F434574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 400 | 248 | 400 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10122450|Ga0157373_101224502 |
| Length | 326 |
| Sequence | MARAPAGRARAASVMTAPGLPSHEYRGLAQAGADTRVGAAPAVTGAGATTIVNAMTIDVEDYFQVSAFTPHVDRAAWDTTESRVERNVHRILGLLADAGASATFFTLGWIAERYPRLVQRIAGAGHEVASHGFAHFRASEQTPAEFLADIRLAKAVLEDVAGCEVRGYRAPSFSIGDKNAWAHDAIAEAGYRYSSSIYPIRHDHYGVPDAPRFAHEVRPGLLEVPVATVRLLGTNFPAGGGGYFRLLPYRMSRWSLRTINARDRQPAMFYFHPWELDPEQPRVPGAGAKTRFRHYVNLERTAPRLARLFRDFRWSRADTVFLPGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 177 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.5 |
| Metatranscriptomes | 1.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 96.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058860_11765155 | 3300004801 | Unclassified | 1422 |
| 2 | Ga0070690_100097625 | 3300005330 | Bacteria | 1943 |
| 3 | Ga0070690_100116738 | 3300005330 | Bacteria | 1787 |
| 4 | Ga0070670_100001756 | 3300005331 | Bacteria | 17652 |
| 5 | Ga0070670_100228685 | 3300005331 | Bacteria | 1618 |
| 6 | Ga0070670_100387006 | 3300005331 | Bacteria | 1233 |
| 7 | Ga0070677_10008841 | 3300005333 | Bacteria | 3400 |
| 8 | Ga0070677_10040040 | 3300005333 | Bacteria | 1842 |
| 9 | Ga0068869_100000039 | 3300005334 | Bacteria | 54386 |
| 10 | Ga0068869_100028696 | 3300005334 | Bacteria | 3892 |
| 11 | Ga0070666_10015253 | 3300005335 | Bacteria | 4901 |
| 12 | Ga0070666_10015976 | 3300005335 | Bacteria | 4796 |
| 13 | Ga0070680_100085277 | 3300005336 | Bacteria | 2609 |
| 14 | Ga0068868_100023171 | 3300005338 | Bacteria | 4696 |
| 15 | Ga0068868_100023510 | 3300005338 | Bacteria | 4665 |
| 16 | Ga0068868_100026787 | 3300005338 | Bacteria | 4396 |
| 17 | Ga0068868_100153556 | 3300005338 | Bacteria | 1897 |
| 18 | Ga0068868_100206652 | 3300005338 | Bacteria | 1639 |
| 19 | Ga0070660_100014871 | 3300005339 | Bacteria | 5617 |
| 20 | Ga0070689_100004732 | 3300005340 | Bacteria | 9238 |
| 21 | Ga0070689_100006809 | 3300005340 | Bacteria | 7948 |
| 22 | Ga0070689_100181993 | 3300005340 | Unclassified | 1707 |
| 23 | Ga0070687_100230777 | 3300005343 | Bacteria | 1139 |
| 24 | Ga0070661_100043956 | 3300005344 | Bacteria | 3263 |
| 25 | Ga0070661_100343947 | 3300005344 | Bacteria | 1169 |
| 26 | Ga0070668_100002072 | 3300005347 | Bacteria | 14658 |
| 27 | Ga0070668_100031347 | 3300005347 | Bacteria | 4044 |
| 28 | Ga0070668_100220817 | 3300005347 | Bacteria | 1563 |
| 29 | Ga0070669_100000122 | 3300005353 | Bacteria | 71837 |
| 30 | Ga0070669_100192105 | 3300005353 | Bacteria | 1602 |
| 31 | Ga0070675_100017063 | 3300005354 | Bacteria | 5771 |
| 32 | Ga0070675_100073066 | 3300005354 | Bacteria | 2847 |
| 33 | Ga0070675_100116509 | 3300005354 | Bacteria | 2266 |
| 34 | Ga0070671_100004142 | 3300005355 | Bacteria | 11445 |
| 35 | Ga0070671_100118455 | 3300005355 | Bacteria | 2227 |
| 36 | Ga0070674_100011779 | 3300005356 | Bacteria | 5338 |
| 37 | Ga0070673_100134351 | 3300005364 | Bacteria | 2080 |
| 38 | Ga0070673_100158662 | 3300005364 | Bacteria | 1922 |
| 39 | Ga0070688_100021051 | 3300005365 | Bacteria | 3803 |
| 40 | Ga0070688_100052313 | 3300005365 | Bacteria | 2550 |
| 41 | Ga0070659_100075893 | 3300005366 | Bacteria | 2680 |
| 42 | Ga0070667_100000488 | 3300005367 | Bacteria | 40240 |
| 43 | Ga0070667_100015270 | 3300005367 | Bacteria | 6347 |
| 44 | Ga0070667_100020726 | 3300005367 | Bacteria | 5460 |
| 45 | Ga0070714_100002169 | 3300005435 | Bacteria | 14423 |
| 46 | Ga0070713_100030852 | 3300005436 | Bacteria | 4263 |
| 47 | Ga0070713_100052667 | 3300005436 | Bacteria | 3370 |
| 48 | Ga0070713_100458817 | 3300005436 | Bacteria | 1198 |
| 49 | Ga0070710_10032214 | 3300005437 | Bacteria | 2838 |
| 50 | Ga0070701_10149662 | 3300005438 | Bacteria | 1343 |
| 51 | Ga0070711_100009309 | 3300005439 | Bacteria | 6043 |
| 52 | Ga0070705_100171369 | 3300005440 | Bacteria | 1461 |
| 53 | Ga0070700_100093506 | 3300005441 | Bacteria | 1967 |
| 54 | Ga0070708_100000095 | 3300005445 | Bacteria | 58224 |
| 55 | Ga0070663_100043958 | 3300005455 | Bacteria | 3146 |
| 56 | Ga0070678_100001419 | 3300005456 | Bacteria | 12751 |
| 57 | Ga0070678_100001917 | 3300005456 | Bacteria | 11213 |
| 58 | Ga0070662_100002209 | 3300005457 | Bacteria | 11946 |
| 59 | Ga0070662_100003741 | 3300005457 | Bacteria | 9518 |
| 60 | Ga0070662_100078002 | 3300005457 | Bacteria | 2459 |
| 61 | Ga0070681_10195066 | 3300005458 | Bacteria | 1944 |
| 62 | Ga0068867_100003065 | 3300005459 | Bacteria | 11774 |
| 63 | Ga0068867_100039542 | 3300005459 | Bacteria | 3439 |
| 64 | Ga0068867_100148901 | 3300005459 | Bacteria | 1837 |
| 65 | Ga0070685_10021459 | 3300005466 | Bacteria | 3511 |
| 66 | Ga0070685_10051053 | 3300005466 | Bacteria | 2391 |
| 67 | Ga0070685_10231411 | 3300005466 | Bacteria | 1216 |
| 68 | Ga0070698_100046867 | 3300005471 | Bacteria | 4419 |
| 69 | Ga0070699_100347030 | 3300005518 | Bacteria | 1337 |
| 70 | Ga0070679_100036426 | 3300005530 | Bacteria | 4882 |
| 71 | Ga0070679_100118006 | 3300005530 | Bacteria | 2638 |
| 72 | Ga0070684_100067247 | 3300005535 | Bacteria | 3147 |
| 73 | Ga0070684_100147280 | 3300005535 | Unclassified | 2132 |
| 74 | Ga0068853_100016065 | 3300005539 | Bacteria | 6156 |
| 75 | Ga0070672_100053908 | 3300005543 | Bacteria | 3146 |
| 76 | Ga0070672_100054893 | 3300005543 | Bacteria | 3120 |
| 77 | Ga0070672_100102247 | 3300005543 | Bacteria | 2326 |
| 78 | Ga0070686_100119384 | 3300005544 | Bacteria | 1808 |
| 79 | Ga0070695_100288297 | 3300005545 | Bacteria | 1209 |
| 80 | Ga0070693_100000279 | 3300005547 | Bacteria | 23976 |
| 81 | Ga0070693_100194246 | 3300005547 | Bacteria | 1315 |
| 82 | Ga0070665_100000379 | 3300005548 | Bacteria | 65890 |
| 83 | Ga0070665_100001326 | 3300005548 | Bacteria | 29474 |
| 84 | Ga0070665_100013159 | 3300005548 | Bacteria | 8333 |
| 85 | Ga0070665_100195159 | 3300005548 | Bacteria | 2025 |
| 86 | Ga0068855_100002559 | 3300005563 | Bacteria | 22406 |
| 87 | Ga0068855_100053590 | 3300005563 | Bacteria | 4745 |
| 88 | Ga0070664_100300972 | 3300005564 | Bacteria | 1449 |
| 89 | Ga0068857_100019068 | 3300005577 | Bacteria | 6020 |
| 90 | Ga0068857_100033434 | 3300005577 | Bacteria | 4548 |
| 91 | Ga0068854_100001056 | 3300005578 | Bacteria | 16551 |
| 92 | Ga0068854_100262982 | 3300005578 | Bacteria | 1382 |
| 93 | Ga0068854_100348492 | 3300005578 | Bacteria | 1211 |
| 94 | Ga0068856_100009577 | 3300005614 | Bacteria | 9409 |
| 95 | Ga0068856_100072273 | 3300005614 | Bacteria | 3415 |
| 96 | Ga0068856_100548316 | 3300005614 | Unclassified | 1177 |
| 97 | Ga0070702_100003086 | 3300005615 | Bacteria | 7370 |
| 98 | Ga0068852_100060507 | 3300005616 | Bacteria | 3287 |
| 99 | Ga0068852_100068774 | 3300005616 | Bacteria | 3101 |
| 100 | Ga0068852_100191896 | 3300005616 | Bacteria | 1928 |
| 101 | Ga0068859_100000189 | 3300005617 | Bacteria | 59789 |
| 102 | Ga0068859_100007698 | 3300005617 | Bacteria | 10940 |
| 103 | Ga0068859_100013792 | 3300005617 | Bacteria | 8103 |
| 104 | Ga0068864_100000192 | 3300005618 | Bacteria | 55904 |
| 105 | Ga0068864_100057655 | 3300005618 | Bacteria | 3355 |
| 106 | Ga0068864_100090328 | 3300005618 | Bacteria | 2700 |
| 107 | Ga0068866_10000761 | 3300005718 | Bacteria | 14539 |
| 108 | Ga0068866_10007660 | 3300005718 | Bacteria | 4527 |
| 109 | Ga0068861_100003661 | 3300005719 | Bacteria | 10250 |
| 110 | Ga0068861_100367995 | 3300005719 | Bacteria | 1266 |
| 111 | Ga0068870_10000773 | 3300005840 | Bacteria | 12328 |
| 112 | Ga0068870_10008705 | 3300005840 | Bacteria | 4576 |
| 113 | Ga0068863_100001997 | 3300005841 | Bacteria | 20234 |
| 114 | Ga0068863_100074565 | 3300005841 | Bacteria | 3210 |
| 115 | Ga0068863_100105159 | 3300005841 | Bacteria | 2685 |
| 116 | Ga0068858_100000433 | 3300005842 | Bacteria | 43597 |
| 117 | Ga0068858_100009594 | 3300005842 | Bacteria | 9231 |
| 118 | Ga0068858_100009738 | 3300005842 | Bacteria | 9153 |
| 119 | Ga0068860_100000350 | 3300005843 | Bacteria | 62017 |
| 120 | Ga0068860_100011252 | 3300005843 | Bacteria | 8818 |
| 121 | Ga0068862_100033383 | 3300005844 | Bacteria | 4350 |
| 122 | Ga0068862_100045280 | 3300005844 | Bacteria | 3754 |
| 123 | Ga0081455_10231467 | 3300005937 | Bacteria | 1364 |
| 124 | Ga0070712_100298316 | 3300006175 | Bacteria | 1303 |
| 125 | Ga0097621_100007042 | 3300006237 | Bacteria | 8009 |
| 126 | Ga0068871_100134953 | 3300006358 | Bacteria | 2095 |
| 127 | Ga0075430_100156144 | 3300006846 | Bacteria | 1900 |
| 128 | Ga0075431_100012565 | 3300006847 | Bacteria | 8544 |
| 129 | Ga0075433_10019612 | 3300006852 | Bacteria | 5638 |
| 130 | Ga0075433_10241005 | 3300006852 | Bacteria | 1605 |
| 131 | Ga0075434_100037515 | 3300006871 | Bacteria | 4798 |
| 132 | Ga0075429_100110018 | 3300006880 | Bacteria | 2409 |
| 133 | Ga0068865_100009764 | 3300006881 | Bacteria | 5955 |
| 134 | Ga0068865_100021579 | 3300006881 | Bacteria | 4190 |
| 135 | Ga0068865_100100095 | 3300006881 | Bacteria | 2120 |
| 136 | Ga0068865_100191113 | 3300006881 | Bacteria | 1583 |
| 137 | Ga0097620_100000189 | 3300006931 | Bacteria | 59789 |
| 138 | Ga0097620_100007698 | 3300006931 | Bacteria | 10940 |
| 139 | Ga0097620_100013792 | 3300006931 | Bacteria | 8103 |
| 140 | Ga0075435_100148811 | 3300007076 | Bacteria | 1968 |
| 141 | Ga0075435_100386288 | 3300007076 | Bacteria | 1203 |
| 142 | Ga0099794_10004841 | 3300007265 | Bacteria | 5344 |
| 143 | Ga0105240_10170325 | 3300009093 | Bacteria | 2580 |
| 144 | Ga0105240_10184224 | 3300009093 | Bacteria | 2461 |
| 145 | Ga0111539_10100831 | 3300009094 | Bacteria | 3390 |
| 146 | Ga0105245_10002966 | 3300009098 | Bacteria | 15210 |
| 147 | Ga0105247_10007374 | 3300009101 | Bacteria | 6754 |
| 148 | Ga0105241_10038674 | 3300009174 | Bacteria | 3597 |
| 149 | Ga0105242_10002782 | 3300009176 | Bacteria | 13696 |
| 150 | Ga0105248_10095264 | 3300009177 | Bacteria | 3351 |
| 151 | Ga0105248_10267332 | 3300009177 | Bacteria | 1925 |
| 152 | Ga0105237_10132463 | 3300009545 | Bacteria | 2487 |
| 153 | Ga0105238_10005588 | 3300009551 | Bacteria | 12424 |
| 154 | Ga0105249_10233592 | 3300009553 | Bacteria | 1815 |
| 155 | Ga0105246_10010355 | 3300011119 | Bacteria | 5767 |
| 156 | Ga0157373_10089152 | 3300013100 | Bacteria | 2172 |
| 157 | Ga0157373_10122450 | 3300013100 | Bacteria | 1828 |
| 158 | Ga0157371_10004679 | 3300013102 | Bacteria | 11832 |
| 159 | Ga0157370_10066059 | 3300013104 | Bacteria | 3422 |
| 160 | Ga0157370_10218305 | 3300013104 | Bacteria | 1766 |
| 161 | Ga0157369_10000994 | 3300013105 | Bacteria | 35863 |
| 162 | Ga0157369_10030152 | 3300013105 | Bacteria | 5983 |
| 163 | Ga0157369_10162706 | 3300013105 | Bacteria | 2355 |
| 164 | Ga0157369_10611022 | 3300013105 | Bacteria | 1125 |
| 165 | Ga0157374_10019992 | 3300013296 | Bacteria | 5936 |
| 166 | Ga0157374_10194381 | 3300013296 | Bacteria | 1985 |
| 167 | Ga0157374_10561542 | 3300013296 | Bacteria | 1150 |
| 168 | Ga0157378_10054523 | 3300013297 | Bacteria | 3560 |
| 169 | Ga0157378_10060241 | 3300013297 | Bacteria | 3388 |
| 170 | Ga0157378_10124422 | 3300013297 | Bacteria | 2381 |
| 171 | Ga0157378_10239930 | 3300013297 | Bacteria | 1731 |
| 172 | Ga0157378_10426743 | 3300013297 | Bacteria | 1311 |
| 173 | Ga0163162_10004616 | 3300013306 | Bacteria | 13276 |
| 174 | Ga0157372_10007225 | 3300013307 | Bacteria | 11827 |
| 175 | Ga0157372_10009914 | 3300013307 | Bacteria | 10133 |
| 176 | Ga0157372_10201618 | 3300013307 | Bacteria | 2305 |
| 177 | Ga0157375_10050253 | 3300013308 | Bacteria | 4089 |
| 178 | Ga0157375_10596963 | 3300013308 | Bacteria | 1263 |
| 179 | Ga0163163_10016471 | 3300014325 | Bacteria | 6872 |
| 180 | Ga0163163_10019411 | 3300014325 | Bacteria | 6385 |
| 181 | Ga0163163_10208910 | 3300014325 | Bacteria | 2001 |
| 182 | Ga0157380_10078248 | 3300014326 | Bacteria | 2697 |
| 183 | Ga0157377_10010148 | 3300014745 | Bacteria | 4648 |
| 184 | Ga0157379_10000028 | 3300014968 | Bacteria | 86433 |
| 185 | Ga0157379_10215742 | 3300014968 | Bacteria | 1738 |
| 186 | Ga0157379_10304242 | 3300014968 | Bacteria | 1453 |
| 187 | Ga0157376_10012059 | 3300014969 | Bacteria | 6398 |
| 188 | Ga0157376_10025162 | 3300014969 | Bacteria | 4685 |
| 189 | Ga0157376_10237630 | 3300014969 | Bacteria | 1696 |
| 190 | Ga0163161_10075859 | 3300017792 | Bacteria | 2468 |
| 191 | Ga0207697_10002167 | 3300025315 | Bacteria | 10276 |
| 192 | Ga0207682_10001573 | 3300025893 | Bacteria | 10501 |
| 193 | Ga0207682_10098583 | 3300025893 | Bacteria | 1275 |
| 194 | Ga0207692_10010577 | 3300025898 | Bacteria | 3894 |
| 195 | Ga0207642_10004366 | 3300025899 | Bacteria | 4560 |
| 196 | Ga0207642_10152571 | 3300025899 | Bacteria | 1231 |
| 197 | Ga0207680_10246370 | 3300025903 | Bacteria | 1233 |
| 198 | Ga0207699_10385980 | 3300025906 | Bacteria | 995 |
| 199 | Ga0207645_10065378 | 3300025907 | Bacteria | 2324 |
| 200 | Ga0207643_10000749 | 3300025908 | Bacteria | 19932 |
| 201 | Ga0207684_10224710 | 3300025910 | Bacteria | 1620 |
| 202 | Ga0207654_10257659 | 3300025911 | Bacteria | 1172 |
| 203 | Ga0207671_10120711 | 3300025914 | Bacteria | 2003 |
| 204 | Ga0207693_10346234 | 3300025915 | Bacteria | 1163 |
| 205 | Ga0207663_10146704 | 3300025916 | Bacteria | 1650 |
| 206 | Ga0207657_10003343 | 3300025919 | Bacteria | 17151 |
| 207 | Ga0207657_10011429 | 3300025919 | Bacteria | 8815 |
| 208 | Ga0207649_10223969 | 3300025920 | Bacteria | 1341 |
| 209 | Ga0207652_10095561 | 3300025921 | Bacteria | 2618 |
| 210 | Ga0207646_10000529 | 3300025922 | Bacteria | 50973 |
| 211 | Ga0207681_10000151 | 3300025923 | Bacteria | 58241 |
| 212 | Ga0207681_10004405 | 3300025923 | Bacteria | 8676 |
| 213 | Ga0207681_10090664 | 3300025923 | Bacteria | 2182 |
| 214 | Ga0207694_10005034 | 3300025924 | Bacteria | 10221 |
| 215 | Ga0207650_10003040 | 3300025925 | Bacteria | 11550 |
| 216 | Ga0207650_10008950 | 3300025925 | Bacteria | 6843 |
| 217 | Ga0207650_10051984 | 3300025925 | Bacteria | 3034 |
| 218 | Ga0207659_10264454 | 3300025926 | Bacteria | 1401 |
| 219 | Ga0207687_10008802 | 3300025927 | Bacteria | 6597 |
| 220 | Ga0207700_10001400 | 3300025928 | Bacteria | 13687 |
| 221 | Ga0207700_10041071 | 3300025928 | Bacteria | 3381 |
| 222 | Ga0207664_10012935 | 3300025929 | Bacteria | 5980 |
| 223 | Ga0207644_10080459 | 3300025931 | Bacteria | 2406 |
| 224 | Ga0207644_10148973 | 3300025931 | Bacteria | 1809 |
| 225 | Ga0207690_10012009 | 3300025932 | Bacteria | 5179 |
| 226 | Ga0207690_10113112 | 3300025932 | Bacteria | 1959 |
| 227 | Ga0207706_10000158 | 3300025933 | Bacteria | 75298 |
| 228 | Ga0207706_10005126 | 3300025933 | Bacteria | 12228 |
| 229 | Ga0207706_10014264 | 3300025933 | Bacteria | 7202 |
| 230 | Ga0207686_10002302 | 3300025934 | Bacteria | 10458 |
| 231 | Ga0207704_10144062 | 3300025938 | Bacteria | 1671 |
| 232 | Ga0207665_10130909 | 3300025939 | Bacteria | 1781 |
| 233 | Ga0207691_10011678 | 3300025940 | Bacteria | 8434 |
| 234 | Ga0207691_10025153 | 3300025940 | Bacteria | 5592 |
| 235 | Ga0207691_10053987 | 3300025940 | Bacteria | 3666 |
| 236 | Ga0207691_10118254 | 3300025940 | Bacteria | 2351 |
| 237 | Ga0207691_10334323 | 3300025940 | Bacteria | 1297 |
| 238 | Ga0207711_10010915 | 3300025941 | Bacteria | 7549 |
| 239 | Ga0207689_10000151 | 3300025942 | Bacteria | 59965 |
| 240 | Ga0207689_10008549 | 3300025942 | Bacteria | 8924 |
| 241 | Ga0207689_10446819 | 3300025942 | Bacteria | 1080 |
| 242 | Ga0207667_10002794 | 3300025949 | Bacteria | 21629 |
| 243 | Ga0207667_10009824 | 3300025949 | Bacteria | 11245 |
| 244 | Ga0207667_10177512 | 3300025949 | Bacteria | 2188 |
| 245 | Ga0207651_10095612 | 3300025960 | Bacteria | 2188 |
| 246 | Ga0207651_10184294 | 3300025960 | Bacteria | 1659 |
| 247 | Ga0207712_10232917 | 3300025961 | Bacteria | 1479 |
| 248 | Ga0207668_10009919 | 3300025972 | Bacteria | 5727 |
| 249 | Ga0207668_10011359 | 3300025972 | Bacteria | 5408 |
| 250 | Ga0207668_10075876 | 3300025972 | Bacteria | 2418 |
| 251 | Ga0207668_10218750 | 3300025972 | Bacteria | 1528 |
| 252 | Ga0207640_10068342 | 3300025981 | Bacteria | 2381 |
| 253 | Ga0207658_10005646 | 3300025986 | Bacteria | 8564 |
| 254 | Ga0207658_10160609 | 3300025986 | Bacteria | 1841 |
| 255 | Ga0207658_10224398 | 3300025986 | Bacteria | 1582 |
| 256 | Ga0207677_10002681 | 3300026023 | Bacteria | 9382 |
| 257 | Ga0207677_10018709 | 3300026023 | Bacteria | 4162 |
| 258 | Ga0207677_10077305 | 3300026023 | Unclassified | 2373 |
| 259 | Ga0207677_10456211 | 3300026023 | Bacteria | 1096 |
| 260 | Ga0207703_10000300 | 3300026035 | Bacteria | 54568 |
| 261 | Ga0207703_10237136 | 3300026035 | Bacteria | 1638 |
| 262 | Ga0207703_10315916 | 3300026035 | Bacteria | 1429 |
| 263 | Ga0207639_10080317 | 3300026041 | Bacteria | 2579 |
| 264 | Ga0207639_10145592 | 3300026041 | Bacteria | 1979 |
| 265 | Ga0207678_10018980 | 3300026067 | Bacteria | 6040 |
| 266 | Ga0207708_10026403 | 3300026075 | Bacteria | 4394 |
| 267 | Ga0207702_10174919 | 3300026078 | Bacteria | 1972 |
| 268 | Ga0207641_10311191 | 3300026088 | Bacteria | 1490 |
| 269 | Ga0207648_10003158 | 3300026089 | Bacteria | 17362 |
| 270 | Ga0207648_10006109 | 3300026089 | Bacteria | 12008 |
| 271 | Ga0207648_10040692 | 3300026089 | Bacteria | 4083 |
| 272 | Ga0207648_10071626 | 3300026089 | Bacteria | 3021 |
| 273 | Ga0207648_10138468 | 3300026089 | Bacteria | 2145 |
| 274 | Ga0207676_10001288 | 3300026095 | Bacteria | 18648 |
| 275 | Ga0207676_10189261 | 3300026095 | Bacteria | 1809 |
| 276 | Ga0207676_10197822 | 3300026095 | Bacteria | 1773 |
| 277 | Ga0207674_10027326 | 3300026116 | Bacteria | 6039 |
| 278 | Ga0207674_10041204 | 3300026116 | Bacteria | 4778 |
| 279 | Ga0207675_100001119 | 3300026118 | Bacteria | 26560 |
| 280 | Ga0207675_100003880 | 3300026118 | Bacteria | 14533 |
| 281 | Ga0207675_100193527 | 3300026118 | Bacteria | 1951 |
| 282 | Ga0207683_10000409 | 3300026121 | Bacteria | 39629 |
| 283 | Ga0207698_10040906 | 3300026142 | Bacteria | 3450 |
| 284 | Ga0207698_10123396 | 3300026142 | Bacteria | 2197 |
| 285 | Ga0209969_1004199 | 3300027360 | Bacteria | 2018 |
| 286 | Ga0209968_1005001 | 3300027526 | Bacteria | 1991 |
| 287 | Ga0209982_1002147 | 3300027552 | Bacteria | 2743 |
| 288 | Ga0210002_1003051 | 3300027617 | Bacteria | 2458 |
| 289 | Ga0209983_1003102 | 3300027665 | Bacteria | 3571 |
| 290 | Ga0209971_1001018 | 3300027682 | Bacteria | 7162 |
| 291 | Ga0209966_1003127 | 3300027695 | Bacteria | 2777 |
| 292 | Ga0209998_10018004 | 3300027717 | Bacteria | 1497 |
| 293 | Ga0209974_10000225 | 3300027876 | Bacteria | 18158 |
| 294 | Ga0268266_10006100 | 3300028379 | Bacteria | 11099 |
| 295 | Ga0268265_10060224 | 3300028380 | Bacteria | 2909 |
| 296 | Ga0268265_10060412 | 3300028380 | Bacteria | 2904 |
| 297 | Ga0268264_10000451 | 3300028381 | Bacteria | 56097 |
| 298 | Ga0268264_10026386 | 3300028381 | Bacteria | 4746 |
| 299 | Ga0268264_10062768 | 3300028381 | Bacteria | 3121 |
| 300 | Ga0307408_100103813 | 3300031548 | Bacteria | 2171 |
| 301 | Ga0316576_10018511 | 3300031727 | Bacteria | 4756 |
| 302 | Ga0316578_10031093 | 3300031728 | Bacteria | 3039 |
| 303 | Ga0307405_10001878 | 3300031731 | Bacteria | 9019 |
| 304 | Ga0307413_10005631 | 3300031824 | Bacteria | 5617 |
| 305 | Ga0307413_10006144 | 3300031824 | Bacteria | 5452 |
| 306 | Ga0307413_10183433 | 3300031824 | Bacteria | 1495 |
| 307 | Ga0307410_10001979 | 3300031852 | Bacteria | 9633 |
| 308 | Ga0307406_10008678 | 3300031901 | Bacteria | 5679 |
| 309 | Ga0307412_10040488 | 3300031911 | Bacteria | 3015 |
| 310 | Ga0307409_100132456 | 3300031995 | Bacteria | 2133 |
| 311 | Ga0307409_100133826 | 3300031995 | Bacteria | 2123 |
| 312 | Ga0307416_100097462 | 3300032002 | Bacteria | 2546 |
| 313 | Ga0307416_100251177 | 3300032002 | Bacteria | 1721 |
| 314 | Ga0307416_100287721 | 3300032002 | Bacteria | 1625 |
| 315 | Ga0307411_10033331 | 3300032005 | Bacteria | 3194 |
| 316 | Ga0307411_10035708 | 3300032005 | Bacteria | 3107 |
| 317 | Ga0316580_10018477 | 3300032139 | Bacteria | 2145 |
| 318 | Ga0316593_10043809 | 3300032168 | Bacteria | 1496 |
| 319 | Ga0316592_1007206 | 3300033524 | Bacteria | 2167 |
| 320 | Ga0316592_1022793 | 3300033524 | Bacteria | 1341 |
| 321 | Ga0316586_1008021 | 3300033527 | Bacteria | 1555 |
| 322 | Ga0316596_1010069 | 3300033541 | Bacteria | 2280 |
| 323 | Ga0373929_0000006 | 3300035085 | Bacteria | 324796 |
| 324 | Ga0373953_0067479 | 3300035117 | Bacteria | 1472 |
| 325 | Ga0373954_0025805 | 3300035118 | Bacteria | 2690 |
| 326 | Ga0373946_0031600 | 3300035171 | Bacteria | 2122 |
| 327 | Ga0373955_0131346 | 3300035172 | Bacteria | 1462 |
| 328 | Ga0316574_0002258 | 3300035398 | Bacteria | 9599 |
| 329 | Ga0373935_0345278 | 3300035692 | Unclassified | 1060 |
| 330 | Ga0373927_0006762 | 3300035695 | Bacteria | 7802 |
| 331 | Ga0373927_0070554 | 3300035695 | Bacteria | 2261 |
| 332 | Ga0373933_0069312 | 3300035724 | Bacteria | 2143 |
| 333 | Ga0373947_0031452 | 3300035725 | Bacteria | 3124 |
| 334 | Ga0373937_0004919 | 3300036401 | Bacteria | 11357 |
| 335 | Ga0373937_0026878 | 3300036401 | Bacteria | 5202 |
| 336 | Ga0373937_0034317 | 3300036401 | Bacteria | 4615 |
| 337 | Ga0373925_0162171 | 3300037068 | Bacteria | 1761 |
| 338 | Ga0373925_0214891 | 3300037068 | Bacteria | 1533 |
| 339 | Ga0395901_0010836 | 3300038443 | Bacteria | 9243 |
| 340 | Ga0451807_2675329 | 3300041486 | Bacteria | 1723 |
| 341 | Ga0466966_0192709 | 3300044684 | Bacteria | 1235 |
| 342 | Ga0453684_0068558 | 3300044712 | Bacteria | 4504 |
| 343 | Ga0451576_0001736 | 3300045051 | Bacteria | 35844 |
| 344 | Ga0495651_0022300 | 3300046462 | Bacteria | 4922 |
| 345 | Ga0495580_0063900 | 3300046472 | Bacteria | 2580 |
| 346 | Ga0495582_0028828 | 3300046473 | Bacteria | 3047 |
| 347 | Ga0495639_0004924 | 3300046475 | Bacteria | 5727 |
| 348 | Ga0495662_0006058 | 3300046476 | Bacteria | 6043 |
| 349 | Ga0495594_0136396 | 3300046499 | Bacteria | 1391 |
| 350 | Ga0495596_0000134 | 3300046500 | Bacteria | 51163 |
| 351 | Ga0495666_0028999 | 3300046526 | Bacteria | 2723 |
| 352 | Ga0495642_0019892 | 3300046528 | Bacteria | 2632 |
| 353 | Ga0495642_0039559 | 3300046528 | Bacteria | 1913 |
| 354 | Ga0495642_0039826 | 3300046528 | Bacteria | 1907 |
| 355 | Ga0495665_0064606 | 3300046531 | Bacteria | 1931 |
| 356 | Ga0495668_0251143 | 3300046616 | Bacteria | 968 |
| 357 | Ga0495635_0036282 | 3300046663 | Bacteria | 3417 |
| 358 | Ga0495661_0051430 | 3300046665 | Bacteria | 2487 |
| 359 | Ga0495588_0065297 | 3300046674 | Bacteria | 1888 |
| 360 | Ga0495647_0002193 | 3300046681 | Bacteria | 6104 |
| 361 | Ga0495613_0008897 | 3300046689 | Bacteria | 7449 |
| 362 | Ga0495670_0138538 | 3300046691 | Bacteria | 1271 |
| 363 | Ga0495600_0014782 | 3300046809 | Bacteria | 4923 |
| 364 | Ga0495581_0014200 | 3300047315 | Bacteria | 4617 |
| 365 | Ga0495680_0049501 | 3300047322 | Bacteria | 3291 |
| 366 | Ga0495602_0152045 | 3300048088 | Bacteria | 1818 |
| 367 | Ga0496101_0042243 | 3300048904 | Bacteria | 3254 |
| 368 | Ga0496102_0222561 | 3300048905 | Bacteria | 1779 |
| 369 | Ga0496103_0057781 | 3300048906 | Bacteria | 2409 |
| 370 | Ga0496105_0169335 | 3300048908 | Bacteria | 1791 |
| 371 | Ga0496107_0059483 | 3300048910 | Bacteria | 2765 |
| 372 | Ga0496108_0048725 | 3300048911 | Bacteria | 3543 |
| 373 | Ga0496108_0052505 | 3300048911 | Bacteria | 3416 |
| 374 | Ga0496108_0230386 | 3300048911 | Bacteria | 1611 |
| 375 | Ga0496109_0008442 | 3300048912 | Bacteria | 8758 |
| 376 | Ga0496110_0446201 | 3300048913 | Bacteria | 1179 |
| 377 | Ga0496111_0161715 | 3300048914 | Bacteria | 1663 |
| 378 | Ga0496114_0162151 | 3300048917 | Bacteria | 1945 |
| 379 | Ga0496116_0028247 | 3300048919 | Bacteria | 4068 |
| 380 | Ga0501036_0057561 | 3300049572 | Bacteria | 3293 |
| 381 | Ga0501067_0035554 | 3300049583 | Bacteria | 2766 |
| 382 | Ga0501068_0029893 | 3300049584 | Bacteria | 3230 |
| 383 | Ga0501071_0195577 | 3300049587 | Bacteria | 1518 |
| 384 | Ga0501075_0021591 | 3300049591 | Bacteria | 4694 |
| 385 | Ga0501075_0064744 | 3300049591 | Bacteria | 2757 |
| 386 | Ga0501076_0548730 | 3300049592 | Bacteria | 953 |
| 387 | Ga0501077_0001063 | 3300049593 | Bacteria | 16531 |
| 388 | Ga0501077_0114853 | 3300049593 | Bacteria | 1707 |
| 389 | Ga0501080_0013368 | 3300049742 | Bacteria | 7547 |
| 390 | nmdc:mga09592_72769_c1 | 3300050508 | Bacteria | 2919 |
| 391 | nmdc:mga06r32_28672_c1 | 3300050510 | Bacteria | 5212 |
| 392 | nmdc:mga08y16_123813_c1 | 3300050511 | Bacteria | 2690 |
| 393 | nmdc:mga0n895_379333_c1 | 3300050512 | Bacteria | 1431 |
| 394 | nmdc:mga0rr50_263308_c1 | 3300050513 | Bacteria | 1435 |
| 395 | Ga0495612_0027861 | 3300053078 | Bacteria | 2273 |
| 396 | Ga0495655_0004176 | 3300053083 | Bacteria | 2450 |
| 397 | Ga0495619_0008404 | 3300053085 | Bacteria | 6529 |
| 398 | Ga0590071_006646 | 3300059421 | Bacteria | 2747 |
| 399 | Ga0501082_0000116 | 3300060353 | Bacteria | 62872 |
| 400 | Ga0530510_0259567 | 3300061734 | Bacteria | 1295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053083 | Ga0495655_0004176 | Ga0495655_0004176_65_910 | 250 |
| 2 | 3300025981 | Ga0207640_10068342 | Ga0207640_100683422 | 253 |
| 3 | 3300005338 | Ga0068868_100153556 | Ga0068868_1001535562 | 258 |
| 4 | 3300005355 | Ga0070671_100118455 | Ga0070671_1001184552 | 258 |
| 5 | 3300005356 | Ga0070674_100011779 | Ga0070674_1000117795 | 258 |
| 6 | 3300005436 | Ga0070713_100458817 | Ga0070713_1004588171 | 258 |
| 7 | 3300005439 | Ga0070711_100009309 | Ga0070711_1000093091 | 258 |
| 8 | 3300005456 | Ga0070678_100001917 | Ga0070678_1000019173 | 258 |
| 9 | 3300005457 | Ga0070662_100003741 | Ga0070662_1000037419 | 258 |
| 10 | 3300005459 | Ga0068867_100148901 | Ga0068867_1001489012 | 258 |
| 11 | 3300005547 | Ga0070693_100000279 | Ga0070693_10000027913 | 258 |
| 12 | 3300005578 | Ga0068854_100001056 | Ga0068854_1000010564 | 258 |
| 13 | 3300005615 | Ga0070702_100003086 | Ga0070702_1000030865 | 258 |
| 14 | 3300005718 | Ga0068866_10000761 | Ga0068866_100007615 | 258 |
| 15 | 3300006175 | Ga0070712_100298316 | Ga0070712_1002983162 | 258 |
| 16 | 3300006237 | Ga0097621_100007042 | Ga0097621_1000070423 | 258 |
| 17 | 3300006881 | Ga0068865_100021579 | Ga0068865_1000215792 | 258 |
| 18 | 3300007076 | Ga0075435_100386288 | Ga0075435_1003862882 | 258 |
| 19 | 3300009098 | Ga0105245_10002966 | Ga0105245_100029668 | 258 |
| 20 | 3300009174 | Ga0105241_10038674 | Ga0105241_100386744 | 258 |
| 21 | 3300009176 | Ga0105242_10002782 | Ga0105242_1000278211 | 258 |
| 22 | 3300009177 | Ga0105248_10267332 | Ga0105248_102673322 | 258 |
| 23 | 3300013297 | Ga0157378_10239930 | Ga0157378_102399302 | 258 |
| 24 | 3300013306 | Ga0163162_10004616 | Ga0163162_1000461611 | 258 |
| 25 | 3300013307 | Ga0157372_10201618 | Ga0157372_102016182 | 258 |
| 26 | 3300014969 | Ga0157376_10025162 | Ga0157376_100251624 | 258 |
| 27 | 3300017792 | Ga0163161_10075859 | Ga0163161_100758593 | 258 |
| 28 | 3300025899 | Ga0207642_10004366 | Ga0207642_100043663 | 258 |
| 29 | 3300025911 | Ga0207654_10257659 | Ga0207654_102576592 | 258 |
| 30 | 3300025915 | Ga0207693_10346234 | Ga0207693_103462342 | 258 |
| 31 | 3300025916 | Ga0207663_10146704 | Ga0207663_101467042 | 258 |
| 32 | 3300025927 | Ga0207687_10008802 | Ga0207687_100088022 | 258 |
| 33 | 3300025931 | Ga0207644_10080459 | Ga0207644_100804592 | 258 |
| 34 | 3300025933 | Ga0207706_10005126 | Ga0207706_100051264 | 258 |
| 35 | 3300025934 | Ga0207686_10002302 | Ga0207686_100023028 | 258 |
| 36 | 3300025938 | Ga0207704_10144062 | Ga0207704_101440622 | 258 |
| 37 | 3300025942 | Ga0207689_10446819 | Ga0207689_104468191 | 258 |
| 38 | 3300025986 | Ga0207658_10224398 | Ga0207658_102243982 | 258 |
| 39 | 3300026023 | Ga0207677_10456211 | Ga0207677_104562112 | 258 |
| 40 | 3300026089 | Ga0207648_10006109 | Ga0207648_1000610913 | 258 |
| 41 | 3300026121 | Ga0207683_10000409 | Ga0207683_1000040910 | 258 |
| 42 | 3300028381 | Ga0268264_10062768 | Ga0268264_100627682 | 258 |
| 43 | 3300035117 | Ga0373953_0067479 | Ga0373953_0067479_139_999 | 258 |
| 44 | 3300035118 | Ga0373954_0025805 | Ga0373954_0025805_955_1815 | 258 |
| 45 | 3300035171 | Ga0373946_0031600 | Ga0373946_0031600_1004_1864 | 258 |
| 46 | 3300035172 | Ga0373955_0131346 | Ga0373955_0131346_56_916 | 258 |
| 47 | 3300035695 | Ga0373927_0070554 | Ga0373927_0070554_1060_1920 | 258 |
| 48 | 3300035724 | Ga0373933_0069312 | Ga0373933_0069312_836_1696 | 258 |
| 49 | 3300035725 | Ga0373947_0031452 | Ga0373947_0031452_871_1731 | 258 |
| 50 | 3300036401 | Ga0373937_0026878 | Ga0373937_0026878_1660_2520 | 258 |
| 51 | 3300036401 | Ga0373937_0034317 | Ga0373937_0034317_1873_2733 | 258 |
| 52 | 3300037068 | Ga0373925_0162171 | Ga0373925_0162171_205_1065 | 258 |
| 53 | 3300046462 | Ga0495651_0022300 | Ga0495651_0022300_69_929 | 258 |
| 54 | 3300046472 | Ga0495580_0063900 | Ga0495580_0063900_1405_2265 | 258 |
| 55 | 3300046473 | Ga0495582_0028828 | Ga0495582_0028828_1678_2538 | 258 |
| 56 | 3300046475 | Ga0495639_0004924 | Ga0495639_0004924_43_903 | 258 |
| 57 | 3300046476 | Ga0495662_0006058 | Ga0495662_0006058_821_1681 | 258 |
| 58 | 3300046499 | Ga0495594_0136396 | Ga0495594_0136396_222_1082 | 258 |
| 59 | 3300046526 | Ga0495666_0028999 | Ga0495666_0028999_1269_2129 | 258 |
| 60 | 3300046531 | Ga0495665_0064606 | Ga0495665_0064606_890_1750 | 258 |
| 61 | 3300046663 | Ga0495635_0036282 | Ga0495635_0036282_598_1458 | 258 |
| 62 | 3300046674 | Ga0495588_0065297 | Ga0495588_0065297_498_1358 | 258 |
| 63 | 3300046681 | Ga0495647_0002193 | Ga0495647_0002193_3406_4266 | 258 |
| 64 | 3300046689 | Ga0495613_0008897 | Ga0495613_0008897_1318_2178 | 258 |
| 65 | 3300046809 | Ga0495600_0014782 | Ga0495600_0014782_2873_3733 | 258 |
| 66 | 3300047315 | Ga0495581_0014200 | Ga0495581_0014200_2954_3814 | 258 |
| 67 | 3300047322 | Ga0495680_0049501 | Ga0495680_0049501_568_1428 | 258 |
| 68 | 3300053085 | Ga0495619_0008404 | Ga0495619_0008404_1517_2377 | 258 |
| 69 | 3300005437 | Ga0070710_10032214 | Ga0070710_100322143 | 264 |
| 70 | 3300025898 | Ga0207692_10010577 | Ga0207692_100105773 | 264 |
| 71 | 3300005347 | Ga0070668_100220817 | Ga0070668_1002208171 | 266 |
| 72 | 3300005466 | Ga0070685_10021459 | Ga0070685_100214593 | 266 |
| 73 | 3300005548 | Ga0070665_100000379 | Ga0070665_10000037918 | 266 |
| 74 | 3300006880 | Ga0075429_100110018 | Ga0075429_1001100183 | 266 |
| 75 | 3300049572 | Ga0501036_0057561 | Ga0501036_0057561_1041_1859 | 269 |
| 76 | 3300045051 | Ga0451576_0001736 | Ga0451576_0001736_16041_16907 | 271 |
| 77 | 3300049583 | Ga0501067_0035554 | Ga0501067_0035554_1931_2746 | 271 |
| 78 | 3300049584 | Ga0501068_0029893 | Ga0501068_0029893_1566_2381 | 271 |
| 79 | 3300049591 | Ga0501075_0021591 | Ga0501075_0021591_1913_2728 | 271 |
| 80 | 3300049593 | Ga0501077_0001063 | Ga0501077_0001063_12548_13363 | 271 |
| 81 | 3300049742 | Ga0501080_0013368 | Ga0501080_0013368_6640_7455 | 271 |
| 82 | 3300060353 | Ga0501082_0000116 | Ga0501082_0000116_59117_59932 | 271 |
| 83 | 3300005330 | Ga0070690_100097625 | Ga0070690_1000976252 | 272 |
| 84 | 3300005330 | Ga0070690_100116738 | Ga0070690_1001167382 | 272 |
| 85 | 3300005331 | Ga0070670_100001756 | Ga0070670_10000175615 | 272 |
| 86 | 3300005331 | Ga0070670_100228685 | Ga0070670_1002286851 | 272 |
| 87 | 3300005331 | Ga0070670_100387006 | Ga0070670_1003870061 | 272 |
| 88 | 3300005333 | Ga0070677_10008841 | Ga0070677_100088413 | 272 |
| 89 | 3300005333 | Ga0070677_10040040 | Ga0070677_100400402 | 272 |
| 90 | 3300005334 | Ga0068869_100000039 | Ga0068869_10000003926 | 272 |
| 91 | 3300005334 | Ga0068869_100028696 | Ga0068869_1000286962 | 272 |
| 92 | 3300005335 | Ga0070666_10015253 | Ga0070666_100152533 | 272 |
| 93 | 3300005335 | Ga0070666_10015976 | Ga0070666_100159763 | 272 |
| 94 | 3300005336 | Ga0070680_100085277 | Ga0070680_1000852772 | 272 |
| 95 | 3300005338 | Ga0068868_100023510 | Ga0068868_1000235104 | 272 |
| 96 | 3300005338 | Ga0068868_100026787 | Ga0068868_1000267873 | 272 |
| 97 | 3300005338 | Ga0068868_100206652 | Ga0068868_1002066522 | 272 |
| 98 | 3300005339 | Ga0070660_100014871 | Ga0070660_1000148713 | 272 |
| 99 | 3300005340 | Ga0070689_100004732 | Ga0070689_1000047325 | 272 |
| 100 | 3300005340 | Ga0070689_100006809 | Ga0070689_1000068096 | 272 |
| 101 | 3300005343 | Ga0070687_100230777 | Ga0070687_1002307771 | 272 |
| 102 | 3300005344 | Ga0070661_100043956 | Ga0070661_1000439562 | 272 |
| 103 | 3300005344 | Ga0070661_100343947 | Ga0070661_1003439471 | 272 |
| 104 | 3300005347 | Ga0070668_100002072 | Ga0070668_10000207211 | 272 |
| 105 | 3300005347 | Ga0070668_100031347 | Ga0070668_1000313472 | 272 |
| 106 | 3300005353 | Ga0070669_100192105 | Ga0070669_1001921052 | 272 |
| 107 | 3300005354 | Ga0070675_100017063 | Ga0070675_1000170632 | 272 |
| 108 | 3300005354 | Ga0070675_100073066 | Ga0070675_1000730662 | 272 |
| 109 | 3300005354 | Ga0070675_100116509 | Ga0070675_1001165091 | 272 |
| 110 | 3300005355 | Ga0070671_100004142 | Ga0070671_1000041425 | 272 |
| 111 | 3300005364 | Ga0070673_100134351 | Ga0070673_1001343512 | 272 |
| 112 | 3300005364 | Ga0070673_100158662 | Ga0070673_1001586622 | 272 |
| 113 | 3300005365 | Ga0070688_100021051 | Ga0070688_1000210513 | 272 |
| 114 | 3300005366 | Ga0070659_100075893 | Ga0070659_1000758932 | 272 |
| 115 | 3300005367 | Ga0070667_100000488 | Ga0070667_10000048824 | 272 |
| 116 | 3300005367 | Ga0070667_100015270 | Ga0070667_1000152705 | 272 |
| 117 | 3300005367 | Ga0070667_100020726 | Ga0070667_1000207262 | 272 |
| 118 | 3300005435 | Ga0070714_100002169 | Ga0070714_1000021695 | 272 |
| 119 | 3300005436 | Ga0070713_100030852 | Ga0070713_1000308523 | 272 |
| 120 | 3300005436 | Ga0070713_100052667 | Ga0070713_1000526674 | 272 |
| 121 | 3300005438 | Ga0070701_10149662 | Ga0070701_101496622 | 272 |
| 122 | 3300005440 | Ga0070705_100171369 | Ga0070705_1001713692 | 272 |
| 123 | 3300005441 | Ga0070700_100093506 | Ga0070700_1000935062 | 272 |
| 124 | 3300005445 | Ga0070708_100000095 | Ga0070708_10000009550 | 272 |
| 125 | 3300005455 | Ga0070663_100043958 | Ga0070663_1000439582 | 272 |
| 126 | 3300005456 | Ga0070678_100001419 | Ga0070678_10000141911 | 272 |
| 127 | 3300005457 | Ga0070662_100002209 | Ga0070662_1000022096 | 272 |
| 128 | 3300005457 | Ga0070662_100078002 | Ga0070662_1000780022 | 272 |
| 129 | 3300005458 | Ga0070681_10195066 | Ga0070681_101950662 | 272 |
| 130 | 3300005459 | Ga0068867_100003065 | Ga0068867_1000030652 | 272 |
| 131 | 3300005459 | Ga0068867_100039542 | Ga0068867_1000395423 | 272 |
| 132 | 3300005466 | Ga0070685_10051053 | Ga0070685_100510532 | 272 |
| 133 | 3300005471 | Ga0070698_100046867 | Ga0070698_1000468674 | 272 |
| 134 | 3300005518 | Ga0070699_100347030 | Ga0070699_1003470302 | 272 |
| 135 | 3300005530 | Ga0070679_100036426 | Ga0070679_1000364264 | 272 |
| 136 | 3300005530 | Ga0070679_100118006 | Ga0070679_1001180062 | 272 |
| 137 | 3300005535 | Ga0070684_100067247 | Ga0070684_1000672471 | 272 |
| 138 | 3300005539 | Ga0068853_100016065 | Ga0068853_1000160654 | 272 |
| 139 | 3300005543 | Ga0070672_100053908 | Ga0070672_1000539082 | 272 |
| 140 | 3300005543 | Ga0070672_100054893 | Ga0070672_1000548932 | 272 |
| 141 | 3300005543 | Ga0070672_100102247 | Ga0070672_1001022472 | 272 |
| 142 | 3300005544 | Ga0070686_100119384 | Ga0070686_1001193842 | 272 |
| 143 | 3300005545 | Ga0070695_100288297 | Ga0070695_1002882972 | 272 |
| 144 | 3300005547 | Ga0070693_100194246 | Ga0070693_1001942462 | 272 |
| 145 | 3300005548 | Ga0070665_100001326 | Ga0070665_1000013268 | 272 |
| 146 | 3300005548 | Ga0070665_100013159 | Ga0070665_1000131594 | 272 |
| 147 | 3300005563 | Ga0068855_100002559 | Ga0068855_10000255918 | 272 |
| 148 | 3300005563 | Ga0068855_100053590 | Ga0068855_1000535904 | 272 |
| 149 | 3300005564 | Ga0070664_100300972 | Ga0070664_1003009722 | 272 |
| 150 | 3300005577 | Ga0068857_100019068 | Ga0068857_1000190685 | 272 |
| 151 | 3300005577 | Ga0068857_100033434 | Ga0068857_1000334343 | 272 |
| 152 | 3300005578 | Ga0068854_100262982 | Ga0068854_1002629822 | 272 |
| 153 | 3300005578 | Ga0068854_100348492 | Ga0068854_1003484921 | 272 |
| 154 | 3300005614 | Ga0068856_100009577 | Ga0068856_1000095774 | 272 |
| 155 | 3300005614 | Ga0068856_100072273 | Ga0068856_1000722733 | 272 |
| 156 | 3300005616 | Ga0068852_100060507 | Ga0068852_1000605072 | 272 |
| 157 | 3300005616 | Ga0068852_100068774 | Ga0068852_1000687742 | 272 |
| 158 | 3300005616 | Ga0068852_100191896 | Ga0068852_1001918962 | 272 |
| 159 | 3300005617 | Ga0068859_100000189 | Ga0068859_10000018945 | 272 |
| 160 | 3300005617 | Ga0068859_100007698 | Ga0068859_10000769810 | 272 |
| 161 | 3300005617 | Ga0068859_100013792 | Ga0068859_1000137926 | 272 |
| 162 | 3300005618 | Ga0068864_100000192 | Ga0068864_1000001928 | 272 |
| 163 | 3300005618 | Ga0068864_100057655 | Ga0068864_1000576553 | 272 |
| 164 | 3300005618 | Ga0068864_100090328 | Ga0068864_1000903282 | 272 |
| 165 | 3300005718 | Ga0068866_10007660 | Ga0068866_100076602 | 272 |
| 166 | 3300005719 | Ga0068861_100003661 | Ga0068861_1000036618 | 272 |
| 167 | 3300005719 | Ga0068861_100367995 | Ga0068861_1003679952 | 272 |
| 168 | 3300005840 | Ga0068870_10000773 | Ga0068870_100007734 | 272 |
| 169 | 3300005840 | Ga0068870_10008705 | Ga0068870_100087054 | 272 |
| 170 | 3300005841 | Ga0068863_100001997 | Ga0068863_10000199715 | 272 |
| 171 | 3300005841 | Ga0068863_100074565 | Ga0068863_1000745653 | 272 |
| 172 | 3300005841 | Ga0068863_100105159 | Ga0068863_1001051592 | 272 |
| 173 | 3300005842 | Ga0068858_100000433 | Ga0068858_10000043310 | 272 |
| 174 | 3300005842 | Ga0068858_100009594 | Ga0068858_1000095943 | 272 |
| 175 | 3300005842 | Ga0068858_100009738 | Ga0068858_1000097388 | 272 |
| 176 | 3300005843 | Ga0068860_100000350 | Ga0068860_10000035037 | 272 |
| 177 | 3300005843 | Ga0068860_100011252 | Ga0068860_1000112523 | 272 |
| 178 | 3300005844 | Ga0068862_100033383 | Ga0068862_1000333833 | 272 |
| 179 | 3300005844 | Ga0068862_100045280 | Ga0068862_1000452802 | 272 |
| 180 | 3300005937 | Ga0081455_10231467 | Ga0081455_102314672 | 272 |
| 181 | 3300006358 | Ga0068871_100134953 | Ga0068871_1001349532 | 272 |
| 182 | 3300006846 | Ga0075430_100156144 | Ga0075430_1001561442 | 272 |
| 183 | 3300006847 | Ga0075431_100012565 | Ga0075431_1000125656 | 272 |
| 184 | 3300006852 | Ga0075433_10019612 | Ga0075433_100196124 | 272 |
| 185 | 3300006852 | Ga0075433_10241005 | Ga0075433_102410052 | 272 |
| 186 | 3300006871 | Ga0075434_100037515 | Ga0075434_1000375154 | 272 |
| 187 | 3300006881 | Ga0068865_100100095 | Ga0068865_1001000952 | 272 |
| 188 | 3300006881 | Ga0068865_100191113 | Ga0068865_1001911132 | 272 |
| 189 | 3300006931 | Ga0097620_100000189 | Ga0097620_10000018945 | 272 |
| 190 | 3300006931 | Ga0097620_100007698 | Ga0097620_10000769810 | 272 |
| 191 | 3300006931 | Ga0097620_100013792 | Ga0097620_1000137926 | 272 |
| 192 | 3300007076 | Ga0075435_100148811 | Ga0075435_1001488112 | 272 |
| 193 | 3300007265 | Ga0099794_10004841 | Ga0099794_100048413 | 272 |
| 194 | 3300009093 | Ga0105240_10170325 | Ga0105240_101703253 | 272 |
| 195 | 3300009094 | Ga0111539_10100831 | Ga0111539_101008312 | 272 |
| 196 | 3300009101 | Ga0105247_10007374 | Ga0105247_100073742 | 272 |
| 197 | 3300009177 | Ga0105248_10095264 | Ga0105248_100952642 | 272 |
| 198 | 3300009551 | Ga0105238_10005588 | Ga0105238_100055885 | 272 |
| 199 | 3300009553 | Ga0105249_10233592 | Ga0105249_102335922 | 272 |
| 200 | 3300011119 | Ga0105246_10010355 | Ga0105246_100103554 | 272 |
| 201 | 3300013100 | Ga0157373_10089152 | Ga0157373_100891522 | 272 |
| 202 | 3300013100 | Ga0157373_10122450 | Ga0157373_101224502 | 272 |
| 203 | 3300013102 | Ga0157371_10004679 | Ga0157371_100046797 | 272 |
| 204 | 3300013104 | Ga0157370_10066059 | Ga0157370_100660592 | 272 |
| 205 | 3300013104 | Ga0157370_10218305 | Ga0157370_102183052 | 272 |
| 206 | 3300013105 | Ga0157369_10000994 | Ga0157369_1000099410 | 272 |
| 207 | 3300013105 | Ga0157369_10030152 | Ga0157369_100301522 | 272 |
| 208 | 3300013105 | Ga0157369_10162706 | Ga0157369_101627062 | 272 |
| 209 | 3300013296 | Ga0157374_10194381 | Ga0157374_101943812 | 272 |
| 210 | 3300013296 | Ga0157374_10561542 | Ga0157374_105615422 | 272 |
| 211 | 3300013297 | Ga0157378_10060241 | Ga0157378_100602412 | 272 |
| 212 | 3300013297 | Ga0157378_10124422 | Ga0157378_101244223 | 272 |
| 213 | 3300013307 | Ga0157372_10007225 | Ga0157372_100072257 | 272 |
| 214 | 3300013307 | Ga0157372_10009914 | Ga0157372_100099146 | 272 |
| 215 | 3300013308 | Ga0157375_10050253 | Ga0157375_100502532 | 272 |
| 216 | 3300013308 | Ga0157375_10596963 | Ga0157375_105969632 | 272 |
| 217 | 3300014325 | Ga0163163_10016471 | Ga0163163_100164713 | 272 |
| 218 | 3300014325 | Ga0163163_10019411 | Ga0163163_100194112 | 272 |
| 219 | 3300014325 | Ga0163163_10208910 | Ga0163163_102089102 | 272 |
| 220 | 3300014326 | Ga0157380_10078248 | Ga0157380_100782482 | 272 |
| 221 | 3300014745 | Ga0157377_10010148 | Ga0157377_100101482 | 272 |
| 222 | 3300014968 | Ga0157379_10000028 | Ga0157379_1000002843 | 272 |
| 223 | 3300014968 | Ga0157379_10215742 | Ga0157379_102157422 | 272 |
| 224 | 3300014968 | Ga0157379_10304242 | Ga0157379_103042422 | 272 |
| 225 | 3300014969 | Ga0157376_10012059 | Ga0157376_100120594 | 272 |
| 226 | 3300014969 | Ga0157376_10237630 | Ga0157376_102376302 | 272 |
| 227 | 3300025315 | Ga0207697_10002167 | Ga0207697_100021678 | 272 |
| 228 | 3300025893 | Ga0207682_10001573 | Ga0207682_100015736 | 272 |
| 229 | 3300025893 | Ga0207682_10098583 | Ga0207682_100985832 | 272 |
| 230 | 3300025899 | Ga0207642_10152571 | Ga0207642_101525712 | 272 |
| 231 | 3300025903 | Ga0207680_10246370 | Ga0207680_102463702 | 272 |
| 232 | 3300025906 | Ga0207699_10385980 | Ga0207699_103859801 | 272 |
| 233 | 3300025907 | Ga0207645_10065378 | Ga0207645_100653782 | 272 |
| 234 | 3300025908 | Ga0207643_10000749 | Ga0207643_100007498 | 272 |
| 235 | 3300025910 | Ga0207684_10224710 | Ga0207684_102247102 | 272 |
| 236 | 3300025919 | Ga0207657_10003343 | Ga0207657_1000334311 | 272 |
| 237 | 3300025919 | Ga0207657_10011429 | Ga0207657_100114296 | 272 |
| 238 | 3300025920 | Ga0207649_10223969 | Ga0207649_102239692 | 272 |
| 239 | 3300025921 | Ga0207652_10095561 | Ga0207652_100955613 | 272 |
| 240 | 3300025922 | Ga0207646_10000529 | Ga0207646_1000052923 | 272 |
| 241 | 3300025923 | Ga0207681_10004405 | Ga0207681_100044052 | 272 |
| 242 | 3300025923 | Ga0207681_10090664 | Ga0207681_100906642 | 272 |
| 243 | 3300025924 | Ga0207694_10005034 | Ga0207694_100050347 | 272 |
| 244 | 3300025925 | Ga0207650_10003040 | Ga0207650_100030402 | 272 |
| 245 | 3300025925 | Ga0207650_10008950 | Ga0207650_100089504 | 272 |
| 246 | 3300025925 | Ga0207650_10051984 | Ga0207650_100519841 | 272 |
| 247 | 3300025926 | Ga0207659_10264454 | Ga0207659_102644542 | 272 |
| 248 | 3300025928 | Ga0207700_10001400 | Ga0207700_100014008 | 272 |
| 249 | 3300025928 | Ga0207700_10041071 | Ga0207700_100410712 | 272 |
| 250 | 3300025929 | Ga0207664_10012935 | Ga0207664_100129355 | 272 |
| 251 | 3300025931 | Ga0207644_10148973 | Ga0207644_101489731 | 272 |
| 252 | 3300025932 | Ga0207690_10012009 | Ga0207690_100120094 | 272 |
| 253 | 3300025933 | Ga0207706_10000158 | Ga0207706_1000015854 | 272 |
| 254 | 3300025933 | Ga0207706_10014264 | Ga0207706_100142643 | 272 |
| 255 | 3300025939 | Ga0207665_10130909 | Ga0207665_101309092 | 272 |
| 256 | 3300025940 | Ga0207691_10011678 | Ga0207691_100116786 | 272 |
| 257 | 3300025940 | Ga0207691_10025153 | Ga0207691_100251534 | 272 |
| 258 | 3300025940 | Ga0207691_10053987 | Ga0207691_100539873 | 272 |
| 259 | 3300025940 | Ga0207691_10118254 | Ga0207691_101182542 | 272 |
| 260 | 3300025940 | Ga0207691_10334323 | Ga0207691_103343232 | 272 |
| 261 | 3300025941 | Ga0207711_10010915 | Ga0207711_100109155 | 272 |
| 262 | 3300025942 | Ga0207689_10000151 | Ga0207689_1000015126 | 272 |
| 263 | 3300025942 | Ga0207689_10008549 | Ga0207689_100085496 | 272 |
| 264 | 3300025949 | Ga0207667_10002794 | Ga0207667_1000279418 | 272 |
| 265 | 3300025949 | Ga0207667_10009824 | Ga0207667_100098244 | 272 |
| 266 | 3300025949 | Ga0207667_10177512 | Ga0207667_101775122 | 272 |
| 267 | 3300025960 | Ga0207651_10095612 | Ga0207651_100956121 | 272 |
| 268 | 3300025960 | Ga0207651_10184294 | Ga0207651_101842942 | 272 |
| 269 | 3300025961 | Ga0207712_10232917 | Ga0207712_102329172 | 272 |
| 270 | 3300025972 | Ga0207668_10009919 | Ga0207668_100099193 | 272 |
| 271 | 3300025972 | Ga0207668_10011359 | Ga0207668_100113592 | 272 |
| 272 | 3300025972 | Ga0207668_10075876 | Ga0207668_100758763 | 272 |
| 273 | 3300025972 | Ga0207668_10218750 | Ga0207668_102187502 | 272 |
| 274 | 3300025986 | Ga0207658_10005646 | Ga0207658_100056467 | 272 |
| 275 | 3300025986 | Ga0207658_10160609 | Ga0207658_101606092 | 272 |
| 276 | 3300026023 | Ga0207677_10002681 | Ga0207677_100026813 | 272 |
| 277 | 3300026023 | Ga0207677_10018709 | Ga0207677_100187092 | 272 |
| 278 | 3300026035 | Ga0207703_10000300 | Ga0207703_1000030028 | 272 |
| 279 | 3300026035 | Ga0207703_10237136 | Ga0207703_102371362 | 272 |
| 280 | 3300026035 | Ga0207703_10315916 | Ga0207703_103159161 | 272 |
| 281 | 3300026041 | Ga0207639_10080317 | Ga0207639_100803173 | 272 |
| 282 | 3300026041 | Ga0207639_10145592 | Ga0207639_101455922 | 272 |
| 283 | 3300026067 | Ga0207678_10018980 | Ga0207678_100189803 | 272 |
| 284 | 3300026075 | Ga0207708_10026403 | Ga0207708_100264032 | 272 |
| 285 | 3300026078 | Ga0207702_10174919 | Ga0207702_101749192 | 272 |
| 286 | 3300026088 | Ga0207641_10311191 | Ga0207641_103111912 | 272 |
| 287 | 3300026089 | Ga0207648_10003158 | Ga0207648_100031589 | 272 |
| 288 | 3300026089 | Ga0207648_10040692 | Ga0207648_100406922 | 272 |
| 289 | 3300026089 | Ga0207648_10071626 | Ga0207648_100716263 | 272 |
| 290 | 3300026089 | Ga0207648_10138468 | Ga0207648_101384681 | 272 |
| 291 | 3300026095 | Ga0207676_10001288 | Ga0207676_100012883 | 272 |
| 292 | 3300026095 | Ga0207676_10189261 | Ga0207676_101892612 | 272 |
| 293 | 3300026095 | Ga0207676_10197822 | Ga0207676_101978222 | 272 |
| 294 | 3300026116 | Ga0207674_10027326 | Ga0207674_100273265 | 272 |
| 295 | 3300026116 | Ga0207674_10041204 | Ga0207674_100412044 | 272 |
| 296 | 3300026118 | Ga0207675_100001119 | Ga0207675_10000111926 | 272 |
| 297 | 3300026118 | Ga0207675_100003880 | Ga0207675_1000038804 | 272 |
| 298 | 3300026118 | Ga0207675_100193527 | Ga0207675_1001935272 | 272 |
| 299 | 3300026142 | Ga0207698_10040906 | Ga0207698_100409063 | 272 |
| 300 | 3300026142 | Ga0207698_10123396 | Ga0207698_101233962 | 272 |
| 301 | 3300027360 | Ga0209969_1004199 | Ga0209969_10041992 | 272 |
| 302 | 3300027526 | Ga0209968_1005001 | Ga0209968_10050012 | 272 |
| 303 | 3300027552 | Ga0209982_1002147 | Ga0209982_10021472 | 272 |
| 304 | 3300027617 | Ga0210002_1003051 | Ga0210002_10030512 | 272 |
| 305 | 3300027665 | Ga0209983_1003102 | Ga0209983_10031022 | 272 |
| 306 | 3300027682 | Ga0209971_1001018 | Ga0209971_10010186 | 272 |
| 307 | 3300027695 | Ga0209966_1003127 | Ga0209966_10031273 | 272 |
| 308 | 3300027717 | Ga0209998_10018004 | Ga0209998_100180042 | 272 |
| 309 | 3300027876 | Ga0209974_10000225 | Ga0209974_100002256 | 272 |
| 310 | 3300028379 | Ga0268266_10006100 | Ga0268266_100061003 | 272 |
| 311 | 3300028380 | Ga0268265_10060224 | Ga0268265_100602242 | 272 |
| 312 | 3300028380 | Ga0268265_10060412 | Ga0268265_100604123 | 272 |
| 313 | 3300028381 | Ga0268264_10000451 | Ga0268264_1000045118 | 272 |
| 314 | 3300028381 | Ga0268264_10026386 | Ga0268264_100263862 | 272 |
| 315 | 3300031548 | Ga0307408_100103813 | Ga0307408_1001038132 | 272 |
| 316 | 3300031731 | Ga0307405_10001878 | Ga0307405_100018787 | 272 |
| 317 | 3300031824 | Ga0307413_10005631 | Ga0307413_100056313 | 272 |
| 318 | 3300031824 | Ga0307413_10006144 | Ga0307413_100061444 | 272 |
| 319 | 3300031824 | Ga0307413_10183433 | Ga0307413_101834332 | 272 |
| 320 | 3300031852 | Ga0307410_10001979 | Ga0307410_100019797 | 272 |
| 321 | 3300031901 | Ga0307406_10008678 | Ga0307406_100086785 | 272 |
| 322 | 3300031911 | Ga0307412_10040488 | Ga0307412_100404883 | 272 |
| 323 | 3300031995 | Ga0307409_100132456 | Ga0307409_1001324562 | 272 |
| 324 | 3300031995 | Ga0307409_100133826 | Ga0307409_1001338262 | 272 |
| 325 | 3300032002 | Ga0307416_100097462 | Ga0307416_1000974622 | 272 |
| 326 | 3300032002 | Ga0307416_100251177 | Ga0307416_1002511772 | 272 |
| 327 | 3300032002 | Ga0307416_100287721 | Ga0307416_1002877212 | 272 |
| 328 | 3300032005 | Ga0307411_10033331 | Ga0307411_100333313 | 272 |
| 329 | 3300032005 | Ga0307411_10035708 | Ga0307411_100357082 | 272 |
| 330 | 3300035692 | Ga0373935_0345278 | Ga0373935_0345278_112_972 | 272 |
| 331 | 3300035695 | Ga0373927_0006762 | Ga0373927_0006762_5406_6266 | 272 |
| 332 | 3300036401 | Ga0373937_0004919 | Ga0373937_0004919_9354_10214 | 272 |
| 333 | 3300037068 | Ga0373925_0214891 | Ga0373925_0214891_461_1321 | 272 |
| 334 | 3300038443 | Ga0395901_0010836 | Ga0395901_0010836_6883_7809 | 272 |
| 335 | 3300048088 | Ga0495602_0152045 | Ga0495602_0152045_628_1488 | 272 |
| 336 | 3300048904 | Ga0496101_0042243 | Ga0496101_0042243_2032_2922 | 272 |
| 337 | 3300048905 | Ga0496102_0222561 | Ga0496102_0222561_397_1335 | 272 |
| 338 | 3300048906 | Ga0496103_0057781 | Ga0496103_0057781_1321_2259 | 272 |
| 339 | 3300048908 | Ga0496105_0169335 | Ga0496105_0169335_86_976 | 272 |
| 340 | 3300048910 | Ga0496107_0059483 | Ga0496107_0059483_551_1441 | 272 |
| 341 | 3300048911 | Ga0496108_0048725 | Ga0496108_0048725_2054_2935 | 272 |
| 342 | 3300048911 | Ga0496108_0052505 | Ga0496108_0052505_2165_3055 | 272 |
| 343 | 3300048911 | Ga0496108_0230386 | Ga0496108_0230386_759_1589 | 272 |
| 344 | 3300048912 | Ga0496109_0008442 | Ga0496109_0008442_1509_2399 | 272 |
| 345 | 3300048913 | Ga0496110_0446201 | Ga0496110_0446201_41_943 | 272 |
| 346 | 3300048914 | Ga0496111_0161715 | Ga0496111_0161715_181_1071 | 272 |
| 347 | 3300048917 | Ga0496114_0162151 | Ga0496114_0162151_81_911 | 272 |
| 348 | 3300048919 | Ga0496116_0028247 | Ga0496116_0028247_1943_2773 | 272 |
| 349 | 3300049591 | Ga0501075_0064744 | Ga0501075_0064744_95_937 | 272 |
| 350 | 3300049592 | Ga0501076_0548730 | Ga0501076_0548730_39_881 | 272 |
| 351 | 3300049593 | Ga0501077_0114853 | Ga0501077_0114853_795_1637 | 272 |
| 352 | 3300050508 | nmdc:mga09592_72769_c1 | nmdc:mga09592_72769_c1_502_1410 | 272 |
| 353 | 3300050510 | nmdc:mga06r32_28672_c1 | nmdc:mga06r32_28672_c1_4230_5138 | 272 |
| 354 | 3300050511 | nmdc:mga08y16_123813_c1 | nmdc:mga08y16_123813_c1_1039_1926 | 272 |
| 355 | 3300050512 | nmdc:mga0n895_379333_c1 | nmdc:mga0n895_379333_c1_539_1396 | 272 |
| 356 | 3300050513 | nmdc:mga0rr50_263308_c1 | nmdc:mga0rr50_263308_c1_426_1283 | 272 |
| 357 | 3300053078 | Ga0495612_0027861 | Ga0495612_0027861_730_1590 | 272 |
| 358 | 3300059421 | Ga0590071_006646 | Ga0590071_006646_633_1505 | 272 |
| 359 | 3300025932 | Ga0207690_10113112 | Ga0207690_101131122 | 273 |
| 360 | 3300049587 | Ga0501071_0195577 | Ga0501071_0195577_334_1191 | 273 |
| 361 | 3300005614 | Ga0068856_100548316 | Ga0068856_1005483161 | 274 |
| 362 | 3300031727 | Ga0316576_10018511 | Ga0316576_100185112 | 274 |
| 363 | 3300031728 | Ga0316578_10031093 | Ga0316578_100310933 | 274 |
| 364 | 3300032139 | Ga0316580_10018477 | Ga0316580_100184772 | 274 |
| 365 | 3300032168 | Ga0316593_10043809 | Ga0316593_100438092 | 274 |
| 366 | 3300033524 | Ga0316592_1007206 | Ga0316592_10072062 | 274 |
| 367 | 3300033524 | Ga0316592_1022793 | Ga0316592_10227931 | 274 |
| 368 | 3300033527 | Ga0316586_1008021 | Ga0316586_10080212 | 274 |
| 369 | 3300033541 | Ga0316596_1010069 | Ga0316596_10100692 | 274 |
| 370 | 3300035398 | Ga0316574_0002258 | Ga0316574_0002258_249_1199 | 274 |
| 371 | 3300044684 | Ga0466966_0192709 | Ga0466966_0192709_218_1096 | 274 |
| 372 | 3300046500 | Ga0495596_0000134 | Ga0495596_0000134_24682_25566 | 274 |
| 373 | 3300046528 | Ga0495642_0019892 | Ga0495642_0019892_645_1523 | 274 |
| 374 | 3300046528 | Ga0495642_0039559 | Ga0495642_0039559_998_1876 | 274 |
| 375 | 3300046528 | Ga0495642_0039826 | Ga0495642_0039826_991_1869 | 274 |
| 376 | 3300046616 | Ga0495668_0251143 | Ga0495668_0251143_23_901 | 274 |
| 377 | 3300046665 | Ga0495661_0051430 | Ga0495661_0051430_620_1498 | 274 |
| 378 | 3300046691 | Ga0495670_0138538 | Ga0495670_0138538_375_1253 | 274 |
| 379 | 3300005338 | Ga0068868_100023171 | Ga0068868_1000231713 | 275 |
| 380 | 3300005340 | Ga0070689_100181993 | Ga0070689_1001819932 | 275 |
| 381 | 3300005535 | Ga0070684_100147280 | Ga0070684_1001472802 | 275 |
| 382 | 3300005548 | Ga0070665_100195159 | Ga0070665_1001951592 | 275 |
| 383 | 3300006881 | Ga0068865_100009764 | Ga0068865_1000097643 | 275 |
| 384 | 3300009093 | Ga0105240_10184224 | Ga0105240_101842242 | 275 |
| 385 | 3300009545 | Ga0105237_10132463 | Ga0105237_101324632 | 275 |
| 386 | 3300013105 | Ga0157369_10611022 | Ga0157369_106110222 | 275 |
| 387 | 3300013296 | Ga0157374_10019992 | Ga0157374_100199925 | 275 |
| 388 | 3300013297 | Ga0157378_10054523 | Ga0157378_100545233 | 275 |
| 389 | 3300013297 | Ga0157378_10426743 | Ga0157378_104267431 | 275 |
| 390 | 3300025914 | Ga0207671_10120711 | Ga0207671_101207112 | 275 |
| 391 | 3300026023 | Ga0207677_10077305 | Ga0207677_100773055 | 275 |
| 392 | 3300005353 | Ga0070669_100000122 | Ga0070669_10000012225 | 276 |
| 393 | 3300005365 | Ga0070688_100052313 | Ga0070688_1000523132 | 276 |
| 394 | 3300005466 | Ga0070685_10231411 | Ga0070685_102314112 | 276 |
| 395 | 3300025923 | Ga0207681_10000151 | Ga0207681_1000015130 | 276 |
| 396 | 3300035085 | Ga0373929_0000006 | Ga0373929_0000006_299209_300039 | 276 |
| 397 | 3300041486 | Ga0451807_2675329 | Ga0451807_2675329_211_1041 | 276 |
| 398 | 3300044712 | Ga0453684_0068558 | Ga0453684_0068558_1914_2744 | 276 |
| 399 | 3300061734 | Ga0530510_0259567 | Ga0530510_0259567_229_1059 | 276 |
| 400 | 3300004801 | Ga0058860_11765155 | Ga0058860_117651552 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2j13-assembly1.cif.gz_A | structure of a family 4 carbohydrate esterase from bacillus anthracis | 0.7964 | 4 | 276 |
| 6hm9-assembly1.cif.gz_A | crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. | 0.7736 | 2 | 275 |
| 4u10-assembly2.cif.gz_B | probing the structure and mechanism of de-n-acetylase from aggregatibacter actinomycetemcomitans | 0.7718 | 38 | 156 |
| 6h8l-assembly1.cif.gz_A | structure of peptidoglycan deacetylase pdac from bacillus subtilis | 0.7661 | 2 | 276 |
| 7bkf-assembly1.cif.gz_A | crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis | 0.7652 | 2 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j13A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7964 | 4 | 276 | 3.20.20.370 |
| af_O53444_35_232_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7672 | 2 | 277 | 3.20.20.370 |
| 2y8uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7593 | 2 | 276 | 3.20.20.370 |
| 4f9dB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.758 | 35 | 147 | 3.20.20.370 |
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7566 | 4 | 276 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UC78-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9916 | 1 | 128 |
GO:0005975
GO:0016810 |
| AF-A0A5A7ND05-F1-model_v4 | Chitooligosaccharide deacetylase (Nodulation protein B) | 0.9906 | 1 | 131 |
GO:0005975
GO:0016810 |
| AF-A0A351A2E7-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9895 | 1 | 121 |
GO:0005975
GO:0016810 |
| AF-A0A2V8KEE4-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9854 | 75 | 276 |
GO:0005975
GO:0016810 |
| AF-A0A3L7RMC8-F1-model_v4 | DUF3473 domain-containing protein | 0.9829 | 3 | 275 |
GO:0005975
GO:0016810 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar