F434535

General Info

Members Datasets Scaffolds Average Seq Length
400 201 397 117

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100731422|Ga0068863_1007314222
Length 127
Sequence MGKPNPLLAGAAGRCPNCGEGWLFEGFLKVSPRCEACGFDLAKADSGDGPAVFVILIAGFIVAFGALFTMVAFRASVWVTLAIWLPMTLVICLALLRPMKGLMLAAQFMNKASQATHGTGDDRGPHD

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 4.75
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10195973 3300005327 Bacteria 1703
2 Ga0070658_10585475 3300005327 Bacteria 967
3 Ga0070658_10726466 3300005327 Bacteria 862
4 Ga0070658_10804343 3300005327 Bacteria 817
5 Ga0070683_101214225 3300005329 Bacteria 725
6 Ga0070670_100109777 3300005331 Bacteria 2377
7 Ga0070670_100324448 3300005331 Bacteria 1349
8 Ga0070666_10405308 3300005335 Bacteria 981
9 Ga0070666_11240442 3300005335 Bacteria 556
10 Ga0070680_100059807 3300005336 Bacteria 3118
11 Ga0068868_100321269 3300005338 Bacteria 1319
12 Ga0068868_101652147 3300005338 Bacteria 603
13 Ga0070660_100211609 3300005339 Bacteria 1574
14 Ga0070691_10078087 3300005341 Bacteria 1617
15 Ga0070661_101332215 3300005344 Bacteria 603
16 Ga0070661_101337949 3300005344 Bacteria 601
17 Ga0070668_100001422 3300005347 Bacteria 17258
18 Ga0070668_100005495 3300005347 Bacteria 9398
19 Ga0070668_100006358 3300005347 Bacteria 8750
20 Ga0070668_101342219 3300005347 Bacteria 651
21 Ga0070669_100182408 3300005353 Bacteria 1643
22 Ga0070669_100278536 3300005353 Bacteria 1339
23 Ga0070671_100045470 3300005355 Bacteria 3650
24 Ga0070671_100069133 3300005355 Bacteria 2945
25 Ga0070671_100510445 3300005355 Bacteria 1034
26 Ga0070688_101207730 3300005365 Bacteria 608
27 Ga0070659_100002614 3300005366 Bacteria 12809
28 Ga0070659_100009203 3300005366 Bacteria 7249
29 Ga0070659_100017175 3300005366 Bacteria 5439
30 Ga0070659_102037260 3300005366 Bacteria 515
31 Ga0070667_100002972 3300005367 Bacteria 14567
32 Ga0070667_100013139 3300005367 Bacteria 6845
33 Ga0070667_100027596 3300005367 Bacteria 4724
34 Ga0070667_100349256 3300005367 Bacteria 1339
35 Ga0070663_100272938 3300005455 Bacteria 1345
36 Ga0070663_102029654 3300005455 Bacteria 518
37 Ga0070678_100260501 3300005456 Bacteria 1458
38 Ga0070678_100849542 3300005456 Bacteria 832
39 Ga0070662_101005872 3300005457 Bacteria 714
40 Ga0070681_10006243 3300005458 Bacteria 11591
41 Ga0070681_10079782 3300005458 Bacteria 3229
42 Ga0070681_11450343 3300005458 Bacteria 610
43 Ga0070681_11559460 3300005458 Bacteria 585
44 Ga0068867_102040005 3300005459 Bacteria 543
45 Ga0070679_100002173 3300005530 Bacteria 17693
46 Ga0070679_100014918 3300005530 Bacteria 7463
47 Ga0070679_100899260 3300005530 Bacteria 829
48 Ga0070684_101660225 3300005535 Bacteria 603
49 Ga0070684_101960604 3300005535 Bacteria 553
50 Ga0068853_100015561 3300005539 Bacteria 6249
51 Ga0068853_101727803 3300005539 Bacteria 607
52 Ga0070665_100000517 3300005548 Bacteria 54900
53 Ga0070665_100000744 3300005548 Bacteria 43397
54 Ga0070665_100004164 3300005548 Bacteria 15220
55 Ga0070665_100054965 3300005548 Bacteria 3993
56 Ga0070665_100325271 3300005548 Bacteria 1542
57 Ga0070665_101017266 3300005548 Bacteria 841
58 Ga0068855_100011378 3300005563 Bacteria 10744
59 Ga0068855_100045611 3300005563 Bacteria 5184
60 Ga0068855_100269320 3300005563 Bacteria 1894
61 Ga0068855_100624660 3300005563 Bacteria 1160
62 Ga0068855_100949748 3300005563 Bacteria 906
63 Ga0070664_100247775 3300005564 Bacteria 1601
64 Ga0068854_100699641 3300005578 Bacteria 875
65 Ga0068856_100512427 3300005614 Bacteria 1221
66 Ga0068852_101139355 3300005616 Bacteria 801
67 Ga0068859_100002155 3300005617 Bacteria 20004
68 Ga0068859_100398111 3300005617 Bacteria 1473
69 Ga0068864_100000093 3300005618 Bacteria 93540
70 Ga0068864_100004767 3300005618 Bacteria 11114
71 Ga0068864_100010560 3300005618 Bacteria 7634
72 Ga0068864_100123357 3300005618 Bacteria 2319
73 Ga0068864_100872408 3300005618 Bacteria 888
74 Ga0068861_100008049 3300005719 Bacteria 7255
75 Ga0068861_100446781 3300005719 Bacteria 1158
76 Ga0068863_100000045 3300005841 Bacteria 147269
77 Ga0068863_100015616 3300005841 Bacteria 7294
78 Ga0068863_100057765 3300005841 Bacteria 3671
79 Ga0068863_100189067 3300005841 Bacteria 1979
80 Ga0068863_100189274 3300005841 Bacteria 1977
81 Ga0068863_100461351 3300005841 Bacteria 1248
82 Ga0068863_100731422 3300005841 Bacteria 985
83 Ga0068858_100000144 3300005842 Bacteria 75375
84 Ga0068858_100024542 3300005842 Bacteria 5617
85 Ga0068858_100031424 3300005842 Bacteria 4932
86 Ga0068860_100000109 3300005843 Bacteria 132169
87 Ga0068860_100006980 3300005843 Bacteria 11313
88 Ga0068860_100031729 3300005843 Bacteria 5079
89 Ga0068860_100249639 3300005843 Bacteria 1728
90 Ga0068862_100007193 3300005844 Bacteria 9243
91 Ga0068862_100140413 3300005844 Bacteria 2144
92 Ga0068862_100220557 3300005844 Bacteria 1717
93 Ga0070717_10279426 3300006028 Bacteria 1481
94 Ga0070717_10869102 3300006028 Bacteria 821
95 Ga0075368_10002103 3300006042 Bacteria 6433
96 Ga0075363_100444259 3300006048 Bacteria 765
97 Ga0075364_10010180 3300006051 Bacteria 5672
98 Ga0070716_101231941 3300006173 Bacteria 602
99 Ga0075362_10160483 3300006177 Bacteria 1082
100 Ga0075362_10387666 3300006177 Bacteria 703
101 Ga0075367_10003072 3300006178 Bacteria 7832
102 Ga0075369_10247281 3300006186 Bacteria 828
103 Ga0075366_10065429 3300006195 Bacteria 2162
104 Ga0075370_10040383 3300006353 Bacteria 2631
105 Ga0068871_100415333 3300006358 Bacteria 1201
106 Ga0068871_100550758 3300006358 Bacteria 1045
107 Ga0068865_100001402 3300006881 Bacteria 14026
108 Ga0068865_100467332 3300006881 Bacteria 1046
109 Ga0097620_100002155 3300006931 Bacteria 20004
110 Ga0097620_100398119 3300006931 Bacteria 1473
111 Ga0105251_10349386 3300009011 Bacteria 675
112 Ga0105250_10009814 3300009092 Bacteria 4020
113 Ga0105240_10035261 3300009093 Bacteria 6448
114 Ga0105240_10036414 3300009093 Bacteria 6331
115 Ga0105240_10088550 3300009093 Bacteria 3788
116 Ga0105240_10107839 3300009093 Bacteria 3376
117 Ga0105240_10449844 3300009093 Bacteria 1442
118 Ga0105247_10082027 3300009101 Bacteria 2034
119 Ga0105247_10762750 3300009101 Bacteria 734
120 Ga0105241_11366634 3300009174 Bacteria 677
121 Ga0105241_12317193 3300009174 Bacteria 535
122 Ga0105241_12458191 3300009174 Bacteria 521
123 Ga0105248_10000303 3300009177 Bacteria 58530
124 Ga0105248_10052086 3300009177 Bacteria 4593
125 Ga0105248_10152139 3300009177 Bacteria 2611
126 Ga0105248_10395744 3300009177 Bacteria 1555
127 Ga0105248_10748845 3300009177 Bacteria 1102
128 Ga0105248_11156421 3300009177 Bacteria 875
129 Ga0105248_12753905 3300009177 Bacteria 561
130 Ga0105238_10011447 3300009551 Bacteria 8933
131 Ga0105238_10126187 3300009551 Bacteria 2537
132 Ga0105238_10338595 3300009551 Bacteria 1492
133 Ga0105238_10527933 3300009551 Bacteria 1183
134 Ga0105249_10007310 3300009553 Bacteria 9629
135 Ga0105249_10164597 3300009553 Bacteria 2146
136 Ga0105249_10297567 3300009553 Bacteria 1617
137 Ga0105249_10703572 3300009553 Bacteria 1071
138 Ga0105239_10100351 3300010375 Bacteria 3202
139 Ga0105239_10158319 3300010375 Bacteria 2530
140 Ga0105239_10181678 3300010375 Bacteria 2354
141 Ga0105239_10303633 3300010375 Bacteria 1798
142 Ga0157370_10083830 3300013104 Bacteria 2997
143 Ga0157370_10817426 3300013104 Bacteria 848
144 Ga0157369_10320503 3300013105 Bacteria 1611
145 Ga0157374_10355269 3300013296 Bacteria 1457
146 Ga0157374_11048049 3300013296 Bacteria 835
147 Ga0163162_10319474 3300013306 Bacteria 1685
148 Ga0157372_10201135 3300013307 Bacteria 2307
149 Ga0157372_12510922 3300013307 Bacteria 592
150 Ga0157375_10519685 3300013308 Bacteria 1354
151 Ga0157375_11623676 3300013308 Bacteria 765
152 Ga0163163_10062599 3300014325 Bacteria 3687
153 Ga0163163_10070721 3300014325 Bacteria 3475
154 Ga0163163_10792801 3300014325 Bacteria 1011
155 Ga0182008_10473463 3300014497 Bacteria 684
156 Ga0157379_10005669 3300014968 Bacteria 10735
157 Ga0157379_10065935 3300014968 Bacteria 3237
158 Ga0157379_11112759 3300014968 Bacteria 757
159 Ga0157376_10429903 3300014969 Bacteria 1283
160 Ga0182007_10023975 3300015262 Bacteria 2140
161 Ga0163161_11002062 3300017792 Bacteria 713
162 Ga0163161_11328233 3300017792 Bacteria 626
163 Ga0213876_10102652 3300021384 Bacteria 1516
164 Ga0209233_1066241 3300025261 Bacteria 682
165 Ga0207696_1041483 3300025711 Bacteria 1344
166 Ga0207680_10119868 3300025903 Bacteria 1719
167 Ga0207680_10652122 3300025903 Bacteria 754
168 Ga0207680_10665240 3300025903 Bacteria 746
169 Ga0207705_10001192 3300025909 Bacteria 21073
170 Ga0207705_10082009 3300025909 Bacteria 2351
171 Ga0207705_10799036 3300025909 Bacteria 732
172 Ga0207705_11007421 3300025909 Bacteria 643
173 Ga0207705_11297513 3300025909 Bacteria 556
174 Ga0207707_10010989 3300025912 Bacteria 7877
175 Ga0207707_10044456 3300025912 Bacteria 3873
176 Ga0207707_10060605 3300025912 Bacteria 3291
177 Ga0207707_11272336 3300025912 Bacteria 592
178 Ga0207695_10003226 3300025913 Bacteria 23212
179 Ga0207695_10005953 3300025913 Bacteria 15959
180 Ga0207695_10007192 3300025913 Bacteria 14236
181 Ga0207695_10022613 3300025913 Bacteria 7130
182 Ga0207695_10265562 3300025913 Bacteria 1613
183 Ga0207695_10454392 3300025913 Bacteria 1164
184 Ga0207671_11005321 3300025914 Bacteria 657
185 Ga0207660_10002637 3300025917 Bacteria 11764
186 Ga0207660_10044874 3300025917 Bacteria 3111
187 Ga0207657_10000435 3300025919 Bacteria 44495
188 Ga0207649_11003223 3300025920 Bacteria 657
189 Ga0207652_10008353 3300025921 Bacteria 8327
190 Ga0207652_10076835 3300025921 Bacteria 2913
191 Ga0207681_10325647 3300025923 Bacteria 1223
192 Ga0207694_10008963 3300025924 Bacteria 7554
193 Ga0207694_10107376 3300025924 Bacteria 2217
194 Ga0207694_10130904 3300025924 Bacteria 2011
195 Ga0207694_11614129 3300025924 Bacteria 546
196 Ga0207650_10000030 3300025925 Bacteria 235824
197 Ga0207650_10143812 3300025925 Bacteria 1877
198 Ga0207650_10155415 3300025925 Bacteria 1809
199 Ga0207650_10205472 3300025925 Bacteria 1580
200 Ga0207644_10017345 3300025931 Bacteria 4861
201 Ga0207644_10292799 3300025931 Bacteria 1310
202 Ga0207690_10000092 3300025932 Bacteria 74832
203 Ga0207690_10010641 3300025932 Bacteria 5480
204 Ga0207690_10041134 3300025932 Bacteria 3027
205 Ga0207704_10008604 3300025938 Bacteria 4889
206 Ga0207665_11296254 3300025939 Bacteria 581
207 Ga0207711_10004063 3300025941 Bacteria 12556
208 Ga0207711_10004978 3300025941 Bacteria 11272
209 Ga0207711_10031364 3300025941 Bacteria 4486
210 Ga0207711_10052669 3300025941 Bacteria 3489
211 Ga0207711_10743455 3300025941 Bacteria 914
212 Ga0207711_11574013 3300025941 Bacteria 600
213 Ga0207679_11523517 3300025945 Bacteria 613
214 Ga0207667_10004054 3300025949 Bacteria 17992
215 Ga0207667_10013524 3300025949 Bacteria 9332
216 Ga0207667_10063286 3300025949 Bacteria 3865
217 Ga0207667_10183699 3300025949 Bacteria 2147
218 Ga0207667_10536417 3300025949 Bacteria 1184
219 Ga0207667_11421131 3300025949 Bacteria 667
220 Ga0207651_11470277 3300025960 Bacteria 614
221 Ga0207712_10001603 3300025961 Bacteria 15207
222 Ga0207712_10452982 3300025961 Bacteria 1088
223 Ga0207712_10602494 3300025961 Bacteria 950
224 Ga0207668_10000019 3300025972 Bacteria 152108
225 Ga0207668_10002086 3300025972 Bacteria 11662
226 Ga0207668_10019264 3300025972 Bacteria 4310
227 Ga0207668_12103482 3300025972 Bacteria 508
228 Ga0207640_10516546 3300025981 Bacteria 997
229 Ga0207658_10000211 3300025986 Bacteria 60993
230 Ga0207658_10025500 3300025986 Bacteria 4140
231 Ga0207658_10210228 3300025986 Bacteria 1630
232 Ga0207658_11554589 3300025986 Bacteria 605
233 Ga0207703_10000723 3300026035 Bacteria 32469
234 Ga0207703_10022825 3300026035 Bacteria 4915
235 Ga0207703_10042622 3300026035 Bacteria 3641
236 Ga0207703_10057808 3300026035 Bacteria 3164
237 Ga0207703_10316215 3300026035 Bacteria 1429
238 Ga0207639_10026074 3300026041 Bacteria 4244
239 Ga0207639_10044521 3300026041 Bacteria 3338
240 Ga0207639_10543248 3300026041 Bacteria 1066
241 Ga0207678_10734075 3300026067 Bacteria 870
242 Ga0207702_10668890 3300026078 Bacteria 1022
243 Ga0207702_11849289 3300026078 Bacteria 595
244 Ga0207641_10000011 3300026088 Bacteria 384362
245 Ga0207641_10028568 3300026088 Bacteria 4608
246 Ga0207641_10036274 3300026088 Bacteria 4115
247 Ga0207641_10280174 3300026088 Bacteria 1568
248 Ga0207641_10923571 3300026088 Bacteria 867
249 Ga0207676_10000114 3300026095 Bacteria 71881
250 Ga0207676_10000757 3300026095 Bacteria 25281
251 Ga0207676_10029070 3300026095 Bacteria 4134
252 Ga0207676_10519364 3300026095 Bacteria 1133
253 Ga0207676_10717359 3300026095 Bacteria 970
254 Ga0207674_11045014 3300026116 Bacteria 786
255 Ga0207675_100033303 3300026118 Bacteria 4802
256 Ga0207675_100226693 3300026118 Bacteria 1802
257 Ga0207683_11173296 3300026121 Bacteria 712
258 Ga0207698_10738634 3300026142 Bacteria 982
259 Ga0209967_1011110 3300027364 Bacteria 1260
260 Ga0209981_1001131 3300027378 Bacteria 3378
261 Ga0209995_1070691 3300027471 Bacteria 597
262 Ga0209983_1004824 3300027665 Bacteria 2815
263 Ga0209813_10004640 3300027866 Bacteria 3291
264 Ga0268266_10000005 3300028379 Bacteria 1448194
265 Ga0268266_10000611 3300028379 Bacteria 48682
266 Ga0268266_10027265 3300028379 Bacteria 4858
267 Ga0268266_10073494 3300028379 Bacteria 2967
268 Ga0268266_10224926 3300028379 Bacteria 1726
269 Ga0268265_10021303 3300028380 Bacteria 4538
270 Ga0268265_10023119 3300028380 Bacteria 4378
271 Ga0268265_10200432 3300028380 Bacteria 1731
272 Ga0268265_10354694 3300028380 Bacteria 1340
273 Ga0268264_10000002 3300028381 Bacteria 1153045
274 Ga0268264_10000125 3300028381 Bacteria 186416
275 Ga0268264_10012833 3300028381 Bacteria 6896
276 Ga0307517_10101890 3300028786 Bacteria 2255
277 Ga0265338_10482269 3300028800 Bacteria 875
278 Ga0265331_10088373 3300031250 Bacteria 1434
279 Ga0265327_10000794 3300031251 Bacteria 48452
280 Ga0265327_10005301 3300031251 Bacteria 10820
281 Ga0265327_10225696 3300031251 Bacteria 841
282 Ga0307513_10001254 3300031456 Bacteria 36787
283 Ga0307513_10007722 3300031456 Bacteria 13886
284 Ga0307408_101063096 3300031548 Bacteria 749
285 Ga0307508_10687740 3300031616 Bacteria 631
286 Ga0307405_10625998 3300031731 Bacteria 882
287 Ga0307405_11203024 3300031731 Bacteria 655
288 Ga0307413_10122428 3300031824 Bacteria 1764
289 Ga0307410_10805246 3300031852 Bacteria 799
290 Ga0307412_11172098 3300031911 Bacteria 687
291 Ga0307412_11325312 3300031911 Bacteria 649
292 Ga0307409_100666819 3300031995 Bacteria 1036
293 Ga0307416_101008292 3300032002 Bacteria 936
294 Ga0307510_10018641 3300033180 Bacteria 8161
295 Ga0373944_0375746 3300035089 Bacteria 544
296 Ga0373923_0147450 3300035111 Bacteria 1067
297 Ga0373943_0511780 3300035170 Bacteria 702
298 Ga0373946_0161857 3300035171 Bacteria 1051
299 Ga0373927_0000358 3300035695 Bacteria 35421
300 Ga0373927_1052381 3300035695 Bacteria 537
301 Ga0373927_1143830 3300035695 Bacteria 513
302 Ga0373937_0511511 3300036401 Bacteria 1141
303 Ga0373925_0000160 3300037068 Bacteria 72172
304 Ga0373925_0436577 3300037068 Bacteria 1071
305 Ga0373925_1149220 3300037068 Bacteria 638
306 Ga0373925_1791727 3300037068 Bacteria 501
307 Ga0395899_0519820 3300037312 Bacteria 769
308 Ga0395900_0218393 3300037418 Bacteria 1923
309 Ga0395900_0311100 3300037418 Bacteria 1558
310 Ga0395900_1932879 3300037418 Bacteria 500
311 Ga0395898_0062907 3300037466 Bacteria 3602
312 Ga0395898_0508454 3300037466 Bacteria 1146
313 Ga0395898_0573443 3300037466 Bacteria 1071
314 Ga0395898_1108804 3300037466 Bacteria 724
315 Ga0395898_1897039 3300037466 Bacteria 516
316 Ga0395905_0098394 3300037471 Bacteria 2747
317 Ga0395905_0394622 3300037471 Bacteria 1278
318 Ga0395901_0345920 3300038443 Bacteria 1535
319 Ga0395901_0364449 3300038443 Bacteria 1489
320 Ga0395901_0468962 3300038443 Bacteria 1285
321 Ga0436365_0092142 3300039437 Bacteria 1563
322 Ga0436365_1429843 3300039437 Bacteria 501
323 Ga0436365_1869595 3300039437 Bacteria 2505
324 Ga0466960_0750795 3300044901 Bacteria 588
325 Ga0466958_0475944 3300045836 Bacteria 810
326 Ga0495650_0085761 3300046471 Bacteria 1206
327 Ga0495605_0483026 3300046474 Bacteria 508
328 Ga0495583_0022243 3300046506 Bacteria 3240
329 Ga0495628_0392598 3300046516 Bacteria 1015
330 Ga0495644_0113943 3300046523 Bacteria 1027
331 Ga0495648_0376495 3300046524 Bacteria 641
332 Ga0495663_0121832 3300046525 Bacteria 874
333 Ga0495642_0015618 3300046528 Bacteria 2954
334 Ga0495642_0439641 3300046528 Bacteria 576
335 Ga0495621_0257180 3300046539 Bacteria 714
336 Ga0495597_0164983 3300046542 Bacteria 902
337 Ga0495645_0078188 3300046543 Bacteria 2378
338 Ga0495633_0278525 3300046558 Bacteria 761
339 Ga0495611_0279962 3300046648 Bacteria 770
340 Ga0495625_0076448 3300046660 Bacteria 2341
341 Ga0495625_0167454 3300046660 Bacteria 1468
342 Ga0495625_0507668 3300046660 Bacteria 736
343 Ga0495625_0808925 3300046660 Bacteria 544
344 Ga0495659_0353716 3300046664 Bacteria 628
345 Ga0495669_0000109 3300046684 Bacteria 53382
346 Ga0495669_0164436 3300046684 Bacteria 1054
347 Ga0495669_0358142 3300046684 Bacteria 705
348 Ga0495649_0296114 3300046694 Bacteria 824
349 Ga0495674_0097763 3300047319 Bacteria 2500
350 Ga0495683_0160778 3300047323 Bacteria 1039
351 Ga0495681_0087099 3300047470 Bacteria 1385
352 Ga0495686_0006360 3300047472 Bacteria 9061
353 Ga0496100_0574977 3300048903 Bacteria 873
354 Ga0496100_0750729 3300048903 Bacteria 763
355 Ga0496101_0170943 3300048904 Bacteria 1671
356 Ga0496102_0286930 3300048905 Bacteria 1551
357 Ga0496102_0367053 3300048905 Bacteria 1355
358 Ga0496103_0100332 3300048906 Bacteria 1832
359 Ga0496103_0326439 3300048906 Bacteria 987
360 Ga0496106_0357028 3300048909 Bacteria 1174
361 Ga0496107_0326341 3300048910 Bacteria 1142
362 Ga0496108_0016995 3300048911 Bacteria 5947
363 Ga0496109_0183977 3300048912 Bacteria 1963
364 Ga0496110_0320533 3300048913 Bacteria 1412
365 Ga0496111_0732273 3300048914 Bacteria 718
366 Ga0496112_0026135 3300048915 Bacteria 5613
367 Ga0496112_0142258 3300048915 Bacteria 2368
368 Ga0496112_1077383 3300048915 Bacteria 722
369 Ga0496113_0101462 3300048916 Bacteria 2231
370 Ga0496115_0001611 3300048918 Bacteria 16221
371 Ga0496115_0006782 3300048918 Bacteria 8400
372 Ga0496125_0037440 3300048928 Bacteria 4218
373 Ga0501034_1358791 3300049571 Bacteria 586
374 Ga0501043_0098855 3300049579 Bacteria 2294
375 Ga0501047_0001670 3300049581 Bacteria 21581
376 Ga0501047_0053176 3300049581 Bacteria 3915
377 Ga0501047_0262114 3300049581 Bacteria 1576
378 Ga0501047_0940082 3300049581 Bacteria 678
379 Ga0501047_0965847 3300049581 Bacteria 665
380 Ga0501048_0140728 3300049582 Bacteria 1706
381 Ga0501035_0339083 3300049822 Bacteria 1260
382 Ga0501044_1004565 3300049823 Bacteria 706
383 nmdc:mga03n38_117030_c1 3300050490 Bacteria 1305
384 nmdc:mga00v17_11712_c1 3300050491 Bacteria 4825
385 nmdc:mga0yw44_193645_c1 3300050492 Bacteria 1341
386 nmdc:mga0k408_19140_c1 3300050493 Bacteria 3824
387 nmdc:mga06z11_2486_c1 3300050494 Bacteria 7054
388 nmdc:mga04h51_7820_c1 3300050495 Bacteria 2839
389 nmdc:mga07m45_38613_c1 3300050496 Bacteria 2665
390 nmdc:mga07m45_71952_c1 3300050496 Bacteria 1968
391 nmdc:mga0sz30_255132_c1 3300050516 Bacteria 781
392 Ga0500643_014050 3300053087 Bacteria 2799
393 Ga0500556_0162528 3300053104 Bacteria 881
394 Ga0500562_028554 3300053108 Bacteria 1466
395 Ga0500642_0015570 3300053130 Bacteria 2865
396 Ga0500645_001302 3300053730 Bacteria 12960
397 Ga0500645_043400 3300053730 Bacteria 1324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10036414 Ga0105240_100364146 100
2 3300025913 Ga0207695_10022613 Ga0207695_100226132 100
3 3300025949 Ga0207667_11421131 Ga0207667_114211311 100
4 3300005341 Ga0070691_10078087 Ga0070691_100780872 101
5 3300005344 Ga0070661_101337949 Ga0070661_1013379491 101
6 3300005458 Ga0070681_10079782 Ga0070681_100797822 101
7 3300005530 Ga0070679_100014918 Ga0070679_1000149184 101
8 3300005563 Ga0068855_100269320 Ga0068855_1002693202 101
9 3300006048 Ga0075363_100444259 Ga0075363_1004442591 101
10 3300006177 Ga0075362_10160483 Ga0075362_101604831 101
11 3300006177 Ga0075362_10387666 Ga0075362_103876662 101
12 3300009093 Ga0105240_10088550 Ga0105240_100885504 101
13 3300009551 Ga0105238_10011447 Ga0105238_100114472 101
14 3300013104 Ga0157370_10817426 Ga0157370_108174262 101
15 3300025912 Ga0207707_10044456 Ga0207707_100444562 101
16 3300025913 Ga0207695_10003226 Ga0207695_100032269 101
17 3300025920 Ga0207649_11003223 Ga0207649_110032231 101
18 3300025921 Ga0207652_10076835 Ga0207652_100768353 101
19 3300025924 Ga0207694_10107376 Ga0207694_101073762 101
20 3300025949 Ga0207667_10004054 Ga0207667_1000405412 101
21 3300026041 Ga0207639_10543248 Ga0207639_105432482 101
22 3300050490 nmdc:mga03n38_117030_c1 nmdc:mga03n38_117030_c1_203_562 101
23 3300050492 nmdc:mga0yw44_193645_c1 nmdc:mga0yw44_193645_c1_264_623 101
24 3300005456 Ga0070678_100260501 Ga0070678_1002605013 103
25 3300037471 Ga0395905_0394622 Ga0395905_0394622_258_614 105
26 3300005329 Ga0070683_101214225 Ga0070683_1012142252 108
27 3300009101 Ga0105247_10082027 Ga0105247_100820271 108
28 3300009177 Ga0105248_10395744 Ga0105248_103957442 108
29 3300009553 Ga0105249_10007310 Ga0105249_100073102 108
30 3300010375 Ga0105239_10100351 Ga0105239_101003512 108
31 3300014325 Ga0163163_10792801 Ga0163163_107928012 108
32 3300014968 Ga0157379_10005669 Ga0157379_100056699 108
33 3300048905 Ga0496102_0367053 Ga0496102_0367053_1003_1332 108
34 3300006042 Ga0075368_10002103 Ga0075368_100021036 109
35 3300006051 Ga0075364_10010180 Ga0075364_100101803 109
36 3300006178 Ga0075367_10003072 Ga0075367_100030725 109
37 3300006186 Ga0075369_10247281 Ga0075369_102472811 109
38 3300027866 Ga0209813_10004640 Ga0209813_100046403 109
39 3300039437 Ga0436365_1869595 Ga0436365_1869595_224_586 109
40 3300050491 nmdc:mga00v17_11712_c1 nmdc:mga00v17_11712_c1_752_1117 109
41 3300050494 nmdc:mga06z11_2486_c1 nmdc:mga06z11_2486_c1_6268_6633 109
42 3300050495 nmdc:mga04h51_7820_c1 nmdc:mga04h51_7820_c1_1456_1821 109
43 3300050496 nmdc:mga07m45_38613_c1 nmdc:mga07m45_38613_c1_170_535 109
44 3300050516 nmdc:mga0sz30_255132_c1 nmdc:mga0sz30_255132_c1_20_385 109
45 3300005335 Ga0070666_10405308 Ga0070666_104053082 111
46 3300005842 Ga0068858_100031424 Ga0068858_1000314244 111
47 3300013307 Ga0157372_12510922 Ga0157372_125109222 111
48 3300025903 Ga0207680_10119868 Ga0207680_101198682 111
49 3300026035 Ga0207703_10042622 Ga0207703_100426225 111
50 3300006195 Ga0075366_10065429 Ga0075366_100654293 112
51 3300006353 Ga0075370_10040383 Ga0075370_100403833 112
52 3300025924 Ga0207694_11614129 Ga0207694_116141292 112
53 3300031251 Ga0265327_10005301 Ga0265327_100053018 112
54 3300037068 Ga0373925_1791727 Ga0373925_1791727_19_378 112
55 3300046684 Ga0495669_0358142 Ga0495669_0358142_83_442 112
56 3300050493 nmdc:mga0k408_19140_c1 nmdc:mga0k408_19140_c1_1990_2355 112
57 3300050496 nmdc:mga07m45_71952_c1 nmdc:mga07m45_71952_c1_718_1083 112
58 3300053108 Ga0500562_028554 Ga0500562_028554_845_1201 112
59 3300009177 Ga0105248_12753905 Ga0105248_127539052 113
60 3300014968 Ga0157379_11112759 Ga0157379_111127591 113
61 3300026041 Ga0207639_10026074 Ga0207639_100260742 113
62 iso_pu_bacteria 2643221598 2643998314 114
63 iso_pu_bacteria 2643221661 2644341781 114
64 iso_pu_bacteria 2643221666 2644368068 114
65 3300005365 Ga0070688_101207730 Ga0070688_1012077301 117
66 3300005366 Ga0070659_100017175 Ga0070659_1000171754 117
67 3300006358 Ga0068871_100415333 Ga0068871_1004153332 117
68 3300009551 Ga0105238_10338595 Ga0105238_103385952 117
69 3300009551 Ga0105238_10527933 Ga0105238_105279332 117
70 3300010375 Ga0105239_10181678 Ga0105239_101816783 117
71 3300025913 Ga0207695_10007192 Ga0207695_1000719213 117
72 3300025924 Ga0207694_10130904 Ga0207694_101309041 117
73 3300025932 Ga0207690_10010641 Ga0207690_100106414 117
74 3300025986 Ga0207658_11554589 Ga0207658_115545892 117
75 3300026035 Ga0207703_10316215 Ga0207703_103162152 117
76 3300037466 Ga0395898_1897039 Ga0395898_1897039_17_370 117
77 3300005327 Ga0070658_10195973 Ga0070658_101959733 118
78 3300005327 Ga0070658_10585475 Ga0070658_105854752 118
79 3300005327 Ga0070658_10726466 Ga0070658_107264662 118
80 3300005327 Ga0070658_10804343 Ga0070658_108043432 118
81 3300005331 Ga0070670_100109777 Ga0070670_1001097773 118
82 3300005331 Ga0070670_100324448 Ga0070670_1003244482 118
83 3300005335 Ga0070666_11240442 Ga0070666_112404421 118
84 3300005336 Ga0070680_100059807 Ga0070680_1000598072 118
85 3300005338 Ga0068868_100321269 Ga0068868_1003212692 118
86 3300005338 Ga0068868_101652147 Ga0068868_1016521472 118
87 3300005339 Ga0070660_100211609 Ga0070660_1002116092 118
88 3300005344 Ga0070661_101332215 Ga0070661_1013322151 118
89 3300005347 Ga0070668_100001422 Ga0070668_10000142215 118
90 3300005347 Ga0070668_100005495 Ga0070668_1000054956 118
91 3300005347 Ga0070668_100006358 Ga0070668_1000063582 118
92 3300005347 Ga0070668_101342219 Ga0070668_1013422191 118
93 3300005353 Ga0070669_100182408 Ga0070669_1001824082 118
94 3300005353 Ga0070669_100278536 Ga0070669_1002785362 118
95 3300005355 Ga0070671_100045470 Ga0070671_1000454702 118
96 3300005355 Ga0070671_100069133 Ga0070671_1000691334 118
97 3300005355 Ga0070671_100510445 Ga0070671_1005104452 118
98 3300005366 Ga0070659_100002614 Ga0070659_1000026147 118
99 3300005366 Ga0070659_100009203 Ga0070659_1000092038 118
100 3300005366 Ga0070659_102037260 Ga0070659_1020372601 118
101 3300005367 Ga0070667_100002972 Ga0070667_1000029726 118
102 3300005367 Ga0070667_100013139 Ga0070667_1000131396 118
103 3300005367 Ga0070667_100027596 Ga0070667_1000275963 118
104 3300005367 Ga0070667_100349256 Ga0070667_1003492562 118
105 3300005455 Ga0070663_100272938 Ga0070663_1002729383 118
106 3300005455 Ga0070663_102029654 Ga0070663_1020296542 118
107 3300005456 Ga0070678_100849542 Ga0070678_1008495422 118
108 3300005457 Ga0070662_101005872 Ga0070662_1010058722 118
109 3300005458 Ga0070681_10006243 Ga0070681_1000624312 118
110 3300005458 Ga0070681_11450343 Ga0070681_114503432 118
111 3300005458 Ga0070681_11559460 Ga0070681_115594601 118
112 3300005459 Ga0068867_102040005 Ga0068867_1020400051 118
113 3300005530 Ga0070679_100002173 Ga0070679_10000217313 118
114 3300005530 Ga0070679_100899260 Ga0070679_1008992601 118
115 3300005535 Ga0070684_101660225 Ga0070684_1016602251 118
116 3300005535 Ga0070684_101960604 Ga0070684_1019606041 118
117 3300005539 Ga0068853_100015561 Ga0068853_1000155612 118
118 3300005539 Ga0068853_101727803 Ga0068853_1017278031 118
119 3300005548 Ga0070665_100000517 Ga0070665_10000051748 118
120 3300005548 Ga0070665_100000744 Ga0070665_1000007447 118
121 3300005548 Ga0070665_100004164 Ga0070665_10000416414 118
122 3300005548 Ga0070665_100054965 Ga0070665_1000549655 118
123 3300005548 Ga0070665_100325271 Ga0070665_1003252713 118
124 3300005548 Ga0070665_101017266 Ga0070665_1010172662 118
125 3300005563 Ga0068855_100011378 Ga0068855_10001137811 118
126 3300005563 Ga0068855_100045611 Ga0068855_1000456112 118
127 3300005563 Ga0068855_100624660 Ga0068855_1006246602 118
128 3300005563 Ga0068855_100949748 Ga0068855_1009497482 118
129 3300005564 Ga0070664_100247775 Ga0070664_1002477753 118
130 3300005578 Ga0068854_100699641 Ga0068854_1006996412 118
131 3300005614 Ga0068856_100512427 Ga0068856_1005124272 118
132 3300005616 Ga0068852_101139355 Ga0068852_1011393552 118
133 3300005617 Ga0068859_100002155 Ga0068859_10000215519 118
134 3300005617 Ga0068859_100398111 Ga0068859_1003981112 118
135 3300005618 Ga0068864_100000093 Ga0068864_10000009395 118
136 3300005618 Ga0068864_100004767 Ga0068864_1000047676 118
137 3300005618 Ga0068864_100010560 Ga0068864_1000105604 118
138 3300005618 Ga0068864_100123357 Ga0068864_1001233572 118
139 3300005618 Ga0068864_100872408 Ga0068864_1008724082 118
140 3300005719 Ga0068861_100008049 Ga0068861_1000080496 118
141 3300005719 Ga0068861_100446781 Ga0068861_1004467812 118
142 3300005841 Ga0068863_100000045 Ga0068863_100000045104 118
143 3300005841 Ga0068863_100015616 Ga0068863_1000156164 118
144 3300005841 Ga0068863_100057765 Ga0068863_1000577655 118
145 3300005841 Ga0068863_100189067 Ga0068863_1001890673 118
146 3300005841 Ga0068863_100189274 Ga0068863_1001892743 118
147 3300005841 Ga0068863_100461351 Ga0068863_1004613512 118
148 3300005841 Ga0068863_100731422 Ga0068863_1007314222 118
149 3300005842 Ga0068858_100000144 Ga0068858_10000014430 118
150 3300005842 Ga0068858_100024542 Ga0068858_1000245426 118
151 3300005843 Ga0068860_100000109 Ga0068860_10000010981 118
152 3300005843 Ga0068860_100006980 Ga0068860_1000069806 118
153 3300005843 Ga0068860_100031729 Ga0068860_1000317296 118
154 3300005843 Ga0068860_100249639 Ga0068860_1002496392 118
155 3300005844 Ga0068862_100007193 Ga0068862_1000071936 118
156 3300005844 Ga0068862_100140413 Ga0068862_1001404132 118
157 3300005844 Ga0068862_100220557 Ga0068862_1002205572 118
158 3300006028 Ga0070717_10279426 Ga0070717_102794262 118
159 3300006028 Ga0070717_10869102 Ga0070717_108691022 118
160 3300006173 Ga0070716_101231941 Ga0070716_1012319412 118
161 3300006358 Ga0068871_100550758 Ga0068871_1005507582 118
162 3300006881 Ga0068865_100001402 Ga0068865_1000014029 118
163 3300006881 Ga0068865_100467332 Ga0068865_1004673321 118
164 3300006931 Ga0097620_100002155 Ga0097620_10000215519 118
165 3300006931 Ga0097620_100398119 Ga0097620_1003981192 118
166 3300009011 Ga0105251_10349386 Ga0105251_103493862 118
167 3300009092 Ga0105250_10009814 Ga0105250_100098144 118
168 3300009093 Ga0105240_10035261 Ga0105240_100352612 118
169 3300009093 Ga0105240_10107839 Ga0105240_101078392 118
170 3300009093 Ga0105240_10449844 Ga0105240_104498442 118
171 3300009101 Ga0105247_10762750 Ga0105247_107627502 118
172 3300009174 Ga0105241_11366634 Ga0105241_113666342 118
173 3300009174 Ga0105241_12317193 Ga0105241_123171931 118
174 3300009174 Ga0105241_12458191 Ga0105241_124581911 118
175 3300009177 Ga0105248_10000303 Ga0105248_1000030332 118
176 3300009177 Ga0105248_10052086 Ga0105248_100520862 118
177 3300009177 Ga0105248_10152139 Ga0105248_101521395 118
178 3300009177 Ga0105248_10748845 Ga0105248_107488451 118
179 3300009177 Ga0105248_11156421 Ga0105248_111564212 118
180 3300009551 Ga0105238_10126187 Ga0105238_101261871 118
181 3300009553 Ga0105249_10164597 Ga0105249_101645973 118
182 3300009553 Ga0105249_10297567 Ga0105249_102975673 118
183 3300009553 Ga0105249_10703572 Ga0105249_107035722 118
184 3300010375 Ga0105239_10158319 Ga0105239_101583193 118
185 3300010375 Ga0105239_10303633 Ga0105239_103036332 118
186 3300013104 Ga0157370_10083830 Ga0157370_100838304 118
187 3300013105 Ga0157369_10320503 Ga0157369_103205032 118
188 3300013296 Ga0157374_10355269 Ga0157374_103552692 118
189 3300013296 Ga0157374_11048049 Ga0157374_110480492 118
190 3300013306 Ga0163162_10319474 Ga0163162_103194742 118
191 3300013307 Ga0157372_10201135 Ga0157372_102011353 118
192 3300013308 Ga0157375_10519685 Ga0157375_105196853 118
193 3300013308 Ga0157375_11623676 Ga0157375_116236762 118
194 3300014325 Ga0163163_10062599 Ga0163163_100625992 118
195 3300014325 Ga0163163_10070721 Ga0163163_100707213 118
196 3300014497 Ga0182008_10473463 Ga0182008_104734632 118
197 3300014968 Ga0157379_10065935 Ga0157379_100659354 118
198 3300014969 Ga0157376_10429903 Ga0157376_104299032 118
199 3300015262 Ga0182007_10023975 Ga0182007_100239753 118
200 3300017792 Ga0163161_11002062 Ga0163161_110020622 118
201 3300017792 Ga0163161_11328233 Ga0163161_113282332 118
202 3300021384 Ga0213876_10102652 Ga0213876_101026523 118
203 3300025261 Ga0209233_1066241 Ga0209233_10662412 118
204 3300025711 Ga0207696_1041483 Ga0207696_10414832 118
205 3300025903 Ga0207680_10652122 Ga0207680_106521222 118
206 3300025903 Ga0207680_10665240 Ga0207680_106652402 118
207 3300025909 Ga0207705_10001192 Ga0207705_1000119211 118
208 3300025909 Ga0207705_10082009 Ga0207705_100820094 118
209 3300025909 Ga0207705_10799036 Ga0207705_107990361 118
210 3300025909 Ga0207705_11007421 Ga0207705_110074212 118
211 3300025909 Ga0207705_11297513 Ga0207705_112975132 118
212 3300025912 Ga0207707_10010989 Ga0207707_100109892 118
213 3300025912 Ga0207707_10060605 Ga0207707_100606054 118
214 3300025912 Ga0207707_11272336 Ga0207707_112723361 118
215 3300025913 Ga0207695_10005953 Ga0207695_1000595313 118
216 3300025913 Ga0207695_10265562 Ga0207695_102655622 118
217 3300025913 Ga0207695_10454392 Ga0207695_104543922 118
218 3300025914 Ga0207671_11005321 Ga0207671_110053212 118
219 3300025917 Ga0207660_10002637 Ga0207660_1000263712 118
220 3300025917 Ga0207660_10044874 Ga0207660_100448743 118
221 3300025919 Ga0207657_10000435 Ga0207657_1000043537 118
222 3300025921 Ga0207652_10008353 Ga0207652_100083537 118
223 3300025923 Ga0207681_10325647 Ga0207681_103256472 118
224 3300025924 Ga0207694_10008963 Ga0207694_100089636 118
225 3300025925 Ga0207650_10000030 Ga0207650_10000030113 118
226 3300025925 Ga0207650_10143812 Ga0207650_101438122 118
227 3300025925 Ga0207650_10155415 Ga0207650_101554152 118
228 3300025925 Ga0207650_10205472 Ga0207650_102054721 118
229 3300025931 Ga0207644_10017345 Ga0207644_100173452 118
230 3300025931 Ga0207644_10292799 Ga0207644_102927993 118
231 3300025932 Ga0207690_10000092 Ga0207690_1000009275 118
232 3300025932 Ga0207690_10041134 Ga0207690_100411342 118
233 3300025938 Ga0207704_10008604 Ga0207704_100086046 118
234 3300025939 Ga0207665_11296254 Ga0207665_112962541 118
235 3300025941 Ga0207711_10004063 Ga0207711_100040638 118
236 3300025941 Ga0207711_10004978 Ga0207711_100049786 118
237 3300025941 Ga0207711_10031364 Ga0207711_100313643 118
238 3300025941 Ga0207711_10052669 Ga0207711_100526695 118
239 3300025941 Ga0207711_10743455 Ga0207711_107434552 118
240 3300025941 Ga0207711_11574013 Ga0207711_115740132 118
241 3300025945 Ga0207679_11523517 Ga0207679_115235171 118
242 3300025949 Ga0207667_10013524 Ga0207667_100135243 118
243 3300025949 Ga0207667_10063286 Ga0207667_100632863 118
244 3300025949 Ga0207667_10183699 Ga0207667_101836991 118
245 3300025949 Ga0207667_10536417 Ga0207667_105364172 118
246 3300025960 Ga0207651_11470277 Ga0207651_114702772 118
247 3300025961 Ga0207712_10001603 Ga0207712_100016039 118
248 3300025961 Ga0207712_10452982 Ga0207712_104529822 118
249 3300025961 Ga0207712_10602494 Ga0207712_106024942 118
250 3300025972 Ga0207668_10000019 Ga0207668_1000001946 118
251 3300025972 Ga0207668_10002086 Ga0207668_100020866 118
252 3300025972 Ga0207668_10019264 Ga0207668_100192642 118
253 3300025972 Ga0207668_12103482 Ga0207668_121034822 118
254 3300025981 Ga0207640_10516546 Ga0207640_105165462 118
255 3300025986 Ga0207658_10000211 Ga0207658_1000021156 118
256 3300025986 Ga0207658_10025500 Ga0207658_100255007 118
257 3300025986 Ga0207658_10210228 Ga0207658_102102282 118
258 3300026035 Ga0207703_10000723 Ga0207703_100007235 118
259 3300026035 Ga0207703_10022825 Ga0207703_100228256 118
260 3300026035 Ga0207703_10057808 Ga0207703_100578082 118
261 3300026041 Ga0207639_10044521 Ga0207639_100445213 118
262 3300026067 Ga0207678_10734075 Ga0207678_107340752 118
263 3300026078 Ga0207702_10668890 Ga0207702_106688902 118
264 3300026078 Ga0207702_11849289 Ga0207702_118492892 118
265 3300026088 Ga0207641_10000011 Ga0207641_1000001158 118
266 3300026088 Ga0207641_10028568 Ga0207641_100285684 118
267 3300026088 Ga0207641_10036274 Ga0207641_100362743 118
268 3300026088 Ga0207641_10280174 Ga0207641_102801742 118
269 3300026088 Ga0207641_10923571 Ga0207641_109235712 118
270 3300026095 Ga0207676_10000114 Ga0207676_1000011426 118
271 3300026095 Ga0207676_10000757 Ga0207676_100007579 118
272 3300026095 Ga0207676_10029070 Ga0207676_100290702 118
273 3300026095 Ga0207676_10519364 Ga0207676_105193642 118
274 3300026095 Ga0207676_10717359 Ga0207676_107173592 118
275 3300026116 Ga0207674_11045014 Ga0207674_110450142 118
276 3300026118 Ga0207675_100033303 Ga0207675_1000333035 118
277 3300026118 Ga0207675_100226693 Ga0207675_1002266933 118
278 3300026121 Ga0207683_11173296 Ga0207683_111732961 118
279 3300026142 Ga0207698_10738634 Ga0207698_107386342 118
280 3300027364 Ga0209967_1011110 Ga0209967_10111102 118
281 3300027378 Ga0209981_1001131 Ga0209981_10011313 118
282 3300027471 Ga0209995_1070691 Ga0209995_10706912 118
283 3300027665 Ga0209983_1004824 Ga0209983_10048242 118
284 3300028379 Ga0268266_10000005 Ga0268266_10000005313 118
285 3300028379 Ga0268266_10000611 Ga0268266_1000061137 118
286 3300028379 Ga0268266_10027265 Ga0268266_100272652 118
287 3300028379 Ga0268266_10073494 Ga0268266_100734945 118
288 3300028379 Ga0268266_10224926 Ga0268266_102249262 118
289 3300028380 Ga0268265_10021303 Ga0268265_100213035 118
290 3300028380 Ga0268265_10023119 Ga0268265_100231192 118
291 3300028380 Ga0268265_10200432 Ga0268265_102004322 118
292 3300028380 Ga0268265_10354694 Ga0268265_103546942 118
293 3300028381 Ga0268264_10000002 Ga0268264_10000002632 118
294 3300028381 Ga0268264_10000125 Ga0268264_1000012588 118
295 3300028381 Ga0268264_10012833 Ga0268264_100128334 118
296 3300028786 Ga0307517_10101890 Ga0307517_101018903 118
297 3300028800 Ga0265338_10482269 Ga0265338_104822692 118
298 3300031250 Ga0265331_10088373 Ga0265331_100883732 118
299 3300031251 Ga0265327_10000794 Ga0265327_1000079439 118
300 3300031251 Ga0265327_10225696 Ga0265327_102256962 118
301 3300031456 Ga0307513_10001254 Ga0307513_1000125431 118
302 3300031456 Ga0307513_10007722 Ga0307513_100077222 118
303 3300031548 Ga0307408_101063096 Ga0307408_1010630962 118
304 3300031616 Ga0307508_10687740 Ga0307508_106877402 118
305 3300031731 Ga0307405_10625998 Ga0307405_106259982 118
306 3300031731 Ga0307405_11203024 Ga0307405_112030242 118
307 3300031824 Ga0307413_10122428 Ga0307413_101224283 118
308 3300031852 Ga0307410_10805246 Ga0307410_108052462 118
309 3300031911 Ga0307412_11172098 Ga0307412_111720982 118
310 3300031911 Ga0307412_11325312 Ga0307412_113253122 118
311 3300031995 Ga0307409_100666819 Ga0307409_1006668192 118
312 3300032002 Ga0307416_101008292 Ga0307416_1010082922 118
313 3300033180 Ga0307510_10018641 Ga0307510_100186418 118
314 3300035089 Ga0373944_0375746 Ga0373944_0375746_137_493 118
315 3300035111 Ga0373923_0147450 Ga0373923_0147450_128_484 118
316 3300035170 Ga0373943_0511780 Ga0373943_0511780_218_574 118
317 3300035171 Ga0373946_0161857 Ga0373946_0161857_485_841 118
318 3300035695 Ga0373927_0000358 Ga0373927_0000358_8098_8454 118
319 3300035695 Ga0373927_1052381 Ga0373927_1052381_10_369 118
320 3300035695 Ga0373927_1143830 Ga0373927_1143830_20_385 118
321 3300036401 Ga0373937_0511511 Ga0373937_0511511_107_475 118
322 3300037068 Ga0373925_0000160 Ga0373925_0000160_66219_66575 118
323 3300037068 Ga0373925_0436577 Ga0373925_0436577_690_1055 118
324 3300037068 Ga0373925_1149220 Ga0373925_1149220_188_544 118
325 3300037312 Ga0395899_0519820 Ga0395899_0519820_243_599 118
326 3300037418 Ga0395900_0218393 Ga0395900_0218393_587_943 118
327 3300037418 Ga0395900_0311100 Ga0395900_0311100_661_1017 118
328 3300037418 Ga0395900_1932879 Ga0395900_1932879_116_472 118
329 3300037466 Ga0395898_0062907 Ga0395898_0062907_878_1234 118
330 3300037466 Ga0395898_0508454 Ga0395898_0508454_590_946 118
331 3300037466 Ga0395898_0573443 Ga0395898_0573443_490_846 118
332 3300037466 Ga0395898_1108804 Ga0395898_1108804_340_696 118
333 3300037471 Ga0395905_0098394 Ga0395905_0098394_989_1345 118
334 3300038443 Ga0395901_0345920 Ga0395901_0345920_633_989 118
335 3300038443 Ga0395901_0364449 Ga0395901_0364449_192_548 118
336 3300038443 Ga0395901_0468962 Ga0395901_0468962_736_1092 118
337 3300039437 Ga0436365_0092142 Ga0436365_0092142_994_1353 118
338 3300039437 Ga0436365_1429843 Ga0436365_1429843_63_422 118
339 3300044901 Ga0466960_0750795 Ga0466960_0750795_16_375 118
340 3300045836 Ga0466958_0475944 Ga0466958_0475944_435_791 118
341 3300046471 Ga0495650_0085761 Ga0495650_0085761_492_851 118
342 3300046474 Ga0495605_0483026 Ga0495605_0483026_131_490 118
343 3300046506 Ga0495583_0022243 Ga0495583_0022243_1381_1740 118
344 3300046516 Ga0495628_0392598 Ga0495628_0392598_582_950 118
345 3300046523 Ga0495644_0113943 Ga0495644_0113943_611_970 118
346 3300046524 Ga0495648_0376495 Ga0495648_0376495_85_444 118
347 3300046525 Ga0495663_0121832 Ga0495663_0121832_119_478 118
348 3300046528 Ga0495642_0015618 Ga0495642_0015618_2554_2913 118
349 3300046528 Ga0495642_0439641 Ga0495642_0439641_133_492 118
350 3300046539 Ga0495621_0257180 Ga0495621_0257180_301_660 118
351 3300046542 Ga0495597_0164983 Ga0495597_0164983_62_421 118
352 3300046543 Ga0495645_0078188 Ga0495645_0078188_185_553 118
353 3300046558 Ga0495633_0278525 Ga0495633_0278525_153_512 118
354 3300046648 Ga0495611_0279962 Ga0495611_0279962_34_393 118
355 3300046660 Ga0495625_0076448 Ga0495625_0076448_1728_2087 118
356 3300046660 Ga0495625_0167454 Ga0495625_0167454_165_524 118
357 3300046660 Ga0495625_0507668 Ga0495625_0507668_278_637 118
358 3300046660 Ga0495625_0808925 Ga0495625_0808925_119_478 118
359 3300046664 Ga0495659_0353716 Ga0495659_0353716_83_442 118
360 3300046684 Ga0495669_0000109 Ga0495669_0000109_10969_11337 118
361 3300046684 Ga0495669_0164436 Ga0495669_0164436_664_1023 118
362 3300046694 Ga0495649_0296114 Ga0495649_0296114_45_413 118
363 3300047319 Ga0495674_0097763 Ga0495674_0097763_2038_2406 118
364 3300047323 Ga0495683_0160778 Ga0495683_0160778_529_888 118
365 3300047470 Ga0495681_0087099 Ga0495681_0087099_945_1304 118
366 3300047472 Ga0495686_0006360 Ga0495686_0006360_5775_6134 118
367 3300048903 Ga0496100_0574977 Ga0496100_0574977_61_420 118
368 3300048903 Ga0496100_0750729 Ga0496100_0750729_29_385 118
369 3300048904 Ga0496101_0170943 Ga0496101_0170943_62_418 118
370 3300048905 Ga0496102_0286930 Ga0496102_0286930_96_455 118
371 3300048906 Ga0496103_0100332 Ga0496103_0100332_497_859 118
372 3300048906 Ga0496103_0326439 Ga0496103_0326439_342_701 118
373 3300048909 Ga0496106_0357028 Ga0496106_0357028_292_654 118
374 3300048910 Ga0496107_0326341 Ga0496107_0326341_704_1063 118
375 3300048911 Ga0496108_0016995 Ga0496108_0016995_3859_4218 118
376 3300048912 Ga0496109_0183977 Ga0496109_0183977_991_1350 118
377 3300048913 Ga0496110_0320533 Ga0496110_0320533_744_1103 118
378 3300048914 Ga0496111_0732273 Ga0496111_0732273_128_487 118
379 3300048915 Ga0496112_0026135 Ga0496112_0026135_3790_4158 118
380 3300048915 Ga0496112_0142258 Ga0496112_0142258_1768_2127 118
381 3300048915 Ga0496112_1077383 Ga0496112_1077383_281_637 118
382 3300048916 Ga0496113_0101462 Ga0496113_0101462_1831_2190 118
383 3300048918 Ga0496115_0001611 Ga0496115_0001611_2340_2696 118
384 3300048918 Ga0496115_0006782 Ga0496115_0006782_2201_2557 118
385 3300048928 Ga0496125_0037440 Ga0496125_0037440_2630_2986 118
386 3300049571 Ga0501034_1358791 Ga0501034_1358791_59_415 118
387 3300049579 Ga0501043_0098855 Ga0501043_0098855_1647_2003 118
388 3300049581 Ga0501047_0001670 Ga0501047_0001670_17457_17813 118
389 3300049581 Ga0501047_0053176 Ga0501047_0053176_2687_3043 118
390 3300049581 Ga0501047_0262114 Ga0501047_0262114_634_990 118
391 3300049581 Ga0501047_0940082 Ga0501047_0940082_22_378 118
392 3300049581 Ga0501047_0965847 Ga0501047_0965847_131_487 118
393 3300049582 Ga0501048_0140728 Ga0501048_0140728_1263_1619 118
394 3300049822 Ga0501035_0339083 Ga0501035_0339083_283_639 118
395 3300049823 Ga0501044_1004565 Ga0501044_1004565_236_592 118
396 3300053087 Ga0500643_014050 Ga0500643_014050_608_967 118
397 3300053104 Ga0500556_0162528 Ga0500556_0162528_284_643 118
398 3300053130 Ga0500642_0015570 Ga0500642_0015570_1888_2247 118
399 3300053730 Ga0500645_001302 Ga0500645_001302_3034_3393 118
400 3300053730 Ga0500645_043400 Ga0500645_043400_685_1053 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

24

108

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oqu-assembly1.cif.gz_P e. coli atp synthase state 1d 0.6502 41 109
6oqu-assembly1.cif.gz_P e. coli atp synthase state 1d 0.5632 41 109
4cbk-assembly1.cif.gz_B the c-ring ion binding site of the atp synthase from bacillus pseudofirmus of4 is adapted to alkaliphilic cell physiology 0.4996 41 109
5xtc-assembly1.cif.gz_g cryo-em structure of human respiratory complex i transmembrane arm 0.4887 26 114
4cbk-assembly1.cif.gz_B the c-ring ion binding site of the atp synthase from bacillus pseudofirmus of4 is adapted to alkaliphilic cell physiology 0.4783 41 109
ID Description Score Start End Superfamily
5fl7L00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5647 41 106 1.20.20.10
4cbjH00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5095 41 109 1.20.20.10
4cbjF00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5057 41 109 1.20.20.10
2x2vE00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5013 41 109 1.20.20.10
2x2vM00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5012 41 109 1.20.20.10
ID Description Score Start End GO Terms
AF-W9H1Z7-F1-model_v4 Zinc-finger protein 0.918 8 111 GO:0016020
AF-A0A2S6NNW1-F1-model_v4 DUF983 domain-containing protein 0.9145 5 112 GO:0016020
AF-A0A259JWV1-F1-model_v4 S1 motif domain-containing protein 0.9136 5 111 GO:0003723
GO:0004527
GO:0004540
GO:0005829
GO:0006402
GO:0016020
AF-A0A521LQB6-F1-model_v4 DUF983 domain-containing protein 0.9111 5 111 GO:0016020
AF-A0A839LQT5-F1-model_v4 deleted 0.9102 1 118

Feature Viewer

pLDDT pTM Quality
81.21 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map