321
43 3300005435 Ga0070714_100186313 Ga0070714_1001863131 322
44 3300025929 Ga0207664_10164966 Ga0207664_101649662 322
45 3300047319 Ga0495674_0106212 Ga0495674_0106212_687_1661 322
46 3300005434 Ga0070709_10001571 Ga0070709_100015718 323
47 3300005435 Ga0070714_100435779 Ga0070714_1004357792 323
48 3300005437 Ga0070710_10021880 Ga0070710_100218803 323
49 3300005439 Ga0070711_100012633 Ga0070711_1000126334 323
50 3300006163 Ga0070715_10030993 Ga0070715_100309933 323
51 3300006175 Ga0070712_100000106 Ga0070712_10000010630 323
52 3300009093 Ga0105240_10459146 Ga0105240_104591462 323
53 3300013307 Ga0157372_10004816 Ga0157372_100048169 323
54 3300025898 Ga0207692_10015719 Ga0207692_100157192 323
55 3300025905 Ga0207685_10021383 Ga0207685_100213832 323
56 3300025906 Ga0207699_10000756 Ga0207699_100007569 323
57 3300025928 Ga0207700_10000902 Ga0207700_1000090211 323
58 3300025929 Ga0207664_10264485 Ga0207664_102644853 323
59 3300005445 Ga0070708_100002005 Ga0070708_1000020059 325
60 3300005467 Ga0070706_100061960 Ga0070706_1000619602 325
61 3300005468 Ga0070707_100010644 Ga0070707_1000106443 325
62 3300005471 Ga0070698_100010519 Ga0070698_10001051910 325
63 3300005518 Ga0070699_100001122 Ga0070699_1000011228 325
64 3300005536 Ga0070697_100001895 Ga0070697_1000018953 325
65 3300005536 Ga0070697_100051840 Ga0070697_1000518403 325
66 3300006028 Ga0070717_10115430 Ga0070717_101154303 325
67 3300025910 Ga0207684_10003036 Ga0207684_100030363 325
68 3300025922 Ga0207646_10011050 Ga0207646_100110509 325
69 3300035111 Ga0373923_0000899 Ga0373923_0000899_5668_6651 325
70 3300035113 Ga0373936_0007613 Ga0373936_0007613_382_1365 325
71 3300035170 Ga0373943_0000199 Ga0373943_0000199_10827_11810 325
72 3300035171 Ga0373946_0005157 Ga0373946_0005157_2692_3675 325
73 3300035410 Ga0373924_0029402 Ga0373924_0029402_504_1487 325
74 3300035692 Ga0373935_0000576 Ga0373935_0000576_3411_4394 325
75 3300035695 Ga0373927_0000041 Ga0373927_0000041_72234_73217 325
76 3300035724 Ga0373933_0104516 Ga0373933_0104516_93_1076 325
77 3300035725 Ga0373947_0000315 Ga0373947_0000315_13254_14237 325
78 3300037068 Ga0373925_0000923 Ga0373925_0000923_6895_7878 325
79 3300046472 Ga0495580_0010227 Ga0495580_0010227_6105_7145 325
80 3300046477 Ga0495664_0037519 Ga0495664_0037519_593_1576 325
81 3300046517 Ga0495630_0032462 Ga0495630_0032462_1924_2907 325
82 3300047319 Ga0495674_0005974 Ga0495674_0005974_146_1129 325
83 3300025922 Ga0207646_10338655 Ga0207646_103386551 326
84 3300046531 Ga0495665_0047043 Ga0495665_0047043_627_1646 326
85 3300046679 Ga0495623_0134587 Ga0495623_0134587_165_1148 326
86 3300005437 Ga0070710_10040278 Ga0070710_100402782 327
87 3300005536 Ga0070697_100103355 Ga0070697_1001033552 327
88 3300006173 Ga0070716_100000274 Ga0070716_10000027414 327
89 3300025898 Ga0207692_10029775 Ga0207692_100297753 327
90 3300025915 Ga0207693_10018610 Ga0207693_100186104 327
91 3300039450 Ga0436363_1545174 Ga0436363_1545174_393_1400 328
92 3300050514 nmdc:mga08x19_1248_c1 nmdc:mga08x19_1248_c1_1137_2132 328
93 3300005434 Ga0070709_10029691 Ga0070709_100296912 329
94 3300005436 Ga0070713_100068457 Ga0070713_1000684572 329
95 3300005445 Ga0070708_100086923 Ga0070708_1000869233 329
96 3300006173 Ga0070716_100004401 Ga0070716_1000044016 329
97 3300006852 Ga0075433_10000913 Ga0075433_1000091316 329
98 3300006871 Ga0075434_100000253 Ga0075434_1000002535 329
99 3300006914 Ga0075436_100003061 Ga0075436_10000306110 329
100 3300006914 Ga0075436_100017510 Ga0075436_1000175106 329
101 3300007076 Ga0075435_100000234 Ga0075435_10000023419 329
102 3300007076 Ga0075435_100001191 Ga0075435_1000011919 329
103 3300025915 Ga0207693_10068859 Ga0207693_100688592 329
104 3300025928 Ga0207700_10181977 Ga0207700_101819772 329
105 3300025939 Ga0207665_10007817 Ga0207665_100078174 329
106 3300035083 Ga0373926_0030443 Ga0373926_0030443_525_1565 329
107 3300035170 Ga0373943_0002028 Ga0373943_0002028_2696_3736 329
108 3300035692 Ga0373935_0025042 Ga0373935_0025042_264_1304 329
109 3300035725 Ga0373947_0005539 Ga0373947_0005539_4199_5239 329
110 3300037068 Ga0373925_0017680 Ga0373925_0017680_2000_3040 329
111 3300046473 Ga0495582_0000160 Ga0495582_0000160_33283_34323 329
112 3300046531 Ga0495665_0003186 Ga0495665_0003186_1250_2290 329
113 3300048088 Ga0495602_0080015 Ga0495602_0080015_909_1901 329
114 3300050512 nmdc:mga0n895_237_c1 nmdc:mga0n895_237_c1_33450_34547 329
115 3300050513 nmdc:mga0rr50_683_c1 nmdc:mga0rr50_683_c1_13186_14283 329
116 3300050514 nmdc:mga08x19_2178_c1 nmdc:mga08x19_2178_c1_9133_10230 329
117 3300050514 nmdc:mga08x19_21990_c1 nmdc:mga08x19_21990_c1_570_1610 329
118 3300050515 nmdc:mga0a205_221_c2 nmdc:mga0a205_221_c2_9793_10890 329
119 3300005435 Ga0070714_100323744 Ga0070714_1003237442 330
120 3300025915 Ga0207693_10012562 Ga0207693_100125624 330
121 3300025928 Ga0207700_10013431 Ga0207700_100134313 330
122 3300025929 Ga0207664_10297983 Ga0207664_102979832 330
123 3300025939 Ga0207665_10115035 Ga0207665_101150352 330
124 3300036401 Ga0373937_0238456 Ga0373937_0238456_224_1225 330
125 3300046529 Ga0495652_0097421 Ga0495652_0097421_1148_2149 330
126 3300046690 Ga0495624_0080555 Ga0495624_0080555_23_1024 330
127 3300053077 Ga0495601_0033186 Ga0495601_0033186_2198_3199 330
128 3300035692 Ga0373935_0113945 Ga0373935_0113945_300_1298 331
129 3300035695 Ga0373927_0011500 Ga0373927_0011500_3238_4236 331
130 3300039450 Ga0436363_0231280 Ga0436363_0231280_626_1636 331
131 3300046517 Ga0495630_0152247 Ga0495630_0152247_287_1285 331
132 3300014325 Ga0163163_10138561 Ga0163163_101385613 332
133 3300025922 Ga0207646_10142218 Ga0207646_101422182 332
134 3300046472 Ga0495580_0006105 Ga0495580_0006105_482_1483 332
135 3300046472 Ga0495580_0026939 Ga0495580_0026939_1642_2667 332
136 3300046499 Ga0495594_0042236 Ga0495594_0042236_1054_2079 332
137 3300005434 Ga0070709_10236375 Ga0070709_102363751 333
138 3300005436 Ga0070713_100028305 Ga0070713_1000283054 333
139 3300005439 Ga0070711_100083305 Ga0070711_1000833052 333
140 3300006028 Ga0070717_10176147 Ga0070717_101761472 333
141 3300006175 Ga0070712_100004726 Ga0070712_1000047264 333
142 3300006914 Ga0075436_100000619 Ga0075436_10000061918 333
143 3300009093 Ga0105240_10010114 Ga0105240_100101144 333
144 3300025906 Ga0207699_10015216 Ga0207699_100152165 333
145 3300025928 Ga0207700_10042396 Ga0207700_100423963 333
146 3300025939 Ga0207665_10000176 Ga0207665_100001766 333
147 3300028800 Ga0265338_10082919 Ga0265338_100829192 333
148 3300039453 Ga0436362_0889942 Ga0436362_0889942_1024_2034 333
149 3300045976 Ga0466967_0200335 Ga0466967_0200335_384_1391 333
150 3300046472 Ga0495580_0007498 Ga0495580_0007498_5726_6748 333
151 3300005327 Ga0070658_10199275 Ga0070658_101992752 334
152 3300005331 Ga0070670_100224227 Ga0070670_1002242272 334
153 3300005334 Ga0068869_100109041 Ga0068869_1001090412 334
154 3300005353 Ga0070669_100329841 Ga0070669_1003298412 334
155 3300005434 Ga0070709_10074461 Ga0070709_100744612 334
156 3300005434 Ga0070709_10098268 Ga0070709_100982682 334
157 3300005435 Ga0070714_100209709 Ga0070714_1002097092 334
158 3300005436 Ga0070713_100000084 Ga0070713_10000008446 334
159 3300005458 Ga0070681_10070893 Ga0070681_100708934 334
160 3300005468 Ga0070707_100229183 Ga0070707_1002291832 334
161 3300005471 Ga0070698_100284119 Ga0070698_1002841191 334
162 3300005530 Ga0070679_100039953 Ga0070679_1000399533 334
163 3300005536 Ga0070697_100000113 Ga0070697_10000011333 334
164 3300005564 Ga0070664_100099512 Ga0070664_1000995122 334
165 3300005614 Ga0068856_100004317 Ga0068856_1000043172 334
166 3300005614 Ga0068856_100028316 Ga0068856_1000283163 334
167 3300005834 Ga0068851_10067814 Ga0068851_100678142 334
168 3300006028 Ga0070717_10143846 Ga0070717_101438461 334
169 3300006173 Ga0070716_100033987 Ga0070716_1000339873 334
170 3300006237 Ga0097621_100091669 Ga0097621_1000916693 334
171 3300009093 Ga0105240_10021993 Ga0105240_100219932 334
172 3300009174 Ga0105241_10004717 Ga0105241_100047173 334
173 3300009545 Ga0105237_10011974 Ga0105237_100119744 334
174 3300009545 Ga0105237_10110057 Ga0105237_101100572 334
175 3300009551 Ga0105238_10109055 Ga0105238_101090554 334
176 3300013100 Ga0157373_10003878 Ga0157373_1000387811 334
177 3300013100 Ga0157373_10028714 Ga0157373_100287144 334
178 3300013100 Ga0157373_10254693 Ga0157373_102546931 334
179 3300013104 Ga0157370_10027500 Ga0157370_100275003 334
180 3300013105 Ga0157369_10088489 Ga0157369_100884892 334
181 3300013297 Ga0157378_10122734 Ga0157378_101227342 334
182 3300013307 Ga0157372_10006638 Ga0157372_100066387 334
183 3300013307 Ga0157372_10083636 Ga0157372_100836363 334
184 3300014497 Ga0182008_10009504 Ga0182008_100095042 334
185 3300015261 Ga0182006_1063625 Ga0182006_10636252 334
186 3300015262 Ga0182007_10006678 Ga0182007_100066784 334
187 3300025906 Ga0207699_10127655 Ga0207699_101276551 334
188 3300025911 Ga0207654_10064359 Ga0207654_100643592 334
189 3300025912 Ga0207707_10077769 Ga0207707_100777692 334
190 3300025913 Ga0207695_10017288 Ga0207695_100172885 334
191 3300025914 Ga0207671_10032357 Ga0207671_100323574 334
192 3300025915 Ga0207693_10000033 Ga0207693_1000003349 334
193 3300025915 Ga0207693_10028808 Ga0207693_100288082 334
194 3300025921 Ga0207652_10329555 Ga0207652_103295551 334
195 3300025928 Ga0207700_10052715 Ga0207700_100527152 334
196 3300025932 Ga0207690_10098520 Ga0207690_100985202 334
197 3300025933 Ga0207706_10032159 Ga0207706_100321594 334
198 3300025939 Ga0207665_10027189 Ga0207665_100271891 334
199 3300025939 Ga0207665_10098386 Ga0207665_100983862 334
200 3300025942 Ga0207689_10253033 Ga0207689_102530332 334
201 3300026023 Ga0207677_10030232 Ga0207677_100302322 334
202 3300026078 Ga0207702_10002313 Ga0207702_1000231314 334
203 3300026078 Ga0207702_10060618 Ga0207702_100606183 334
204 3300031235 Ga0265330_10020678 Ga0265330_100206783 334
205 3300031249 Ga0265339_10050555 Ga0265339_100505552 334
206 3300035691 Ga0373931_0030533 Ga0373931_0030533_403_1413 334
207 3300035695 Ga0373927_0029951 Ga0373927_0029951_500_1510 334
208 3300037068 Ga0373925_0165921 Ga0373925_0165921_664_1674 334
209 3300046472 Ga0495580_0001086 Ga0495580_0001086_4116_5126 334
210 3300046472 Ga0495580_0040743 Ga0495580_0040743_145_1155 334
211 3300046472 Ga0495580_0136337 Ga0495580_0136337_61_1071 334
212 3300046531 Ga0495665_0027070 Ga0495665_0027070_1631_2641 334
213 3300046531 Ga0495665_0110793 Ga0495665_0110793_360_1370 334
214 3300048909 Ga0496106_0138816 Ga0496106_0138816_267_1283 334
215 3300048913 Ga0496110_0091697 Ga0496110_0091697_520_1536 334
216 3300048915 Ga0496112_0071571 Ga0496112_0071571_980_1990 334
217 3300005435 Ga0070714_100000211 Ga0070714_10000021127 335
218 3300005435 Ga0070714_100032355 Ga0070714_1000323552 335
219 3300005436 Ga0070713_100029007 Ga0070713_1000290074 335
220 3300005436 Ga0070713_100030673 Ga0070713_1000306732 335
221 3300005445 Ga0070708_100004717 Ga0070708_1000047172 335
222 3300005467 Ga0070706_100002168 Ga0070706_10000216820 335
223 3300005467 Ga0070706_100003312 Ga0070706_1000033122 335
224 3300005468 Ga0070707_100046910 Ga0070707_1000469102 335
225 3300005471 Ga0070698_100007279 Ga0070698_1000072799 335
226 3300005536 Ga0070697_100003932 Ga0070697_1000039326 335
227 3300006028 Ga0070717_10001346 Ga0070717_1000134611 335
228 3300006028 Ga0070717_10005388 Ga0070717_100053887 335
229 3300006028 Ga0070717_10028247 Ga0070717_100282472 335
230 3300006028 Ga0070717_10096139 Ga0070717_100961391 335
231 3300006028 Ga0070717_10176931 Ga0070717_101769312 335
232 3300006175 Ga0070712_100003376 Ga0070712_1000033762 335
233 3300006175 Ga0070712_100008733 Ga0070712_1000087334 335
234 3300006237 Ga0097621_100001385 Ga0097621_10000138513 335
235 3300006358 Ga0068871_100009154 Ga0068871_1000091544 335
236 3300009098 Ga0105245_10153136 Ga0105245_101531362 335
237 3300009174 Ga0105241_10112117 Ga0105241_101121173 335
238 3300009176 Ga0105242_10200791 Ga0105242_102007912 335
239 3300010375 Ga0105239_10265482 Ga0105239_102654822 335
240 3300013296 Ga0157374_10095010 Ga0157374_100950102 335
241 3300013307 Ga0157372_10053274 Ga0157372_100532745 335
242 3300014968 Ga0157379_10027874 Ga0157379_100278742 335
243 3300014969 Ga0157376_10017049 Ga0157376_100170492 335
244 3300014969 Ga0157376_10119650 Ga0157376_101196501 335
245 3300025910 Ga0207684_10016187 Ga0207684_100161876 335
246 3300025910 Ga0207684_10038482 Ga0207684_100384822 335
247 3300025913 Ga0207695_10007980 Ga0207695_1000798013 335
248 3300025915 Ga0207693_10112809 Ga0207693_101128092 335
249 3300025922 Ga0207646_10006985 Ga0207646_100069856 335
250 3300025928 Ga0207700_10155693 Ga0207700_101556932 335
251 3300025929 Ga0207664_10000097 Ga0207664_1000009759 335
252 3300025929 Ga0207664_10030702 Ga0207664_100307023 335
253 3300025981 Ga0207640_10171210 Ga0207640_101712102 335
254 3300028800 Ga0265338_10016633 Ga0265338_100166335 335
255 3300028800 Ga0265338_10034702 Ga0265338_100347023 335
256 3300031239 Ga0265328_10028447 Ga0265328_100284472 335
257 3300031247 Ga0265340_10067703 Ga0265340_100677032 335
258 3300031249 Ga0265339_10027165 Ga0265339_100271653 335
259 3300031344 Ga0265316_10196781 Ga0265316_101967812 335
260 3300031711 Ga0265314_10124507 Ga0265314_101245072 335
261 3300035086 Ga0373934_0022330 Ga0373934_0022330_67_1086 335
262 3300035172 Ga0373955_0043092 Ga0373955_0043092_903_1922 335
263 3300036401 Ga0373937_0047814 Ga0373937_0047814_1600_2652 335
264 3300037068 Ga0373925_0032449 Ga0373925_0032449_2466_3479 335
265 3300046472 Ga0495580_0000777 Ga0495580_0000777_13071_14162 335
266 3300046472 Ga0495580_0011825 Ga0495580_0011825_1484_2503 335
267 3300046517 Ga0495630_0066264 Ga0495630_0066264_1411_2499 335
268 3300053077 Ga0495601_0002278 Ga0495601_0002278_4610_5695 335
269 2162886011 MRS1b_contig_483180 MRS1b_0708.00001170 336
270 3300001978 JGI24747J21853_1005364 JGI24747J21853_10053642 336
271 3300001991 JGI24743J22301_10000793 JGI24743J22301_100007937 336
272 3300002239 JGI24034J26672_10000449 JGI24034J26672_100004496 336
273 3300002459 JGI24751J29686_10007194 JGI24751J29686_100071942 336
274 3300005293 Ga0065715_10119057 Ga0065715_101190572 336
275 3300005328 Ga0070676_10017135 Ga0070676_100171354 336
276 3300005329 Ga0070683_100009516 Ga0070683_1000095163 336
277 3300005330 Ga0070690_100005169 Ga0070690_1000051696 336
278 3300005331 Ga0070670_100083400 Ga0070670_1000834001 336
279 3300005333 Ga0070677_10002354 Ga0070677_100023542 336
280 3300005334 Ga0068869_100030930 Ga0068869_1000309303 336
281 3300005335 Ga0070666_10023824 Ga0070666_100238243 336
282 3300005337 Ga0070682_100016901 Ga0070682_1000169015 336
283 3300005338 Ga0068868_100003111 Ga0068868_10000311112 336
284 3300005339 Ga0070660_100003557 Ga0070660_1000035577 336
285 3300005340 Ga0070689_100042906 Ga0070689_1000429062 336
286 3300005343 Ga0070687_100014073 Ga0070687_1000140732 336
287 3300005344 Ga0070661_100041894 Ga0070661_1000418942 336
288 3300005353 Ga0070669_100017651 Ga0070669_1000176513 336
289 3300005354 Ga0070675_100067553 Ga0070675_1000675533 336
290 3300005355 Ga0070671_100054051 Ga0070671_1000540512 336
291 3300005356 Ga0070674_100022066 Ga0070674_1000220663 336
292 3300005364 Ga0070673_100060420 Ga0070673_1000604204 336
293 3300005366 Ga0070659_100022927 Ga0070659_1000229276 336
294 3300005367 Ga0070667_100166658 Ga0070667_1001666581 336
295 3300005445 Ga0070708_100015788 Ga0070708_1000157882 336
296 3300005455 Ga0070663_100038054 Ga0070663_1000380543 336
297 3300005456 Ga0070678_100017905 Ga0070678_1000179053 336
298 3300005457 Ga0070662_100004500 Ga0070662_1000045006 336
299 3300005459 Ga0068867_100013981 Ga0068867_1000139815 336
300 3300005466 Ga0070685_10012151 Ga0070685_100121512 336
301 3300005535 Ga0070684_100001029 Ga0070684_10000102917 336
302 3300005539 Ga0068853_100014734 Ga0068853_1000147345 336
303 3300005543 Ga0070672_100021012 Ga0070672_1000210123 336
304 3300005544 Ga0070686_100055363 Ga0070686_1000553632 336
305 3300005547 Ga0070693_100005731 Ga0070693_1000057313 336
306 3300005563 Ga0068855_100007705 Ga0068855_10000770512 336
307 3300005564 Ga0070664_100028212 Ga0070664_1000282124 336
308 3300005577 Ga0068857_100044186 Ga0068857_1000441863 336
309 3300005578 Ga0068854_100013331 Ga0068854_1000133314 336
310 3300005614 Ga0068856_100043165 Ga0068856_1000431656 336
311 3300005616 Ga0068852_100168762 Ga0068852_1001687622 336
312 3300005617 Ga0068859_100012693 Ga0068859_1000126932 336
313 3300005618 Ga0068864_100042535 Ga0068864_1000425352 336
314 3300005718 Ga0068866_10002988 Ga0068866_100029886 336
315 3300005834 Ga0068851_10002764 Ga0068851_100027647 336
316 3300005840 Ga0068870_10004267 Ga0068870_100042673 336
317 3300005841 Ga0068863_100100702 Ga0068863_1001007022 336
318 3300005843 Ga0068860_100251439 Ga0068860_1002514392 336
319 3300005844 Ga0068862_100032586 Ga0068862_1000325862 336
320 3300006028 Ga0070717_10026174 Ga0070717_100261743 336
321 3300006028 Ga0070717_10172579 Ga0070717_101725792 336
322 3300006237 Ga0097621_100474960 Ga0097621_1004749602 336
323 3300006358 Ga0068871_100065405 Ga0068871_1000654052 336
324 3300006881 Ga0068865_100035676 Ga0068865_1000356763 336
325 3300006931 Ga0097620_100012693 Ga0097620_1000126932 336
326 3300009092 Ga0105250_10026365 Ga0105250_100263653 336
327 3300009098 Ga0105245_10016297 Ga0105245_100162976 336
328 3300009174 Ga0105241_10005045 Ga0105241_100050459 336
329 3300009177 Ga0105248_10143437 Ga0105248_101434372 336
330 3300009551 Ga0105238_10088815 Ga0105238_100888153 336
331 3300009553 Ga0105249_10003240 Ga0105249_100032406 336
332 3300010159 Ga0099796_10003148 Ga0099796_100031482 336
333 3300011119 Ga0105246_10010534 Ga0105246_100105343 336
334 3300013105 Ga0157369_10049206 Ga0157369_100492064 336
335 3300013296 Ga0157374_10059353 Ga0157374_100593532 336
336 3300013297 Ga0157378_10105103 Ga0157378_101051032 336
337 3300013306 Ga0163162_10146571 Ga0163162_101465712 336
338 3300013307 Ga0157372_10049751 Ga0157372_100497516 336
339 3300013308 Ga0157375_10036107 Ga0157375_100361076 336
340 3300014325 Ga0163163_10039950 Ga0163163_100399505 336
341 3300014745 Ga0157377_10005879 Ga0157377_100058796 336
342 3300014969 Ga0157376_10032920 Ga0157376_100329205 336
343 3300017792 Ga0163161_10000977 Ga0163161_1000097719 336
344 3300025321 Ga0207656_10013597 Ga0207656_100135973 336
345 3300025893 Ga0207682_10024359 Ga0207682_100243592 336
346 3300025899 Ga0207642_10003864 Ga0207642_100038644 336
347 3300025900 Ga0207710_10009158 Ga0207710_100091582 336
348 3300025901 Ga0207688_10010126 Ga0207688_100101266 336
349 3300025903 Ga0207680_10011955 Ga0207680_100119556 336
350 3300025904 Ga0207647_10007134 Ga0207647_100071347 336
351 3300025907 Ga0207645_10000827 Ga0207645_1000082720 336
352 3300025908 Ga0207643_10004808 Ga0207643_100048086 336
353 3300025911 Ga0207654_10018198 Ga0207654_100181983 336
354 3300025916 Ga0207663_10144649 Ga0207663_101446492 336
355 3300025918 Ga0207662_10011115 Ga0207662_100111154 336
356 3300025919 Ga0207657_10000981 Ga0207657_1000098117 336
357 3300025920 Ga0207649_10000206 Ga0207649_1000020635 336
358 3300025923 Ga0207681_10011122 Ga0207681_100111225 336
359 3300025925 Ga0207650_10000036 Ga0207650_10000036186 336
360 3300025928 Ga0207700_10016833 Ga0207700_100168333 336
361 3300025931 Ga0207644_10057231 Ga0207644_100572312 336
362 3300025932 Ga0207690_10008746 Ga0207690_100087465 336
363 3300025933 Ga0207706_10001158 Ga0207706_1000115818 336
364 3300025936 Ga0207670_10070448 Ga0207670_100704482 336
365 3300025937 Ga0207669_10016699 Ga0207669_100166993 336
366 3300025938 Ga0207704_10052609 Ga0207704_100526092 336
367 3300025940 Ga0207691_10005865 Ga0207691_100058655 336
368 3300025941 Ga0207711_10019319 Ga0207711_100193193 336
369 3300025942 Ga0207689_10001551 Ga0207689_100015519 336
370 3300025944 Ga0207661_10000089 Ga0207661_100000899 336
371 3300025945 Ga0207679_10000399 Ga0207679_100003995 336
372 3300025949 Ga0207667_10051641 Ga0207667_100516412 336
373 3300025960 Ga0207651_10005990 Ga0207651_100059906 336
374 3300025981 Ga0207640_10028242 Ga0207640_100282424 336
375 3300025986 Ga0207658_10015612 Ga0207658_100156122 336
376 3300026023 Ga0207677_10001995 Ga0207677_100019956 336
377 3300026035 Ga0207703_10018149 Ga0207703_100181492 336
378 3300026067 Ga0207678_10023232 Ga0207678_100232325 336
379 3300026078 Ga0207702_10049670 Ga0207702_100496702 336
380 3300026088 Ga0207641_10000153 Ga0207641_1000015382 336
381 3300026089 Ga0207648_10001917 Ga0207648_100019179 336
382 3300026095 Ga0207676_10000309 Ga0207676_1000030939 336
383 3300026116 Ga0207674_10004291 Ga0207674_100042913 336
384 3300026121 Ga0207683_10000927 Ga0207683_1000092716 336
385 3300026142 Ga0207698_10034971 Ga0207698_100349713 336
386 3300028379 Ga0268266_10016703 Ga0268266_100167034 336
387 3300028380 Ga0268265_10009211 Ga0268265_100092113 336
388 3300028381 Ga0268264_10008478 Ga0268264_100084782 336
389 3300035695 Ga0373927_0034939 Ga0373927_0034939_1759_2799 336
390 3300046684 Ga0495669_0005031 Ga0495669_0005031_3955_4965 336
391 3300048903 Ga0496100_0099934 Ga0496100_0099934_151_1161 336
392 3300048905 Ga0496102_0065596 Ga0496102_0065596_526_1536 336
393 3300048906 Ga0496103_0129507 Ga0496103_0129507_208_1218 336
394 3300048910 Ga0496107_0098010 Ga0496107_0098010_828_1838 336
395 3300048911 Ga0496108_0000119 Ga0496108_0000119_15195_16205 336
396 3300048912 Ga0496109_0000020 Ga0496109_0000020_41117_42127 336
397 3300048913 Ga0496110_0025072 Ga0496110_0025072_3860_4870 336
398 3300048915 Ga0496112_0000134 Ga0496112_0000134_21739_22749 336
399 3300048916 Ga0496113_0004478 Ga0496113_0004478_379_1389 336
400 3300048918 Ga0496115_0051168 Ga0496115_0051168_1271_2281 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

21

246

0.86

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

49

166

0.85

PF09084

NMT1

NMT1/THI5 like

60

242

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8647 23 322
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8592 23 318
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8571 23 318
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8466 24 319
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8402 23 322
ID Description Score Start End Superfamily
3e4rA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8892 23 105 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8753 107 210 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8597 107 210 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8291 109 202 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8159 109 204 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A533UVV0-F1-model_v4 ABC transporter substrate-binding protein 0.9887 22 336 GO:0005886
GO:0012505
GO:0042626
AF-A0A535P9F1-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.986 126 336
AF-A0A2V5VXH0-F1-model_v4 Aliphatic sulfonates ABC transporter substrate-binding protein 0.9832 69 336
AF-K0IDW2-F1-model_v4 ABC uptake transporter, substrate-binding protein 0.9825 24 336 GO:0005886
GO:0012505
GO:0042626
AF-A0A533WT69-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9823 137 336

Feature Viewer

pLDDT pTM Quality
93.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map