F434571

General Info

Members Datasets Scaffolds Average Seq Length
400 173 800 118

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_11025960|Ga0105246_110259602
Length 144
Sequence MDMLSMLVICSLWYNFSTCKTFCDGEAMSQWIYIGLFFIVGLLIPVSAIAVAWILGPKKPNPIKQSTYECGIETVGDSWVQFKAQYYIFALVFLVFDVETVFLFPWAVKLSQLGLFAVVEGIIFILILIAGLVYTWRKGMLEWA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
159 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.75
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_11025960 3300011119 Bacteria 748
2 SwRhRL2b_contig_366991 2162886007 Unclassified 2895
3 JGI25406J46586_10015545 3300003203 Bacteria 3206
4 rootL2_10034859 3300003322 Bacteria 2023
5 Ga0058859_11779417 3300004798 Bacteria 689
6 Ga0058859_11789624 3300004798 Bacteria 1303
7 Ga0058860_12093990 3300004801 Bacteria 764
8 Ga0065704_10089970 3300005289 Bacteria 2820
9 Ga0065712_10350406 3300005290 Unclassified 788
10 Ga0065715_11017631 3300005293 Unclassified 540
11 Ga0065707_10000491 3300005295 Bacteria 31842
12 Ga0065707_10002015 3300005295 Bacteria 5505
13 Ga0065707_10023774 3300005295 Bacteria 1454
14 Ga0065707_10097608 3300005295 Bacteria 3159
15 Ga0065707_10757144 3300005295 Unclassified 616
16 Ga0065707_10783249 3300005295 Bacteria 606
17 Ga0065707_10847647 3300005295 Bacteria 583
18 Ga0070690_100376524 3300005330 Bacteria 1037
19 Ga0068869_101463840 3300005334 Bacteria 606
20 Ga0070666_11086032 3300005335 Unclassified 595
21 Ga0070680_100147137 3300005336 Bacteria 1977
22 Ga0070682_100708390 3300005337 Bacteria 808
23 Ga0070689_100636433 3300005340 Bacteria 927
24 Ga0070689_100917246 3300005340 Bacteria 776
25 Ga0070687_100238784 3300005343 Bacteria 1122
26 Ga0070675_100388671 3300005354 Bacteria 1243
27 Ga0070673_100647020 3300005364 Unclassified 967
28 Ga0070688_100417325 3300005365 Bacteria 997
29 Ga0070667_100960108 3300005367 Bacteria 797
30 Ga0070701_11251690 3300005438 Unclassified 528
31 Ga0070705_100579044 3300005440 Bacteria 865
32 Ga0070705_100786595 3300005440 Bacteria 756
33 Ga0070700_100019187 3300005441 Bacteria 3944
34 Ga0070700_100434571 3300005441 Bacteria 995
35 Ga0070700_101081499 3300005441 Bacteria 664
36 Ga0070694_100162432 3300005444 Bacteria 1640
37 Ga0070694_100164847 3300005444 Bacteria 1629
38 Ga0070694_100306406 3300005444 Bacteria 1218
39 Ga0070694_100609319 3300005444 Bacteria 880
40 Ga0070694_101103994 3300005444 Bacteria 662
41 Ga0070662_101418756 3300005457 Bacteria 598
42 Ga0070662_101469154 3300005457 Bacteria 588
43 Ga0070685_10149705 3300005466 Bacteria 1478
44 Ga0070706_100325647 3300005467 Bacteria 1433
45 Ga0070706_100793946 3300005467 Bacteria 876
46 Ga0070707_100078233 3300005468 Bacteria 3190
47 Ga0070707_100773396 3300005468 Bacteria 924
48 Ga0070707_100777808 3300005468 Bacteria 921
49 Ga0070707_101157185 3300005468 Bacteria 740
50 Ga0070698_100101941 3300005471 Bacteria 2841
51 Ga0070698_100107016 3300005471 Bacteria 2765
52 Ga0070698_100286169 3300005471 Bacteria 1579
53 Ga0070698_100462462 3300005471 Bacteria 1205
54 Ga0070698_100482581 3300005471 Bacteria 1176
55 Ga0070698_102064431 3300005471 Bacteria 523
56 Ga0070699_100011209 3300005518 Bacteria 7745
57 Ga0070699_100085366 3300005518 Bacteria 2755
58 Ga0070699_100100003 3300005518 Bacteria 2542
59 Ga0070699_100380169 3300005518 Bacteria 1275
60 Ga0070699_100536189 3300005518 Bacteria 1065
61 Ga0070699_100852173 3300005518 Bacteria 834
62 Ga0070684_100101906 3300005535 Bacteria 2566
63 Ga0070686_100148195 3300005544 Bacteria 1641
64 Ga0070695_100961928 3300005545 Bacteria 693
65 Ga0070696_100206742 3300005546 Bacteria 1468
66 Ga0070696_100488376 3300005546 Bacteria 978
67 Ga0070696_100687724 3300005546 Bacteria 833
68 Ga0070693_100574489 3300005547 Viruses 810
69 Ga0070693_101143450 3300005547 Bacteria 595
70 Ga0070704_100870551 3300005549 Bacteria 809
71 Ga0070704_101291349 3300005549 Bacteria 668
72 Ga0068857_100122946 3300005577 Unclassified 2338
73 Ga0068857_100520348 3300005577 Bacteria 1118
74 Ga0068859_100441754 3300005617 Bacteria 1397
75 Ga0068859_101076038 3300005617 Bacteria 884
76 Ga0068859_101899234 3300005617 Bacteria 657
77 Ga0068864_100055563 3300005618 Bacteria 3419
78 Ga0068864_100687168 3300005618 Bacteria 999
79 Ga0068864_101781647 3300005618 Unclassified 621
80 Ga0068861_100039538 3300005719 Bacteria 3521
81 Ga0068861_100251345 3300005719 Bacteria 1508
82 Ga0068870_10797528 3300005840 Bacteria 660
83 Ga0068863_100270571 3300005841 Bacteria 1644
84 Ga0068858_100089971 3300005842 Bacteria 2856
85 Ga0068860_101291956 3300005843 Bacteria 750
86 Ga0068860_102452153 3300005843 Unclassified 541
87 Ga0068862_100056783 3300005844 Unclassified 3355
88 Ga0068862_100142214 3300005844 Bacteria 2130
89 Ga0068862_100202908 3300005844 Bacteria 1789
90 Ga0081539_10003721 3300005985 Bacteria 18169
91 Ga0075365_11130773 3300006038 Bacteria 551
92 Ga0075427_10004767 3300006194 Bacteria 1914
93 Ga0075370_11021416 3300006353 Bacteria 507
94 Ga0068871_101704055 3300006358 Bacteria 598
95 Ga0075428_100133422 3300006844 Bacteria 2700
96 Ga0075428_100241026 3300006844 Bacteria 1951
97 Ga0075428_100602417 3300006844 Bacteria 1173
98 Ga0075428_101980910 3300006844 Unclassified 604
99 Ga0075430_100229064 3300006846 Bacteria 1541
100 Ga0075430_100233341 3300006846 Bacteria 1525
101 Ga0075430_100482026 3300006846 Bacteria 1023
102 Ga0075431_100103380 3300006847 Bacteria 2940
103 Ga0075431_100160740 3300006847 Bacteria 2310
104 Ga0075431_100890678 3300006847 Bacteria 860
105 Ga0075431_101120784 3300006847 Bacteria 751
106 Ga0075431_101542592 3300006847 Bacteria 622
107 Ga0075433_10054511 3300006852 Bacteria 3488
108 Ga0075433_10096788 3300006852 Bacteria 2612
109 Ga0075433_10122082 3300006852 Bacteria 2314
110 Ga0075433_10728596 3300006852 Bacteria 868
111 Ga0075433_10839849 3300006852 Unclassified 802
112 Ga0075434_100574378 3300006871 Bacteria 1147
113 Ga0075434_101443481 3300006871 Bacteria 698
114 Ga0075434_101776655 3300006871 Bacteria 624
115 Ga0075429_100021228 3300006880 Bacteria 5629
116 Ga0075429_100025585 3300006880 Bacteria 5123
117 Ga0075429_100299468 3300006880 Unclassified 1408
118 Ga0075429_100400795 3300006880 Bacteria 1202
119 Ga0075429_100607279 3300006880 Bacteria 958
120 Ga0097620_100441796 3300006931 Bacteria 1397
121 Ga0097620_101076097 3300006931 Bacteria 884
122 Ga0097620_101899294 3300006931 Bacteria 657
123 Ga0105240_11031568 3300009093 Bacteria 878
124 Ga0111539_12232822 3300009094 Bacteria 635
125 Ga0105245_10543006 3300009098 Bacteria 1184
126 Ga0105245_12357486 3300009098 Bacteria 586
127 Ga0105247_10282188 3300009101 Bacteria 1146
128 Ga0105247_10802026 3300009101 Bacteria 718
129 Ga0105247_11491849 3300009101 Bacteria 551
130 Ga0114129_10009980 3300009147 Bacteria 13532
131 Ga0114129_10040697 3300009147 Bacteria 6551
132 Ga0114129_10133573 3300009147 Bacteria 3407
133 Ga0114129_10272890 3300009147 Bacteria 2262
134 Ga0114129_10279912 3300009147 Unclassified 2229
135 Ga0114129_10293459 3300009147 Unclassified 2169
136 Ga0114129_10471676 3300009147 Bacteria 1643
137 Ga0114129_10547848 3300009147 Bacteria 1505
138 Ga0114129_10967809 3300009147 Unclassified 1074
139 Ga0114129_10996381 3300009147 Bacteria 1055
140 Ga0114129_11017192 3300009147 Bacteria 1043
141 Ga0114129_11159836 3300009147 Bacteria 964
142 Ga0114129_11389198 3300009147 Bacteria 867
143 Ga0114129_12196980 3300009147 Bacteria 664
144 Ga0114129_12226107 3300009147 Unclassified 659
145 Ga0114129_12336991 3300009147 Unclassified 641
146 Ga0105243_10179229 3300009148 Bacteria 1841
147 Ga0105243_10265042 3300009148 Bacteria 1540
148 Ga0105243_10609166 3300009148 Bacteria 1052
149 Ga0105243_10964958 3300009148 Bacteria 852
150 Ga0105243_11537952 3300009148 Unclassified 690
151 Ga0105243_12387477 3300009148 Bacteria 567
152 Ga0105243_12986221 3300009148 Unclassified 513
153 Ga0105241_11640312 3300009174 Unclassified 623
154 Ga0105242_10141131 3300009176 Unclassified 2090
155 Ga0105242_10892666 3300009176 Unclassified 888
156 Ga0105237_11967668 3300009545 Bacteria 593
157 Ga0105249_10025036 3300009553 Bacteria 5370
158 Ga0105249_10080556 3300009553 Bacteria 3025
159 Ga0105249_10216695 3300009553 Bacteria 1882
160 Ga0105249_10722471 3300009553 Bacteria 1057
161 Ga0105249_11342933 3300009553 Bacteria 787
162 Ga0105249_11573347 3300009553 Unclassified 730
163 Ga0105246_10014667 3300011119 Bacteria 4931
164 Ga0105246_10585024 3300011119 Bacteria 962
165 Ga0157374_10253800 3300013296 Bacteria 1731
166 Ga0157378_10166699 3300013297 Bacteria 2064
167 Ga0163163_11333260 3300014325 Bacteria 779
168 Ga0157380_10108254 3300014326 Bacteria 2329
169 Ga0157380_11226880 3300014326 Bacteria 794
170 Ga0157379_10960706 3300014968 Bacteria 813
171 Ga0157376_10643686 3300014969 Bacteria 1060
172 Ga0213875_10144187 3300021388 Bacteria 1115
173 Ga0207710_10777940 3300025900 Bacteria 503
174 Ga0207643_10219038 3300025908 Bacteria 1164
175 Ga0207684_10710289 3300025910 Bacteria 854
176 Ga0207646_10307576 3300025922 Bacteria 1432
177 Ga0207646_10936980 3300025922 Bacteria 767
178 Ga0207646_11135780 3300025922 Bacteria 687
179 Ga0207681_11035530 3300025923 Bacteria 689
180 Ga0207650_10716117 3300025925 Bacteria 846
181 Ga0207650_11561516 3300025925 Bacteria 561
182 Ga0207659_11009922 3300025926 Unclassified 716
183 Ga0207687_10829680 3300025927 Bacteria 789
184 Ga0207644_10417617 3300025931 Bacteria 1099
185 Ga0207706_10869477 3300025933 Bacteria 763
186 Ga0207706_11577868 3300025933 Unclassified 533
187 Ga0207709_10297515 3300025935 Bacteria 1199
188 Ga0207709_10335955 3300025935 Bacteria 1135
189 Ga0207709_10404820 3300025935 Bacteria 1044
190 Ga0207709_10574380 3300025935 Bacteria 890
191 Ga0207709_10868051 3300025935 Bacteria 732
192 Ga0207670_10314777 3300025936 Bacteria 1230
193 Ga0207670_11201994 3300025936 Bacteria 642
194 Ga0207712_10046046 3300025961 Bacteria 3022
195 Ga0207712_10116811 3300025961 Bacteria 2011
196 Ga0207712_10164799 3300025961 Bacteria 1726
197 Ga0207712_10241304 3300025961 Bacteria 1456
198 Ga0207677_11635171 3300026023 Bacteria 597
199 Ga0207703_10611534 3300026035 Bacteria 1031
200 Ga0207703_10631555 3300026035 Bacteria 1015
201 Ga0207678_10391151 3300026067 Bacteria 1203
202 Ga0207708_10395611 3300026075 Bacteria 1142
203 Ga0207648_10203523 3300026089 Unclassified 1756
204 Ga0207676_10073976 3300026095 Bacteria 2744
205 Ga0207676_10519589 3300026095 Bacteria 1133
206 Ga0207674_10114036 3300026116 Unclassified 2675
207 Ga0207674_10894201 3300026116 Unclassified 856
208 Ga0207674_10894420 3300026116 Bacteria 856
209 Ga0207675_100109822 3300026118 Bacteria 2602
210 Ga0207675_100145490 3300026118 Bacteria 2253
211 Ga0207675_101248314 3300026118 Bacteria 763
212 Ga0209996_1078402 3300027395 Unclassified 517
213 Ga0209966_1050196 3300027695 Bacteria 886
214 Ga0268265_10264811 3300028380 Unclassified 1530
215 Ga0268265_10331662 3300028380 Bacteria 1382
216 Ga0268265_10465086 3300028380 Bacteria 1184
217 Ga0268265_11352384 3300028380 Bacteria 713
218 Ga0268264_10595989 3300028381 Bacteria 1089
219 Ga0268264_10673570 3300028381 Bacteria 1025
220 Ga0268264_12593115 3300028381 Unclassified 511
221 Ga0265326_10123707 3300028558 Bacteria 736
222 Ga0265334_10013913 3300028573 Bacteria 3362
223 Ga0265323_10023161 3300028653 Archaea 2369
224 Ga0265322_10011617 3300028654 Bacteria 2550
225 Ga0265338_10010498 3300028800 Bacteria 10845
226 Ga0307512_10455618 3300030522 Bacteria 515
227 Ga0265320_10065045 3300031240 Unclassified 1731
228 Ga0265340_10010681 3300031247 Bacteria 4906
229 Ga0265331_10272000 3300031250 Unclassified 759
230 Ga0265327_10011415 3300031251 Bacteria 6117
231 Ga0307408_100530173 3300031548 Unclassified 1036
232 Ga0265313_10324426 3300031595 Unclassified 614
233 Ga0316575_10055393 3300031665 Bacteria 1579
234 Ga0316576_10036124 3300031727 Bacteria 3531
235 Ga0316578_10271463 3300031728 Bacteria 1016
236 Ga0316578_10374524 3300031728 Unclassified 846
237 Ga0307405_10228858 3300031731 Unclassified 1369
238 Ga0316577_10011981 3300031733 Bacteria 4714
239 Ga0316577_10528778 3300031733 Bacteria 671
240 Ga0316577_10670604 3300031733 Unclassified 589
241 Ga0307406_10652309 3300031901 Bacteria 874
242 Ga0307407_10030880 3300031903 Bacteria 2895
243 Ga0307412_10038527 3300031911 Bacteria 3079
244 Ga0307409_101908957 3300031995 Unclassified 623
245 Ga0307416_100062838 3300032002 Bacteria 3038
246 Ga0307411_10121529 3300032005 Bacteria 1891
247 Ga0307415_100153692 3300032126 Bacteria 1774
248 Ga0316592_1055716 3300033524 Bacteria 885
249 Ga0373949_0140318 3300035090 Bacteria 692
250 Ga0373932_0124121 3300035112 Bacteria 864
251 Ga0373939_0154126 3300035114 Bacteria 839
252 Ga0373961_0151388 3300035241 Bacteria 791
253 Ga0316574_0717927 3300035398 Bacteria 612
254 Ga0373933_0494702 3300035724 Bacteria 801
255 Ga0316582_0604292 3300036647 Unclassified 755
256 Ga0316582_0857696 3300036647 Bacteria 622
257 Ga0316584_0346241 3300036712 Bacteria 1068
258 Ga0436364_0980478 3300037853 Bacteria 1518
259 Ga0451791_0447273 3300041451 Unclassified 592
260 Ga0451853_2903633 3300041512 Bacteria 1136
261 Ga0439446_0356481 3300042156 Bacteria 522
262 Ga0451577_0003127 3300042876 Bacteria 18678
263 Ga0451577_0010692 3300042876 Bacteria 8738
264 Ga0451577_0024147 3300042876 Bacteria 5532
265 Ga0451577_0131466 3300042876 Bacteria 2245
266 Ga0451577_0151934 3300042876 Bacteria 2083
267 Ga0451577_0174877 3300042876 Bacteria 1935
268 Ga0451577_0191912 3300042876 Bacteria 1843
269 Ga0451577_0299149 3300042876 Bacteria 1458
270 Ga0451577_0323875 3300042876 Bacteria 1398
271 Ga0451577_0961829 3300042876 Unclassified 768
272 Ga0451577_1144456 3300042876 Bacteria 695
273 Ga0453683_0002264 3300044673 Bacteria 15201
274 Ga0453683_0008026 3300044673 Bacteria 7111
275 Ga0453683_0069525 3300044673 Bacteria 2201
276 Ga0453683_0265684 3300044673 Bacteria 1095
277 Ga0453683_0328126 3300044673 Unclassified 981
278 Ga0453683_0333202 3300044673 Unclassified 973
279 Ga0453683_1049115 3300044673 Bacteria 542
280 Ga0453684_0000007 3300044712 Bacteria 1301482
281 Ga0453684_0000044 3300044712 Bacteria 585643
282 Ga0453684_0000047 3300044712 Bacteria 560243
283 Ga0453684_0000458 3300044712 Bacteria 163146
284 Ga0453684_0005135 3300044712 Bacteria 26338
285 Ga0453684_0006285 3300044712 Bacteria 22725
286 Ga0453684_0006496 3300044712 Bacteria 22177
287 Ga0453684_0009709 3300044712 Bacteria 16743
288 Ga0453684_0009852 3300044712 Bacteria 16545
289 Ga0453684_0015867 3300044712 Bacteria 11842
290 Ga0453684_0018370 3300044712 Bacteria 10736
291 Ga0453684_0022347 3300044712 Bacteria 9388
292 Ga0453684_0028663 3300044712 Bacteria 7934
293 Ga0453684_0039678 3300044712 Bacteria 6409
294 Ga0453684_0041567 3300044712 Bacteria 6215
295 Ga0453684_0045678 3300044712 Bacteria 5838
296 Ga0453684_0100666 3300044712 Bacteria 3537
297 Ga0453684_0100881 3300044712 Unclassified 3533
298 Ga0453684_0112267 3300044712 Bacteria 3309
299 Ga0453684_0117222 3300044712 Bacteria 3223
300 Ga0453684_0188196 3300044712 Bacteria 2417
301 Ga0453684_0194746 3300044712 Bacteria 2368
302 Ga0453684_0239814 3300044712 Unclassified 2088
303 Ga0453684_0244769 3300044712 Bacteria 2063
304 Ga0453684_0260611 3300044712 Bacteria 1986
305 Ga0453684_0268816 3300044712 Archaea 1949
306 Ga0453684_0308681 3300044712 Bacteria 1796
307 Ga0453684_0347642 3300044712 Bacteria 1673
308 Ga0453684_0446397 3300044712 Bacteria 1440
309 Ga0453684_0487320 3300044712 Unclassified 1367
310 Ga0453684_0488337 3300044712 Bacteria 1365
311 Ga0453684_0524584 3300044712 Bacteria 1308
312 Ga0453684_0536211 3300044712 Bacteria 1291
313 Ga0453684_0555051 3300044712 Bacteria 1265
314 Ga0453684_0584719 3300044712 Bacteria 1226
315 Ga0453684_0645396 3300044712 Bacteria 1156
316 Ga0453684_0799502 3300044712 Bacteria 1017
317 Ga0453684_1237063 3300044712 Bacteria 782
318 Ga0453684_1319267 3300044712 Bacteria 752
319 Ga0453684_1438353 3300044712 Bacteria 713
320 Ga0453684_1741182 3300044712 Bacteria 635
321 Ga0453684_1955652 3300044712 Bacteria 592
322 Ga0453684_2056572 3300044712 Bacteria 574
323 Ga0453684_2397964 3300044712 Unclassified 523
324 Ga0451576_0000009 3300045051 Bacteria 712666
325 Ga0451576_0019360 3300045051 Bacteria 7429
326 Ga0451576_0026063 3300045051 Bacteria 6290
327 Ga0451576_0032891 3300045051 Bacteria 5514
328 Ga0451576_0208907 3300045051 Bacteria 2039
329 Ga0451576_0228086 3300045051 Bacteria 1945
330 Ga0451576_0476842 3300045051 Bacteria 1310
331 Ga0451576_0546798 3300045051 Bacteria 1216
332 Ga0451576_2265092 3300045051 Bacteria 557
333 Ga0495686_0457598 3300047472 Bacteria 677
334 Ga0496106_0955554 3300048909 Unclassified 675
335 Ga0496108_0000219 3300048911 Bacteria 51931
336 Ga0501308_084698 3300049128 Unclassified 509
337 Ga0501298_080578 3300049521 Bacteria 716
338 Ga0501299_019981 3300049522 Bacteria 1217
339 Ga0501034_0013458 3300049571 Bacteria 8420
340 Ga0501036_1369818 3300049572 Bacteria 574
341 Ga0501041_0169736 3300049577 Bacteria 1365
342 Ga0501041_0890615 3300049577 Unclassified 572
343 Ga0501042_0550204 3300049578 Bacteria 839
344 Ga0501071_0628137 3300049587 Unclassified 826
345 Ga0501072_0272608 3300049588 Unclassified 1346
346 Ga0501073_0018075 3300049589 Bacteria 5098
347 Ga0501073_0048492 3300049589 Bacteria 2981
348 Ga0501073_0119071 3300049589 Bacteria 1830
349 Ga0501073_0886556 3300049589 Unclassified 614
350 Ga0501075_0079705 3300049591 Unclassified 2478
351 Ga0501075_0660007 3300049591 Unclassified 797
352 Ga0501076_0059655 3300049592 Bacteria 3035
353 Ga0501076_0452707 3300049592 Bacteria 1057
354 Ga0501198_044515 3300049649 Bacteria 777
355 Ga0501243_069114 3300049675 Bacteria 668
356 Ga0501257_006691 3300049686 Bacteria 2561
357 Ga0501257_026154 3300049686 Bacteria 1391
358 Ga0501079_0013494 3300049741 Bacteria 6230
359 Ga0501079_1383732 3300049741 Bacteria 554
360 Ga0501080_0301872 3300049742 Bacteria 1452
361 Ga0501080_1719297 3300049742 Unclassified 529
362 Ga0501081_0155476 3300049743 Bacteria 1645
363 Ga0501045_1288398 3300049824 Bacteria 532
364 nmdc:mga0yw44_941434_c1 3300050492 Bacteria 585
365 nmdc:mga05p37_1692219_c1 3300050507 Bacteria 617
366 nmdc:mga05p37_241286_c1 3300050507 Unclassified 2173
367 nmdc:mga05p37_269626_c1 3300050507 Bacteria 2034
368 nmdc:mga05p37_32947_c1 3300050507 Bacteria 6343
369 nmdc:mga05p37_64238_c1 3300050507 Bacteria 4517
370 nmdc:mga05p37_674384_c1 3300050507 Bacteria 1153
371 nmdc:mga05p37_681489_c1 3300050507 Bacteria 1145
372 nmdc:mga05p37_885911_c1 3300050507 Bacteria 964
373 nmdc:mga05p37_97715_c1 3300050507 Bacteria 3617
374 nmdc:mga09592_123236_c1 3300050508 Bacteria 2227
375 nmdc:mga09592_369994_c1 3300050508 Bacteria 1240
376 nmdc:mga09592_42154_c1 3300050508 Unclassified 3839
377 nmdc:mga09592_73693_c1 3300050508 Bacteria 2901
378 nmdc:mga09592_913005_c1 3300050508 Bacteria 738
379 nmdc:mga0qj67_211707_c1 3300050509 Bacteria 1574
380 nmdc:mga0qj67_491097_c1 3300050509 Bacteria 987
381 nmdc:mga06r32_1024369_c1 3300050510 Bacteria 777
382 nmdc:mga06r32_165144_c1 3300050510 Bacteria 2197
383 nmdc:mga06r32_634736_c1 3300050510 Bacteria 1037
384 nmdc:mga06r32_763123_c1 3300050510 Bacteria 930
385 nmdc:mga06r32_885980_c1 3300050510 Bacteria 849
386 nmdc:mga0n895_804698_c1 3300050512 Bacteria 930
387 nmdc:mga0n895_816986_c1 3300050512 Unclassified 922
388 nmdc:mga0n895_915270_c1 3300050512 Bacteria 862
389 nmdc:mga0a205_1362931_c1 3300050515 Bacteria 557
390 nmdc:mga0a205_1458632_c1 3300050515 Bacteria 532
391 nmdc:mga0a205_1563_c2 3300050515 Bacteria 14343
392 nmdc:mga0a205_21296_c2 3300050515 Bacteria 3998
393 nmdc:mga0a205_300224_c1 3300050515 Bacteria 1479
394 Ga0501084_0004268 3300054114 Bacteria 11631
395 Ga0501084_0136465 3300054114 Bacteria 2065
396 Ga0501084_1450399 3300054114 Bacteria 575
397 Ga0501082_0986076 3300060353 Bacteria 737
398 Ga0501082_1037125 3300060353 Unclassified 717
399 Ga0530510_0009728 3300061734 Bacteria 6746
400 Ga0530510_0124277 3300061734 Unclassified 1896
401 Ga0105246_11025960
402 SwRhRL2b_contig_366991
403 JGI25406J46586_10015545
404 rootL2_10034859
405 Ga0058859_11779417
406 Ga0058859_11789624
407 Ga0058860_12093990
408 Ga0065704_10089970
409 Ga0065712_10350406
410 Ga0065715_11017631
411 Ga0065707_10000491
412 Ga0065707_10002015
413 Ga0065707_10023774
414 Ga0065707_10097608
415 Ga0065707_10757144
416 Ga0065707_10783249
417 Ga0065707_10847647
418 Ga0070690_100376524
419 Ga0068869_101463840
420 Ga0070666_11086032
421 Ga0070680_100147137
422 Ga0070682_100708390
423 Ga0070689_100636433
424 Ga0070689_100917246
425 Ga0070687_100238784
426 Ga0070675_100388671
427 Ga0070673_100647020
428 Ga0070688_100417325
429 Ga0070667_100960108
430 Ga0070701_11251690
431 Ga0070705_100579044
432 Ga0070705_100786595
433 Ga0070700_100019187
434 Ga0070700_100434571
435 Ga0070700_101081499
436 Ga0070694_100162432
437 Ga0070694_100164847
438 Ga0070694_100306406
439 Ga0070694_100609319
440 Ga0070694_101103994
441 Ga0070662_101418756
442 Ga0070662_101469154
443 Ga0070685_10149705
444 Ga0070706_100325647
445 Ga0070706_100793946
446 Ga0070707_100078233
447 Ga0070707_100773396
448 Ga0070707_100777808
449 Ga0070707_101157185
450 Ga0070698_100101941
451 Ga0070698_100107016
452 Ga0070698_100286169
453 Ga0070698_100462462
454 Ga0070698_100482581
455 Ga0070698_102064431
456 Ga0070699_100011209
457 Ga0070699_100085366
458 Ga0070699_100100003
459 Ga0070699_100380169
460 Ga0070699_100536189
461 Ga0070699_100852173
462 Ga0070684_100101906
463 Ga0070686_100148195
464 Ga0070695_100961928
465 Ga0070696_100206742
466 Ga0070696_100488376
467 Ga0070696_100687724
468 Ga0070693_100574489
469 Ga0070693_101143450
470 Ga0070704_100870551
471 Ga0070704_101291349
472 Ga0068857_100122946
473 Ga0068857_100520348
474 Ga0068859_100441754
475 Ga0068859_101076038
476 Ga0068859_101899234
477 Ga0068864_100055563
478 Ga0068864_100687168
479 Ga0068864_101781647
480 Ga0068861_100039538
481 Ga0068861_100251345
482 Ga0068870_10797528
483 Ga0068863_100270571
484 Ga0068858_100089971
485 Ga0068860_101291956
486 Ga0068860_102452153
487 Ga0068862_100056783
488 Ga0068862_100142214
489 Ga0068862_100202908
490 Ga0081539_10003721
491 Ga0075365_11130773
492 Ga0075427_10004767
493 Ga0075370_11021416
494 Ga0068871_101704055
495 Ga0075428_100133422
496 Ga0075428_100241026
497 Ga0075428_100602417
498 Ga0075428_101980910
499 Ga0075430_100229064
500 Ga0075430_100233341
501 Ga0075430_100482026
502 Ga0075431_100103380
503 Ga0075431_100160740
504 Ga0075431_100890678
505 Ga0075431_101120784
506 Ga0075431_101542592
507 Ga0075433_10054511
508 Ga0075433_10096788
509 Ga0075433_10122082
510 Ga0075433_10728596
511 Ga0075433_10839849
512 Ga0075434_100574378
513 Ga0075434_101443481
514 Ga0075434_101776655
515 Ga0075429_100021228
516 Ga0075429_100025585
517 Ga0075429_100299468
518 Ga0075429_100400795
519 Ga0075429_100607279
520 Ga0097620_100441796
521 Ga0097620_101076097
522 Ga0097620_101899294
523 Ga0105240_11031568
524 Ga0111539_12232822
525 Ga0105245_10543006
526 Ga0105245_12357486
527 Ga0105247_10282188
528 Ga0105247_10802026
529 Ga0105247_11491849
530 Ga0114129_10009980
531 Ga0114129_10040697
532 Ga0114129_10133573
533 Ga0114129_10272890
534 Ga0114129_10279912
535 Ga0114129_10293459
536 Ga0114129_10471676
537 Ga0114129_10547848
538 Ga0114129_10967809
539 Ga0114129_10996381
540 Ga0114129_11017192
541 Ga0114129_11159836
542 Ga0114129_11389198
543 Ga0114129_12196980
544 Ga0114129_12226107
545 Ga0114129_12336991
546 Ga0105243_10179229
547 Ga0105243_10265042
548 Ga0105243_10609166
549 Ga0105243_10964958
550 Ga0105243_11537952
551 Ga0105243_12387477
552 Ga0105243_12986221
553 Ga0105241_11640312
554 Ga0105242_10141131
555 Ga0105242_10892666
556 Ga0105237_11967668
557 Ga0105249_10025036
558 Ga0105249_10080556
559 Ga0105249_10216695
560 Ga0105249_10722471
561 Ga0105249_11342933
562 Ga0105249_11573347
563 Ga0105246_10014667
564 Ga0105246_10585024
565 Ga0157374_10253800
566 Ga0157378_10166699
567 Ga0163163_11333260
568 Ga0157380_10108254
569 Ga0157380_11226880
570 Ga0157379_10960706
571 Ga0157376_10643686
572 Ga0213875_10144187
573 Ga0207710_10777940
574 Ga0207643_10219038
575 Ga0207684_10710289
576 Ga0207646_10307576
577 Ga0207646_10936980
578 Ga0207646_11135780
579 Ga0207681_11035530
580 Ga0207650_10716117
581 Ga0207650_11561516
582 Ga0207659_11009922
583 Ga0207687_10829680
584 Ga0207644_10417617
585 Ga0207706_10869477
586 Ga0207706_11577868
587 Ga0207709_10297515
588 Ga0207709_10335955
589 Ga0207709_10404820
590 Ga0207709_10574380
591 Ga0207709_10868051
592 Ga0207670_10314777
593 Ga0207670_11201994
594 Ga0207712_10046046
595 Ga0207712_10116811
596 Ga0207712_10164799
597 Ga0207712_10241304
598 Ga0207677_11635171
599 Ga0207703_10611534
600 Ga0207703_10631555
601 Ga0207678_10391151
602 Ga0207708_10395611
603 Ga0207648_10203523
604 Ga0207676_10073976
605 Ga0207676_10519589
606 Ga0207674_10114036
607 Ga0207674_10894201
608 Ga0207674_10894420
609 Ga0207675_100109822
610 Ga0207675_100145490
611 Ga0207675_101248314
612 Ga0209996_1078402
613 Ga0209966_1050196
614 Ga0268265_10264811
615 Ga0268265_10331662
616 Ga0268265_10465086
617 Ga0268265_11352384
618 Ga0268264_10595989
619 Ga0268264_10673570
620 Ga0268264_12593115
621 Ga0265326_10123707
622 Ga0265334_10013913
623 Ga0265323_10023161
624 Ga0265322_10011617
625 Ga0265338_10010498
626 Ga0307512_10455618
627 Ga0265320_10065045
628 Ga0265340_10010681
629 Ga0265331_10272000
630 Ga0265327_10011415
631 Ga0307408_100530173
632 Ga0265313_10324426
633 Ga0316575_10055393
634 Ga0316576_10036124
635 Ga0316578_10271463
636 Ga0316578_10374524
637 Ga0307405_10228858
638 Ga0316577_10011981
639 Ga0316577_10528778
640 Ga0316577_10670604
641 Ga0307406_10652309
642 Ga0307407_10030880
643 Ga0307412_10038527
644 Ga0307409_101908957
645 Ga0307416_100062838
646 Ga0307411_10121529
647 Ga0307415_100153692
648 Ga0316592_1055716
649 Ga0373949_0140318
650 Ga0373932_0124121
651 Ga0373939_0154126
652 Ga0373961_0151388
653 Ga0316574_0717927
654 Ga0373933_0494702
655 Ga0316582_0604292
656 Ga0316582_0857696
657 Ga0316584_0346241
658 Ga0436364_0980478
659 Ga0451791_0447273
660 Ga0451853_2903633
661 Ga0439446_0356481
662 Ga0451577_0003127
663 Ga0451577_0010692
664 Ga0451577_0024147
665 Ga0451577_0131466
666 Ga0451577_0151934
667 Ga0451577_0174877
668 Ga0451577_0191912
669 Ga0451577_0299149
670 Ga0451577_0323875
671 Ga0451577_0961829
672 Ga0451577_1144456
673 Ga0453683_0002264
674 Ga0453683_0008026
675 Ga0453683_0069525
676 Ga0453683_0265684
677 Ga0453683_0328126
678 Ga0453683_0333202
679 Ga0453683_1049115
680 Ga0453684_0000007
681 Ga0453684_0000044
682 Ga0453684_0000047
683 Ga0453684_0000458
684 Ga0453684_0005135
685 Ga0453684_0006285
686 Ga0453684_0006496
687 Ga0453684_0009709
688 Ga0453684_0009852
689 Ga0453684_0015867
690 Ga0453684_0018370
691 Ga0453684_0022347
692 Ga0453684_0028663
693 Ga0453684_0039678
694 Ga0453684_0041567
695 Ga0453684_0045678
696 Ga0453684_0100666
697 Ga0453684_0100881
698 Ga0453684_0112267
699 Ga0453684_0117222
700 Ga0453684_0188196
701 Ga0453684_0194746
702 Ga0453684_0239814
703 Ga0453684_0244769
704 Ga0453684_0260611
705 Ga0453684_0268816
706 Ga0453684_0308681
707 Ga0453684_0347642
708 Ga0453684_0446397
709 Ga0453684_0487320
710 Ga0453684_0488337
711 Ga0453684_0524584
712 Ga0453684_0536211
713 Ga0453684_0555051
714 Ga0453684_0584719
715 Ga0453684_0645396
716 Ga0453684_0799502
717 Ga0453684_1237063
718 Ga0453684_1319267
719 Ga0453684_1438353
720 Ga0453684_1741182
721 Ga0453684_1955652
722 Ga0453684_2056572
723 Ga0453684_2397964
724 Ga0451576_0000009
725 Ga0451576_0019360
726 Ga0451576_0026063
727 Ga0451576_0032891
728 Ga0451576_0208907
729 Ga0451576_0228086
730 Ga0451576_0476842
731 Ga0451576_0546798
732 Ga0451576_2265092
733 Ga0495686_0457598
734 Ga0496106_0955554
735 Ga0496108_0000219
736 Ga0501308_084698
737 Ga0501298_080578
738 Ga0501299_019981
739 Ga0501034_0013458
740 Ga0501036_1369818
741 Ga0501041_0169736
742 Ga0501041_0890615
743 Ga0501042_0550204
744 Ga0501071_0628137
745 Ga0501072_0272608
746 Ga0501073_0018075
747 Ga0501073_0048492
748 Ga0501073_0119071
749 Ga0501073_0886556
750 Ga0501075_0079705
751 Ga0501075_0660007
752 Ga0501076_0059655
753 Ga0501076_0452707
754 Ga0501198_044515
755 Ga0501243_069114
756 Ga0501257_006691
757 Ga0501257_026154
758 Ga0501079_0013494
759 Ga0501079_1383732
760 Ga0501080_0301872
761 Ga0501080_1719297
762 Ga0501081_0155476
763 Ga0501045_1288398
764 nmdc:mga0yw44_941434_c1
765 nmdc:mga05p37_1692219_c1
766 nmdc:mga05p37_241286_c1
767 nmdc:mga05p37_269626_c1
768 nmdc:mga05p37_32947_c1
769 nmdc:mga05p37_64238_c1
770 nmdc:mga05p37_674384_c1
771 nmdc:mga05p37_681489_c1
772 nmdc:mga05p37_885911_c1
773 nmdc:mga05p37_97715_c1
774 nmdc:mga09592_123236_c1
775 nmdc:mga09592_369994_c1
776 nmdc:mga09592_42154_c1
777 nmdc:mga09592_73693_c1
778 nmdc:mga09592_913005_c1
779 nmdc:mga0qj67_211707_c1
780 nmdc:mga0qj67_491097_c1
781 nmdc:mga06r32_1024369_c1
782 nmdc:mga06r32_165144_c1
783 nmdc:mga06r32_634736_c1
784 nmdc:mga06r32_763123_c1
785 nmdc:mga06r32_885980_c1
786 nmdc:mga0n895_804698_c1
787 nmdc:mga0n895_816986_c1
788 nmdc:mga0n895_915270_c1
789 nmdc:mga0a205_1362931_c1
790 nmdc:mga0a205_1458632_c1
791 nmdc:mga0a205_1563_c2
792 nmdc:mga0a205_21296_c2
793 nmdc:mga0a205_300224_c1
794 Ga0501084_0004268
795 Ga0501084_0136465
796 Ga0501084_1450399
797 Ga0501082_0986076
798 Ga0501082_1037125
799 Ga0530510_0009728
800 Ga0530510_0124277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

45

143

0.98

Map