F434574

General Info

Members Datasets Scaffolds Average Seq Length
400 248 400 288

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10122450|Ga0157373_101224502
Length 326
Sequence MARAPAGRARAASVMTAPGLPSHEYRGLAQAGADTRVGAAPAVTGAGATTIVNAMTIDVEDYFQVSAFTPHVDRAAWDTTESRVERNVHRILGLLADAGASATFFTLGWIAERYPRLVQRIAGAGHEVASHGFAHFRASEQTPAEFLADIRLAKAVLEDVAGCEVRGYRAPSFSIGDKNAWAHDAIAEAGYRYSSSIYPIRHDHYGVPDAPRFAHEVRPGLLEVPVATVRLLGTNFPAGGGGYFRLLPYRMSRWSLRTINARDRQPAMFYFHPWELDPEQPRVPGAGAKTRFRHYVNLERTAPRLARLFRDFRWSRADTVFLPGGA

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11765155 3300004801 Unclassified 1422
2 Ga0070690_100097625 3300005330 Bacteria 1943
3 Ga0070690_100116738 3300005330 Bacteria 1787
4 Ga0070670_100001756 3300005331 Bacteria 17652
5 Ga0070670_100228685 3300005331 Bacteria 1618
6 Ga0070670_100387006 3300005331 Bacteria 1233
7 Ga0070677_10008841 3300005333 Bacteria 3400
8 Ga0070677_10040040 3300005333 Bacteria 1842
9 Ga0068869_100000039 3300005334 Bacteria 54386
10 Ga0068869_100028696 3300005334 Bacteria 3892
11 Ga0070666_10015253 3300005335 Bacteria 4901
12 Ga0070666_10015976 3300005335 Bacteria 4796
13 Ga0070680_100085277 3300005336 Bacteria 2609
14 Ga0068868_100023171 3300005338 Bacteria 4696
15 Ga0068868_100023510 3300005338 Bacteria 4665
16 Ga0068868_100026787 3300005338 Bacteria 4396
17 Ga0068868_100153556 3300005338 Bacteria 1897
18 Ga0068868_100206652 3300005338 Bacteria 1639
19 Ga0070660_100014871 3300005339 Bacteria 5617
20 Ga0070689_100004732 3300005340 Bacteria 9238
21 Ga0070689_100006809 3300005340 Bacteria 7948
22 Ga0070689_100181993 3300005340 Unclassified 1707
23 Ga0070687_100230777 3300005343 Bacteria 1139
24 Ga0070661_100043956 3300005344 Bacteria 3263
25 Ga0070661_100343947 3300005344 Bacteria 1169
26 Ga0070668_100002072 3300005347 Bacteria 14658
27 Ga0070668_100031347 3300005347 Bacteria 4044
28 Ga0070668_100220817 3300005347 Bacteria 1563
29 Ga0070669_100000122 3300005353 Bacteria 71837
30 Ga0070669_100192105 3300005353 Bacteria 1602
31 Ga0070675_100017063 3300005354 Bacteria 5771
32 Ga0070675_100073066 3300005354 Bacteria 2847
33 Ga0070675_100116509 3300005354 Bacteria 2266
34 Ga0070671_100004142 3300005355 Bacteria 11445
35 Ga0070671_100118455 3300005355 Bacteria 2227
36 Ga0070674_100011779 3300005356 Bacteria 5338
37 Ga0070673_100134351 3300005364 Bacteria 2080
38 Ga0070673_100158662 3300005364 Bacteria 1922
39 Ga0070688_100021051 3300005365 Bacteria 3803
40 Ga0070688_100052313 3300005365 Bacteria 2550
41 Ga0070659_100075893 3300005366 Bacteria 2680
42 Ga0070667_100000488 3300005367 Bacteria 40240
43 Ga0070667_100015270 3300005367 Bacteria 6347
44 Ga0070667_100020726 3300005367 Bacteria 5460
45 Ga0070714_100002169 3300005435 Bacteria 14423
46 Ga0070713_100030852 3300005436 Bacteria 4263
47 Ga0070713_100052667 3300005436 Bacteria 3370
48 Ga0070713_100458817 3300005436 Bacteria 1198
49 Ga0070710_10032214 3300005437 Bacteria 2838
50 Ga0070701_10149662 3300005438 Bacteria 1343
51 Ga0070711_100009309 3300005439 Bacteria 6043
52 Ga0070705_100171369 3300005440 Bacteria 1461
53 Ga0070700_100093506 3300005441 Bacteria 1967
54 Ga0070708_100000095 3300005445 Bacteria 58224
55 Ga0070663_100043958 3300005455 Bacteria 3146
56 Ga0070678_100001419 3300005456 Bacteria 12751
57 Ga0070678_100001917 3300005456 Bacteria 11213
58 Ga0070662_100002209 3300005457 Bacteria 11946
59 Ga0070662_100003741 3300005457 Bacteria 9518
60 Ga0070662_100078002 3300005457 Bacteria 2459
61 Ga0070681_10195066 3300005458 Bacteria 1944
62 Ga0068867_100003065 3300005459 Bacteria 11774
63 Ga0068867_100039542 3300005459 Bacteria 3439
64 Ga0068867_100148901 3300005459 Bacteria 1837
65 Ga0070685_10021459 3300005466 Bacteria 3511
66 Ga0070685_10051053 3300005466 Bacteria 2391
67 Ga0070685_10231411 3300005466 Bacteria 1216
68 Ga0070698_100046867 3300005471 Bacteria 4419
69 Ga0070699_100347030 3300005518 Bacteria 1337
70 Ga0070679_100036426 3300005530 Bacteria 4882
71 Ga0070679_100118006 3300005530 Bacteria 2638
72 Ga0070684_100067247 3300005535 Bacteria 3147
73 Ga0070684_100147280 3300005535 Unclassified 2132
74 Ga0068853_100016065 3300005539 Bacteria 6156
75 Ga0070672_100053908 3300005543 Bacteria 3146
76 Ga0070672_100054893 3300005543 Bacteria 3120
77 Ga0070672_100102247 3300005543 Bacteria 2326
78 Ga0070686_100119384 3300005544 Bacteria 1808
79 Ga0070695_100288297 3300005545 Bacteria 1209
80 Ga0070693_100000279 3300005547 Bacteria 23976
81 Ga0070693_100194246 3300005547 Bacteria 1315
82 Ga0070665_100000379 3300005548 Bacteria 65890
83 Ga0070665_100001326 3300005548 Bacteria 29474
84 Ga0070665_100013159 3300005548 Bacteria 8333
85 Ga0070665_100195159 3300005548 Bacteria 2025
86 Ga0068855_100002559 3300005563 Bacteria 22406
87 Ga0068855_100053590 3300005563 Bacteria 4745
88 Ga0070664_100300972 3300005564 Bacteria 1449
89 Ga0068857_100019068 3300005577 Bacteria 6020
90 Ga0068857_100033434 3300005577 Bacteria 4548
91 Ga0068854_100001056 3300005578 Bacteria 16551
92 Ga0068854_100262982 3300005578 Bacteria 1382
93 Ga0068854_100348492 3300005578 Bacteria 1211
94 Ga0068856_100009577 3300005614 Bacteria 9409
95 Ga0068856_100072273 3300005614 Bacteria 3415
96 Ga0068856_100548316 3300005614 Unclassified 1177
97 Ga0070702_100003086 3300005615 Bacteria 7370
98 Ga0068852_100060507 3300005616 Bacteria 3287
99 Ga0068852_100068774 3300005616 Bacteria 3101
100 Ga0068852_100191896 3300005616 Bacteria 1928
101 Ga0068859_100000189 3300005617 Bacteria 59789
102 Ga0068859_100007698 3300005617 Bacteria 10940
103 Ga0068859_100013792 3300005617 Bacteria 8103
104 Ga0068864_100000192 3300005618 Bacteria 55904
105 Ga0068864_100057655 3300005618 Bacteria 3355
106 Ga0068864_100090328 3300005618 Bacteria 2700
107 Ga0068866_10000761 3300005718 Bacteria 14539
108 Ga0068866_10007660 3300005718 Bacteria 4527
109 Ga0068861_100003661 3300005719 Bacteria 10250
110 Ga0068861_100367995 3300005719 Bacteria 1266
111 Ga0068870_10000773 3300005840 Bacteria 12328
112 Ga0068870_10008705 3300005840 Bacteria 4576
113 Ga0068863_100001997 3300005841 Bacteria 20234
114 Ga0068863_100074565 3300005841 Bacteria 3210
115 Ga0068863_100105159 3300005841 Bacteria 2685
116 Ga0068858_100000433 3300005842 Bacteria 43597
117 Ga0068858_100009594 3300005842 Bacteria 9231
118 Ga0068858_100009738 3300005842 Bacteria 9153
119 Ga0068860_100000350 3300005843 Bacteria 62017
120 Ga0068860_100011252 3300005843 Bacteria 8818
121 Ga0068862_100033383 3300005844 Bacteria 4350
122 Ga0068862_100045280 3300005844 Bacteria 3754
123 Ga0081455_10231467 3300005937 Bacteria 1364
124 Ga0070712_100298316 3300006175 Bacteria 1303
125 Ga0097621_100007042 3300006237 Bacteria 8009
126 Ga0068871_100134953 3300006358 Bacteria 2095
127 Ga0075430_100156144 3300006846 Bacteria 1900
128 Ga0075431_100012565 3300006847 Bacteria 8544
129 Ga0075433_10019612 3300006852 Bacteria 5638
130 Ga0075433_10241005 3300006852 Bacteria 1605
131 Ga0075434_100037515 3300006871 Bacteria 4798
132 Ga0075429_100110018 3300006880 Bacteria 2409
133 Ga0068865_100009764 3300006881 Bacteria 5955
134 Ga0068865_100021579 3300006881 Bacteria 4190
135 Ga0068865_100100095 3300006881 Bacteria 2120
136 Ga0068865_100191113 3300006881 Bacteria 1583
137 Ga0097620_100000189 3300006931 Bacteria 59789
138 Ga0097620_100007698 3300006931 Bacteria 10940
139 Ga0097620_100013792 3300006931 Bacteria 8103
140 Ga0075435_100148811 3300007076 Bacteria 1968
141 Ga0075435_100386288 3300007076 Bacteria 1203
142 Ga0099794_10004841 3300007265 Bacteria 5344
143 Ga0105240_10170325 3300009093 Bacteria 2580
144 Ga0105240_10184224 3300009093 Bacteria 2461
145 Ga0111539_10100831 3300009094 Bacteria 3390
146 Ga0105245_10002966 3300009098 Bacteria 15210
147 Ga0105247_10007374 3300009101 Bacteria 6754
148 Ga0105241_10038674 3300009174 Bacteria 3597
149 Ga0105242_10002782 3300009176 Bacteria 13696
150 Ga0105248_10095264 3300009177 Bacteria 3351
151 Ga0105248_10267332 3300009177 Bacteria 1925
152 Ga0105237_10132463 3300009545 Bacteria 2487
153 Ga0105238_10005588 3300009551 Bacteria 12424
154 Ga0105249_10233592 3300009553 Bacteria 1815
155 Ga0105246_10010355 3300011119 Bacteria 5767
156 Ga0157373_10089152 3300013100 Bacteria 2172
157 Ga0157373_10122450 3300013100 Bacteria 1828
158 Ga0157371_10004679 3300013102 Bacteria 11832
159 Ga0157370_10066059 3300013104 Bacteria 3422
160 Ga0157370_10218305 3300013104 Bacteria 1766
161 Ga0157369_10000994 3300013105 Bacteria 35863
162 Ga0157369_10030152 3300013105 Bacteria 5983
163 Ga0157369_10162706 3300013105 Bacteria 2355
164 Ga0157369_10611022 3300013105 Bacteria 1125
165 Ga0157374_10019992 3300013296 Bacteria 5936
166 Ga0157374_10194381 3300013296 Bacteria 1985
167 Ga0157374_10561542 3300013296 Bacteria 1150
168 Ga0157378_10054523 3300013297 Bacteria 3560
169 Ga0157378_10060241 3300013297 Bacteria 3388
170 Ga0157378_10124422 3300013297 Bacteria 2381
171 Ga0157378_10239930 3300013297 Bacteria 1731
172 Ga0157378_10426743 3300013297 Bacteria 1311
173 Ga0163162_10004616 3300013306 Bacteria 13276
174 Ga0157372_10007225 3300013307 Bacteria 11827
175 Ga0157372_10009914 3300013307 Bacteria 10133
176 Ga0157372_10201618 3300013307 Bacteria 2305
177 Ga0157375_10050253 3300013308 Bacteria 4089
178 Ga0157375_10596963 3300013308 Bacteria 1263
179 Ga0163163_10016471 3300014325 Bacteria 6872
180 Ga0163163_10019411 3300014325 Bacteria 6385
181 Ga0163163_10208910 3300014325 Bacteria 2001
182 Ga0157380_10078248 3300014326 Bacteria 2697
183 Ga0157377_10010148 3300014745 Bacteria 4648
184 Ga0157379_10000028 3300014968 Bacteria 86433
185 Ga0157379_10215742 3300014968 Bacteria 1738
186 Ga0157379_10304242 3300014968 Bacteria 1453
187 Ga0157376_10012059 3300014969 Bacteria 6398
188 Ga0157376_10025162 3300014969 Bacteria 4685
189 Ga0157376_10237630 3300014969 Bacteria 1696
190 Ga0163161_10075859 3300017792 Bacteria 2468
191 Ga0207697_10002167 3300025315 Bacteria 10276
192 Ga0207682_10001573 3300025893 Bacteria 10501
193 Ga0207682_10098583 3300025893 Bacteria 1275
194 Ga0207692_10010577 3300025898 Bacteria 3894
195 Ga0207642_10004366 3300025899 Bacteria 4560
196 Ga0207642_10152571 3300025899 Bacteria 1231
197 Ga0207680_10246370 3300025903 Bacteria 1233
198 Ga0207699_10385980 3300025906 Bacteria 995
199 Ga0207645_10065378 3300025907 Bacteria 2324
200 Ga0207643_10000749 3300025908 Bacteria 19932
201 Ga0207684_10224710 3300025910 Bacteria 1620
202 Ga0207654_10257659 3300025911 Bacteria 1172
203 Ga0207671_10120711 3300025914 Bacteria 2003
204 Ga0207693_10346234 3300025915 Bacteria 1163
205 Ga0207663_10146704 3300025916 Bacteria 1650
206 Ga0207657_10003343 3300025919 Bacteria 17151
207 Ga0207657_10011429 3300025919 Bacteria 8815
208 Ga0207649_10223969 3300025920 Bacteria 1341
209 Ga0207652_10095561 3300025921 Bacteria 2618
210 Ga0207646_10000529 3300025922 Bacteria 50973
211 Ga0207681_10000151 3300025923 Bacteria 58241
212 Ga0207681_10004405 3300025923 Bacteria 8676
213 Ga0207681_10090664 3300025923 Bacteria 2182
214 Ga0207694_10005034 3300025924 Bacteria 10221
215 Ga0207650_10003040 3300025925 Bacteria 11550
216 Ga0207650_10008950 3300025925 Bacteria 6843
217 Ga0207650_10051984 3300025925 Bacteria 3034
218 Ga0207659_10264454 3300025926 Bacteria 1401
219 Ga0207687_10008802 3300025927 Bacteria 6597
220 Ga0207700_10001400 3300025928 Bacteria 13687
221 Ga0207700_10041071 3300025928 Bacteria 3381
222 Ga0207664_10012935 3300025929 Bacteria 5980
223 Ga0207644_10080459 3300025931 Bacteria 2406
224 Ga0207644_10148973 3300025931 Bacteria 1809
225 Ga0207690_10012009 3300025932 Bacteria 5179
226 Ga0207690_10113112 3300025932 Bacteria 1959
227 Ga0207706_10000158 3300025933 Bacteria 75298
228 Ga0207706_10005126 3300025933 Bacteria 12228
229 Ga0207706_10014264 3300025933 Bacteria 7202
230 Ga0207686_10002302 3300025934 Bacteria 10458
231 Ga0207704_10144062 3300025938 Bacteria 1671
232 Ga0207665_10130909 3300025939 Bacteria 1781
233 Ga0207691_10011678 3300025940 Bacteria 8434
234 Ga0207691_10025153 3300025940 Bacteria 5592
235 Ga0207691_10053987 3300025940 Bacteria 3666
236 Ga0207691_10118254 3300025940 Bacteria 2351
237 Ga0207691_10334323 3300025940 Bacteria 1297
238 Ga0207711_10010915 3300025941 Bacteria 7549
239 Ga0207689_10000151 3300025942 Bacteria 59965
240 Ga0207689_10008549 3300025942 Bacteria 8924
241 Ga0207689_10446819 3300025942 Bacteria 1080
242 Ga0207667_10002794 3300025949 Bacteria 21629
243 Ga0207667_10009824 3300025949 Bacteria 11245
244 Ga0207667_10177512 3300025949 Bacteria 2188
245 Ga0207651_10095612 3300025960 Bacteria 2188
246 Ga0207651_10184294 3300025960 Bacteria 1659
247 Ga0207712_10232917 3300025961 Bacteria 1479
248 Ga0207668_10009919 3300025972 Bacteria 5727
249 Ga0207668_10011359 3300025972 Bacteria 5408
250 Ga0207668_10075876 3300025972 Bacteria 2418
251 Ga0207668_10218750 3300025972 Bacteria 1528
252 Ga0207640_10068342 3300025981 Bacteria 2381
253 Ga0207658_10005646 3300025986 Bacteria 8564
254 Ga0207658_10160609 3300025986 Bacteria 1841
255 Ga0207658_10224398 3300025986 Bacteria 1582
256 Ga0207677_10002681 3300026023 Bacteria 9382
257 Ga0207677_10018709 3300026023 Bacteria 4162
258 Ga0207677_10077305 3300026023 Unclassified 2373
259 Ga0207677_10456211 3300026023 Bacteria 1096
260 Ga0207703_10000300 3300026035 Bacteria 54568
261 Ga0207703_10237136 3300026035 Bacteria 1638
262 Ga0207703_10315916 3300026035 Bacteria 1429
263 Ga0207639_10080317 3300026041 Bacteria 2579
264 Ga0207639_10145592 3300026041 Bacteria 1979
265 Ga0207678_10018980 3300026067 Bacteria 6040
266 Ga0207708_10026403 3300026075 Bacteria 4394
267 Ga0207702_10174919 3300026078 Bacteria 1972
268 Ga0207641_10311191 3300026088 Bacteria 1490
269 Ga0207648_10003158 3300026089 Bacteria 17362
270 Ga0207648_10006109 3300026089 Bacteria 12008
271 Ga0207648_10040692 3300026089 Bacteria 4083
272 Ga0207648_10071626 3300026089 Bacteria 3021
273 Ga0207648_10138468 3300026089 Bacteria 2145
274 Ga0207676_10001288 3300026095 Bacteria 18648
275 Ga0207676_10189261 3300026095 Bacteria 1809
276 Ga0207676_10197822 3300026095 Bacteria 1773
277 Ga0207674_10027326 3300026116 Bacteria 6039
278 Ga0207674_10041204 3300026116 Bacteria 4778
279 Ga0207675_100001119 3300026118 Bacteria 26560
280 Ga0207675_100003880 3300026118 Bacteria 14533
281 Ga0207675_100193527 3300026118 Bacteria 1951
282 Ga0207683_10000409 3300026121 Bacteria 39629
283 Ga0207698_10040906 3300026142 Bacteria 3450
284 Ga0207698_10123396 3300026142 Bacteria 2197
285 Ga0209969_1004199 3300027360 Bacteria 2018
286 Ga0209968_1005001 3300027526 Bacteria 1991
287 Ga0209982_1002147 3300027552 Bacteria 2743
288 Ga0210002_1003051 3300027617 Bacteria 2458
289 Ga0209983_1003102 3300027665 Bacteria 3571
290 Ga0209971_1001018 3300027682 Bacteria 7162
291 Ga0209966_1003127 3300027695 Bacteria 2777
292 Ga0209998_10018004 3300027717 Bacteria 1497
293 Ga0209974_10000225 3300027876 Bacteria 18158
294 Ga0268266_10006100 3300028379 Bacteria 11099
295 Ga0268265_10060224 3300028380 Bacteria 2909
296 Ga0268265_10060412 3300028380 Bacteria 2904
297 Ga0268264_10000451 3300028381 Bacteria 56097
298 Ga0268264_10026386 3300028381 Bacteria 4746
299 Ga0268264_10062768 3300028381 Bacteria 3121
300 Ga0307408_100103813 3300031548 Bacteria 2171
301 Ga0316576_10018511 3300031727 Bacteria 4756
302 Ga0316578_10031093 3300031728 Bacteria 3039
303 Ga0307405_10001878 3300031731 Bacteria 9019
304 Ga0307413_10005631 3300031824 Bacteria 5617
305 Ga0307413_10006144 3300031824 Bacteria 5452
306 Ga0307413_10183433 3300031824 Bacteria 1495
307 Ga0307410_10001979 3300031852 Bacteria 9633
308 Ga0307406_10008678 3300031901 Bacteria 5679
309 Ga0307412_10040488 3300031911 Bacteria 3015
310 Ga0307409_100132456 3300031995 Bacteria 2133
311 Ga0307409_100133826 3300031995 Bacteria 2123
312 Ga0307416_100097462 3300032002 Bacteria 2546
313 Ga0307416_100251177 3300032002 Bacteria 1721
314 Ga0307416_100287721 3300032002 Bacteria 1625
315 Ga0307411_10033331 3300032005 Bacteria 3194
316 Ga0307411_10035708 3300032005 Bacteria 3107
317 Ga0316580_10018477 3300032139 Bacteria 2145
318 Ga0316593_10043809 3300032168 Bacteria 1496
319 Ga0316592_1007206 3300033524 Bacteria 2167
320 Ga0316592_1022793 3300033524 Bacteria 1341
321 Ga0316586_1008021 3300033527 Bacteria 1555
322 Ga0316596_1010069 3300033541 Bacteria 2280
323 Ga0373929_0000006 3300035085 Bacteria 324796
324 Ga0373953_0067479 3300035117 Bacteria 1472
325 Ga0373954_0025805 3300035118 Bacteria 2690
326 Ga0373946_0031600 3300035171 Bacteria 2122
327 Ga0373955_0131346 3300035172 Bacteria 1462
328 Ga0316574_0002258 3300035398 Bacteria 9599
329 Ga0373935_0345278 3300035692 Unclassified 1060
330 Ga0373927_0006762 3300035695 Bacteria 7802
331 Ga0373927_0070554 3300035695 Bacteria 2261
332 Ga0373933_0069312 3300035724 Bacteria 2143
333 Ga0373947_0031452 3300035725 Bacteria 3124
334 Ga0373937_0004919 3300036401 Bacteria 11357
335 Ga0373937_0026878 3300036401 Bacteria 5202
336 Ga0373937_0034317 3300036401 Bacteria 4615
337 Ga0373925_0162171 3300037068 Bacteria 1761
338 Ga0373925_0214891 3300037068 Bacteria 1533
339 Ga0395901_0010836 3300038443 Bacteria 9243
340 Ga0451807_2675329 3300041486 Bacteria 1723
341 Ga0466966_0192709 3300044684 Bacteria 1235
342 Ga0453684_0068558 3300044712 Bacteria 4504
343 Ga0451576_0001736 3300045051 Bacteria 35844
344 Ga0495651_0022300 3300046462 Bacteria 4922
345 Ga0495580_0063900 3300046472 Bacteria 2580
346 Ga0495582_0028828 3300046473 Bacteria 3047
347 Ga0495639_0004924 3300046475 Bacteria 5727
348 Ga0495662_0006058 3300046476 Bacteria 6043
349 Ga0495594_0136396 3300046499 Bacteria 1391
350 Ga0495596_0000134 3300046500 Bacteria 51163
351 Ga0495666_0028999 3300046526 Bacteria 2723
352 Ga0495642_0019892 3300046528 Bacteria 2632
353 Ga0495642_0039559 3300046528 Bacteria 1913
354 Ga0495642_0039826 3300046528 Bacteria 1907
355 Ga0495665_0064606 3300046531 Bacteria 1931
356 Ga0495668_0251143 3300046616 Bacteria 968
357 Ga0495635_0036282 3300046663 Bacteria 3417
358 Ga0495661_0051430 3300046665 Bacteria 2487
359 Ga0495588_0065297 3300046674 Bacteria 1888
360 Ga0495647_0002193 3300046681 Bacteria 6104
361 Ga0495613_0008897 3300046689 Bacteria 7449
362 Ga0495670_0138538 3300046691 Bacteria 1271
363 Ga0495600_0014782 3300046809 Bacteria 4923
364 Ga0495581_0014200 3300047315 Bacteria 4617
365 Ga0495680_0049501 3300047322 Bacteria 3291
366 Ga0495602_0152045 3300048088 Bacteria 1818
367 Ga0496101_0042243 3300048904 Bacteria 3254
368 Ga0496102_0222561 3300048905 Bacteria 1779
369 Ga0496103_0057781 3300048906 Bacteria 2409
370 Ga0496105_0169335 3300048908 Bacteria 1791
371 Ga0496107_0059483 3300048910 Bacteria 2765
372 Ga0496108_0048725 3300048911 Bacteria 3543
373 Ga0496108_0052505 3300048911 Bacteria 3416
374 Ga0496108_0230386 3300048911 Bacteria 1611
375 Ga0496109_0008442 3300048912 Bacteria 8758
376 Ga0496110_0446201 3300048913 Bacteria 1179
377 Ga0496111_0161715 3300048914 Bacteria 1663
378 Ga0496114_0162151 3300048917 Bacteria 1945
379 Ga0496116_0028247 3300048919 Bacteria 4068
380 Ga0501036_0057561 3300049572 Bacteria 3293
381 Ga0501067_0035554 3300049583 Bacteria 2766
382 Ga0501068_0029893 3300049584 Bacteria 3230
383 Ga0501071_0195577 3300049587 Bacteria 1518
384 Ga0501075_0021591 3300049591 Bacteria 4694
385 Ga0501075_0064744 3300049591 Bacteria 2757
386 Ga0501076_0548730 3300049592 Bacteria 953
387 Ga0501077_0001063 3300049593 Bacteria 16531
388 Ga0501077_0114853 3300049593 Bacteria 1707
389 Ga0501080_0013368 3300049742 Bacteria 7547
390 nmdc:mga09592_72769_c1 3300050508 Bacteria 2919
391 nmdc:mga06r32_28672_c1 3300050510 Bacteria 5212
392 nmdc:mga08y16_123813_c1 3300050511 Bacteria 2690
393 nmdc:mga0n895_379333_c1 3300050512 Bacteria 1431
394 nmdc:mga0rr50_263308_c1 3300050513 Bacteria 1435
395 Ga0495612_0027861 3300053078 Bacteria 2273
396 Ga0495655_0004176 3300053083 Bacteria 2450
397 Ga0495619_0008404 3300053085 Bacteria 6529
398 Ga0590071_006646 3300059421 Bacteria 2747
399 Ga0501082_0000116 3300060353 Bacteria 62872
400 Ga0530510_0259567 3300061734 Bacteria 1295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053083 Ga0495655_0004176 Ga0495655_0004176_65_910 250
2 3300025981 Ga0207640_10068342 Ga0207640_100683422 253
3 3300005338 Ga0068868_100153556 Ga0068868_1001535562 258
4 3300005355 Ga0070671_100118455 Ga0070671_1001184552 258
5 3300005356 Ga0070674_100011779 Ga0070674_1000117795 258
6 3300005436 Ga0070713_100458817 Ga0070713_1004588171 258
7 3300005439 Ga0070711_100009309 Ga0070711_1000093091 258
8 3300005456 Ga0070678_100001917 Ga0070678_1000019173 258
9 3300005457 Ga0070662_100003741 Ga0070662_1000037419 258
10 3300005459 Ga0068867_100148901 Ga0068867_1001489012 258
11 3300005547 Ga0070693_100000279 Ga0070693_10000027913 258
12 3300005578 Ga0068854_100001056 Ga0068854_1000010564 258
13 3300005615 Ga0070702_100003086 Ga0070702_1000030865 258
14 3300005718 Ga0068866_10000761 Ga0068866_100007615 258
15 3300006175 Ga0070712_100298316 Ga0070712_1002983162 258
16 3300006237 Ga0097621_100007042 Ga0097621_1000070423 258
17 3300006881 Ga0068865_100021579 Ga0068865_1000215792 258
18 3300007076 Ga0075435_100386288 Ga0075435_1003862882 258
19 3300009098 Ga0105245_10002966 Ga0105245_100029668 258
20 3300009174 Ga0105241_10038674 Ga0105241_100386744 258
21 3300009176 Ga0105242_10002782 Ga0105242_1000278211 258
22 3300009177 Ga0105248_10267332 Ga0105248_102673322 258
23 3300013297 Ga0157378_10239930 Ga0157378_102399302 258
24 3300013306 Ga0163162_10004616 Ga0163162_1000461611 258
25 3300013307 Ga0157372_10201618 Ga0157372_102016182 258
26 3300014969 Ga0157376_10025162 Ga0157376_100251624 258
27 3300017792 Ga0163161_10075859 Ga0163161_100758593 258
28 3300025899 Ga0207642_10004366 Ga0207642_100043663 258
29 3300025911 Ga0207654_10257659 Ga0207654_102576592 258
30 3300025915 Ga0207693_10346234 Ga0207693_103462342 258
31 3300025916 Ga0207663_10146704 Ga0207663_101467042 258
32 3300025927 Ga0207687_10008802 Ga0207687_100088022 258
33 3300025931 Ga0207644_10080459 Ga0207644_100804592 258
34 3300025933 Ga0207706_10005126 Ga0207706_100051264 258
35 3300025934 Ga0207686_10002302 Ga0207686_100023028 258
36 3300025938 Ga0207704_10144062 Ga0207704_101440622 258
37 3300025942 Ga0207689_10446819 Ga0207689_104468191 258
38 3300025986 Ga0207658_10224398 Ga0207658_102243982 258
39 3300026023 Ga0207677_10456211 Ga0207677_104562112 258
40 3300026089 Ga0207648_10006109 Ga0207648_1000610913 258
41 3300026121 Ga0207683_10000409 Ga0207683_1000040910 258
42 3300028381 Ga0268264_10062768 Ga0268264_100627682 258
43 3300035117 Ga0373953_0067479 Ga0373953_0067479_139_999 258
44 3300035118 Ga0373954_0025805 Ga0373954_0025805_955_1815 258
45 3300035171 Ga0373946_0031600 Ga0373946_0031600_1004_1864 258
46 3300035172 Ga0373955_0131346 Ga0373955_0131346_56_916 258
47 3300035695 Ga0373927_0070554 Ga0373927_0070554_1060_1920 258
48 3300035724 Ga0373933_0069312 Ga0373933_0069312_836_1696 258
49 3300035725 Ga0373947_0031452 Ga0373947_0031452_871_1731 258
50 3300036401 Ga0373937_0026878 Ga0373937_0026878_1660_2520 258
51 3300036401 Ga0373937_0034317 Ga0373937_0034317_1873_2733 258
52 3300037068 Ga0373925_0162171 Ga0373925_0162171_205_1065 258
53 3300046462 Ga0495651_0022300 Ga0495651_0022300_69_929 258
54 3300046472 Ga0495580_0063900 Ga0495580_0063900_1405_2265 258
55 3300046473 Ga0495582_0028828 Ga0495582_0028828_1678_2538 258
56 3300046475 Ga0495639_0004924 Ga0495639_0004924_43_903 258
57 3300046476 Ga0495662_0006058 Ga0495662_0006058_821_1681 258
58 3300046499 Ga0495594_0136396 Ga0495594_0136396_222_1082 258
59 3300046526 Ga0495666_0028999 Ga0495666_0028999_1269_2129 258
60 3300046531 Ga0495665_0064606 Ga0495665_0064606_890_1750 258
61 3300046663 Ga0495635_0036282 Ga0495635_0036282_598_1458 258
62 3300046674 Ga0495588_0065297 Ga0495588_0065297_498_1358 258
63 3300046681 Ga0495647_0002193 Ga0495647_0002193_3406_4266 258
64 3300046689 Ga0495613_0008897 Ga0495613_0008897_1318_2178 258
65 3300046809 Ga0495600_0014782 Ga0495600_0014782_2873_3733 258
66 3300047315 Ga0495581_0014200 Ga0495581_0014200_2954_3814 258
67 3300047322 Ga0495680_0049501 Ga0495680_0049501_568_1428 258
68 3300053085 Ga0495619_0008404 Ga0495619_0008404_1517_2377 258
69 3300005437 Ga0070710_10032214 Ga0070710_100322143 264
70 3300025898 Ga0207692_10010577 Ga0207692_100105773 264
71 3300005347 Ga0070668_100220817 Ga0070668_1002208171 266
72 3300005466 Ga0070685_10021459 Ga0070685_100214593 266
73 3300005548 Ga0070665_100000379 Ga0070665_10000037918 266
74 3300006880 Ga0075429_100110018 Ga0075429_1001100183 266
75 3300049572 Ga0501036_0057561 Ga0501036_0057561_1041_1859 269
76 3300045051 Ga0451576_0001736 Ga0451576_0001736_16041_16907 271
77 3300049583 Ga0501067_0035554 Ga0501067_0035554_1931_2746 271
78 3300049584 Ga0501068_0029893 Ga0501068_0029893_1566_2381 271
79 3300049591 Ga0501075_0021591 Ga0501075_0021591_1913_2728 271
80 3300049593 Ga0501077_0001063 Ga0501077_0001063_12548_13363 271
81 3300049742 Ga0501080_0013368 Ga0501080_0013368_6640_7455 271
82 3300060353 Ga0501082_0000116 Ga0501082_0000116_59117_59932 271
83 3300005330 Ga0070690_100097625 Ga0070690_1000976252 272
84 3300005330 Ga0070690_100116738 Ga0070690_1001167382 272
85 3300005331 Ga0070670_100001756 Ga0070670_10000175615 272
86 3300005331 Ga0070670_100228685 Ga0070670_1002286851 272
87 3300005331 Ga0070670_100387006 Ga0070670_1003870061 272
88 3300005333 Ga0070677_10008841 Ga0070677_100088413 272
89 3300005333 Ga0070677_10040040 Ga0070677_100400402 272
90 3300005334 Ga0068869_100000039 Ga0068869_10000003926 272
91 3300005334 Ga0068869_100028696 Ga0068869_1000286962 272
92 3300005335 Ga0070666_10015253 Ga0070666_100152533 272
93 3300005335 Ga0070666_10015976 Ga0070666_100159763 272
94 3300005336 Ga0070680_100085277 Ga0070680_1000852772 272
95 3300005338 Ga0068868_100023510 Ga0068868_1000235104 272
96 3300005338 Ga0068868_100026787 Ga0068868_1000267873 272
97 3300005338 Ga0068868_100206652 Ga0068868_1002066522 272
98 3300005339 Ga0070660_100014871 Ga0070660_1000148713 272
99 3300005340 Ga0070689_100004732 Ga0070689_1000047325 272
100 3300005340 Ga0070689_100006809 Ga0070689_1000068096 272
101 3300005343 Ga0070687_100230777 Ga0070687_1002307771 272
102 3300005344 Ga0070661_100043956 Ga0070661_1000439562 272
103 3300005344 Ga0070661_100343947 Ga0070661_1003439471 272
104 3300005347 Ga0070668_100002072 Ga0070668_10000207211 272
105 3300005347 Ga0070668_100031347 Ga0070668_1000313472 272
106 3300005353 Ga0070669_100192105 Ga0070669_1001921052 272
107 3300005354 Ga0070675_100017063 Ga0070675_1000170632 272
108 3300005354 Ga0070675_100073066 Ga0070675_1000730662 272
109 3300005354 Ga0070675_100116509 Ga0070675_1001165091 272
110 3300005355 Ga0070671_100004142 Ga0070671_1000041425 272
111 3300005364 Ga0070673_100134351 Ga0070673_1001343512 272
112 3300005364 Ga0070673_100158662 Ga0070673_1001586622 272
113 3300005365 Ga0070688_100021051 Ga0070688_1000210513 272
114 3300005366 Ga0070659_100075893 Ga0070659_1000758932 272
115 3300005367 Ga0070667_100000488 Ga0070667_10000048824 272
116 3300005367 Ga0070667_100015270 Ga0070667_1000152705 272
117 3300005367 Ga0070667_100020726 Ga0070667_1000207262 272
118 3300005435 Ga0070714_100002169 Ga0070714_1000021695 272
119 3300005436 Ga0070713_100030852 Ga0070713_1000308523 272
120 3300005436 Ga0070713_100052667 Ga0070713_1000526674 272
121 3300005438 Ga0070701_10149662 Ga0070701_101496622 272
122 3300005440 Ga0070705_100171369 Ga0070705_1001713692 272
123 3300005441 Ga0070700_100093506 Ga0070700_1000935062 272
124 3300005445 Ga0070708_100000095 Ga0070708_10000009550 272
125 3300005455 Ga0070663_100043958 Ga0070663_1000439582 272
126 3300005456 Ga0070678_100001419 Ga0070678_10000141911 272
127 3300005457 Ga0070662_100002209 Ga0070662_1000022096 272
128 3300005457 Ga0070662_100078002 Ga0070662_1000780022 272
129 3300005458 Ga0070681_10195066 Ga0070681_101950662 272
130 3300005459 Ga0068867_100003065 Ga0068867_1000030652 272
131 3300005459 Ga0068867_100039542 Ga0068867_1000395423 272
132 3300005466 Ga0070685_10051053 Ga0070685_100510532 272
133 3300005471 Ga0070698_100046867 Ga0070698_1000468674 272
134 3300005518 Ga0070699_100347030 Ga0070699_1003470302 272
135 3300005530 Ga0070679_100036426 Ga0070679_1000364264 272
136 3300005530 Ga0070679_100118006 Ga0070679_1001180062 272
137 3300005535 Ga0070684_100067247 Ga0070684_1000672471 272
138 3300005539 Ga0068853_100016065 Ga0068853_1000160654 272
139 3300005543 Ga0070672_100053908 Ga0070672_1000539082 272
140 3300005543 Ga0070672_100054893 Ga0070672_1000548932 272
141 3300005543 Ga0070672_100102247 Ga0070672_1001022472 272
142 3300005544 Ga0070686_100119384 Ga0070686_1001193842 272
143 3300005545 Ga0070695_100288297 Ga0070695_1002882972 272
144 3300005547 Ga0070693_100194246 Ga0070693_1001942462 272
145 3300005548 Ga0070665_100001326 Ga0070665_1000013268 272
146 3300005548 Ga0070665_100013159 Ga0070665_1000131594 272
147 3300005563 Ga0068855_100002559 Ga0068855_10000255918 272
148 3300005563 Ga0068855_100053590 Ga0068855_1000535904 272
149 3300005564 Ga0070664_100300972 Ga0070664_1003009722 272
150 3300005577 Ga0068857_100019068 Ga0068857_1000190685 272
151 3300005577 Ga0068857_100033434 Ga0068857_1000334343 272
152 3300005578 Ga0068854_100262982 Ga0068854_1002629822 272
153 3300005578 Ga0068854_100348492 Ga0068854_1003484921 272
154 3300005614 Ga0068856_100009577 Ga0068856_1000095774 272
155 3300005614 Ga0068856_100072273 Ga0068856_1000722733 272
156 3300005616 Ga0068852_100060507 Ga0068852_1000605072 272
157 3300005616 Ga0068852_100068774 Ga0068852_1000687742 272
158 3300005616 Ga0068852_100191896 Ga0068852_1001918962 272
159 3300005617 Ga0068859_100000189 Ga0068859_10000018945 272
160 3300005617 Ga0068859_100007698 Ga0068859_10000769810 272
161 3300005617 Ga0068859_100013792 Ga0068859_1000137926 272
162 3300005618 Ga0068864_100000192 Ga0068864_1000001928 272
163 3300005618 Ga0068864_100057655 Ga0068864_1000576553 272
164 3300005618 Ga0068864_100090328 Ga0068864_1000903282 272
165 3300005718 Ga0068866_10007660 Ga0068866_100076602 272
166 3300005719 Ga0068861_100003661 Ga0068861_1000036618 272
167 3300005719 Ga0068861_100367995 Ga0068861_1003679952 272
168 3300005840 Ga0068870_10000773 Ga0068870_100007734 272
169 3300005840 Ga0068870_10008705 Ga0068870_100087054 272
170 3300005841 Ga0068863_100001997 Ga0068863_10000199715 272
171 3300005841 Ga0068863_100074565 Ga0068863_1000745653 272
172 3300005841 Ga0068863_100105159 Ga0068863_1001051592 272
173 3300005842 Ga0068858_100000433 Ga0068858_10000043310 272
174 3300005842 Ga0068858_100009594 Ga0068858_1000095943 272
175 3300005842 Ga0068858_100009738 Ga0068858_1000097388 272
176 3300005843 Ga0068860_100000350 Ga0068860_10000035037 272
177 3300005843 Ga0068860_100011252 Ga0068860_1000112523 272
178 3300005844 Ga0068862_100033383 Ga0068862_1000333833 272
179 3300005844 Ga0068862_100045280 Ga0068862_1000452802 272
180 3300005937 Ga0081455_10231467 Ga0081455_102314672 272
181 3300006358 Ga0068871_100134953 Ga0068871_1001349532 272
182 3300006846 Ga0075430_100156144 Ga0075430_1001561442 272
183 3300006847 Ga0075431_100012565 Ga0075431_1000125656 272
184 3300006852 Ga0075433_10019612 Ga0075433_100196124 272
185 3300006852 Ga0075433_10241005 Ga0075433_102410052 272
186 3300006871 Ga0075434_100037515 Ga0075434_1000375154 272
187 3300006881 Ga0068865_100100095 Ga0068865_1001000952 272
188 3300006881 Ga0068865_100191113 Ga0068865_1001911132 272
189 3300006931 Ga0097620_100000189 Ga0097620_10000018945 272
190 3300006931 Ga0097620_100007698 Ga0097620_10000769810 272
191 3300006931 Ga0097620_100013792 Ga0097620_1000137926 272
192 3300007076 Ga0075435_100148811 Ga0075435_1001488112 272
193 3300007265 Ga0099794_10004841 Ga0099794_100048413 272
194 3300009093 Ga0105240_10170325 Ga0105240_101703253 272
195 3300009094 Ga0111539_10100831 Ga0111539_101008312 272
196 3300009101 Ga0105247_10007374 Ga0105247_100073742 272
197 3300009177 Ga0105248_10095264 Ga0105248_100952642 272
198 3300009551 Ga0105238_10005588 Ga0105238_100055885 272
199 3300009553 Ga0105249_10233592 Ga0105249_102335922 272
200 3300011119 Ga0105246_10010355 Ga0105246_100103554 272
201 3300013100 Ga0157373_10089152 Ga0157373_100891522 272
202 3300013100 Ga0157373_10122450 Ga0157373_101224502 272
203 3300013102 Ga0157371_10004679 Ga0157371_100046797 272
204 3300013104 Ga0157370_10066059 Ga0157370_100660592 272
205 3300013104 Ga0157370_10218305 Ga0157370_102183052 272
206 3300013105 Ga0157369_10000994 Ga0157369_1000099410 272
207 3300013105 Ga0157369_10030152 Ga0157369_100301522 272
208 3300013105 Ga0157369_10162706 Ga0157369_101627062 272
209 3300013296 Ga0157374_10194381 Ga0157374_101943812 272
210 3300013296 Ga0157374_10561542 Ga0157374_105615422 272
211 3300013297 Ga0157378_10060241 Ga0157378_100602412 272
212 3300013297 Ga0157378_10124422 Ga0157378_101244223 272
213 3300013307 Ga0157372_10007225 Ga0157372_100072257 272
214 3300013307 Ga0157372_10009914 Ga0157372_100099146 272
215 3300013308 Ga0157375_10050253 Ga0157375_100502532 272
216 3300013308 Ga0157375_10596963 Ga0157375_105969632 272
217 3300014325 Ga0163163_10016471 Ga0163163_100164713 272
218 3300014325 Ga0163163_10019411 Ga0163163_100194112 272
219 3300014325 Ga0163163_10208910 Ga0163163_102089102 272
220 3300014326 Ga0157380_10078248 Ga0157380_100782482 272
221 3300014745 Ga0157377_10010148 Ga0157377_100101482 272
222 3300014968 Ga0157379_10000028 Ga0157379_1000002843 272
223 3300014968 Ga0157379_10215742 Ga0157379_102157422 272
224 3300014968 Ga0157379_10304242 Ga0157379_103042422 272
225 3300014969 Ga0157376_10012059 Ga0157376_100120594 272
226 3300014969 Ga0157376_10237630 Ga0157376_102376302 272
227 3300025315 Ga0207697_10002167 Ga0207697_100021678 272
228 3300025893 Ga0207682_10001573 Ga0207682_100015736 272
229 3300025893 Ga0207682_10098583 Ga0207682_100985832 272
230 3300025899 Ga0207642_10152571 Ga0207642_101525712 272
231 3300025903 Ga0207680_10246370 Ga0207680_102463702 272
232 3300025906 Ga0207699_10385980 Ga0207699_103859801 272
233 3300025907 Ga0207645_10065378 Ga0207645_100653782 272
234 3300025908 Ga0207643_10000749 Ga0207643_100007498 272
235 3300025910 Ga0207684_10224710 Ga0207684_102247102 272
236 3300025919 Ga0207657_10003343 Ga0207657_1000334311 272
237 3300025919 Ga0207657_10011429 Ga0207657_100114296 272
238 3300025920 Ga0207649_10223969 Ga0207649_102239692 272
239 3300025921 Ga0207652_10095561 Ga0207652_100955613 272
240 3300025922 Ga0207646_10000529 Ga0207646_1000052923 272
241 3300025923 Ga0207681_10004405 Ga0207681_100044052 272
242 3300025923 Ga0207681_10090664 Ga0207681_100906642 272
243 3300025924 Ga0207694_10005034 Ga0207694_100050347 272
244 3300025925 Ga0207650_10003040 Ga0207650_100030402 272
245 3300025925 Ga0207650_10008950 Ga0207650_100089504 272
246 3300025925 Ga0207650_10051984 Ga0207650_100519841 272
247 3300025926 Ga0207659_10264454 Ga0207659_102644542 272
248 3300025928 Ga0207700_10001400 Ga0207700_100014008 272
249 3300025928 Ga0207700_10041071 Ga0207700_100410712 272
250 3300025929 Ga0207664_10012935 Ga0207664_100129355 272
251 3300025931 Ga0207644_10148973 Ga0207644_101489731 272
252 3300025932 Ga0207690_10012009 Ga0207690_100120094 272
253 3300025933 Ga0207706_10000158 Ga0207706_1000015854 272
254 3300025933 Ga0207706_10014264 Ga0207706_100142643 272
255 3300025939 Ga0207665_10130909 Ga0207665_101309092 272
256 3300025940 Ga0207691_10011678 Ga0207691_100116786 272
257 3300025940 Ga0207691_10025153 Ga0207691_100251534 272
258 3300025940 Ga0207691_10053987 Ga0207691_100539873 272
259 3300025940 Ga0207691_10118254 Ga0207691_101182542 272
260 3300025940 Ga0207691_10334323 Ga0207691_103343232 272
261 3300025941 Ga0207711_10010915 Ga0207711_100109155 272
262 3300025942 Ga0207689_10000151 Ga0207689_1000015126 272
263 3300025942 Ga0207689_10008549 Ga0207689_100085496 272
264 3300025949 Ga0207667_10002794 Ga0207667_1000279418 272
265 3300025949 Ga0207667_10009824 Ga0207667_100098244 272
266 3300025949 Ga0207667_10177512 Ga0207667_101775122 272
267 3300025960 Ga0207651_10095612 Ga0207651_100956121 272
268 3300025960 Ga0207651_10184294 Ga0207651_101842942 272
269 3300025961 Ga0207712_10232917 Ga0207712_102329172 272
270 3300025972 Ga0207668_10009919 Ga0207668_100099193 272
271 3300025972 Ga0207668_10011359 Ga0207668_100113592 272
272 3300025972 Ga0207668_10075876 Ga0207668_100758763 272
273 3300025972 Ga0207668_10218750 Ga0207668_102187502 272
274 3300025986 Ga0207658_10005646 Ga0207658_100056467 272
275 3300025986 Ga0207658_10160609 Ga0207658_101606092 272
276 3300026023 Ga0207677_10002681 Ga0207677_100026813 272
277 3300026023 Ga0207677_10018709 Ga0207677_100187092 272
278 3300026035 Ga0207703_10000300 Ga0207703_1000030028 272
279 3300026035 Ga0207703_10237136 Ga0207703_102371362 272
280 3300026035 Ga0207703_10315916 Ga0207703_103159161 272
281 3300026041 Ga0207639_10080317 Ga0207639_100803173 272
282 3300026041 Ga0207639_10145592 Ga0207639_101455922 272
283 3300026067 Ga0207678_10018980 Ga0207678_100189803 272
284 3300026075 Ga0207708_10026403 Ga0207708_100264032 272
285 3300026078 Ga0207702_10174919 Ga0207702_101749192 272
286 3300026088 Ga0207641_10311191 Ga0207641_103111912 272
287 3300026089 Ga0207648_10003158 Ga0207648_100031589 272
288 3300026089 Ga0207648_10040692 Ga0207648_100406922 272
289 3300026089 Ga0207648_10071626 Ga0207648_100716263 272
290 3300026089 Ga0207648_10138468 Ga0207648_101384681 272
291 3300026095 Ga0207676_10001288 Ga0207676_100012883 272
292 3300026095 Ga0207676_10189261 Ga0207676_101892612 272
293 3300026095 Ga0207676_10197822 Ga0207676_101978222 272
294 3300026116 Ga0207674_10027326 Ga0207674_100273265 272
295 3300026116 Ga0207674_10041204 Ga0207674_100412044 272
296 3300026118 Ga0207675_100001119 Ga0207675_10000111926 272
297 3300026118 Ga0207675_100003880 Ga0207675_1000038804 272
298 3300026118 Ga0207675_100193527 Ga0207675_1001935272 272
299 3300026142 Ga0207698_10040906 Ga0207698_100409063 272
300 3300026142 Ga0207698_10123396 Ga0207698_101233962 272
301 3300027360 Ga0209969_1004199 Ga0209969_10041992 272
302 3300027526 Ga0209968_1005001 Ga0209968_10050012 272
303 3300027552 Ga0209982_1002147 Ga0209982_10021472 272
304 3300027617 Ga0210002_1003051 Ga0210002_10030512 272
305 3300027665 Ga0209983_1003102 Ga0209983_10031022 272
306 3300027682 Ga0209971_1001018 Ga0209971_10010186 272
307 3300027695 Ga0209966_1003127 Ga0209966_10031273 272
308 3300027717 Ga0209998_10018004 Ga0209998_100180042 272
309 3300027876 Ga0209974_10000225 Ga0209974_100002256 272
310 3300028379 Ga0268266_10006100 Ga0268266_100061003 272
311 3300028380 Ga0268265_10060224 Ga0268265_100602242 272
312 3300028380 Ga0268265_10060412 Ga0268265_100604123 272
313 3300028381 Ga0268264_10000451 Ga0268264_1000045118 272
314 3300028381 Ga0268264_10026386 Ga0268264_100263862 272
315 3300031548 Ga0307408_100103813 Ga0307408_1001038132 272
316 3300031731 Ga0307405_10001878 Ga0307405_100018787 272
317 3300031824 Ga0307413_10005631 Ga0307413_100056313 272
318 3300031824 Ga0307413_10006144 Ga0307413_100061444 272
319 3300031824 Ga0307413_10183433 Ga0307413_101834332 272
320 3300031852 Ga0307410_10001979 Ga0307410_100019797 272
321 3300031901 Ga0307406_10008678 Ga0307406_100086785 272
322 3300031911 Ga0307412_10040488 Ga0307412_100404883 272
323 3300031995 Ga0307409_100132456 Ga0307409_1001324562 272
324 3300031995 Ga0307409_100133826 Ga0307409_1001338262 272
325 3300032002 Ga0307416_100097462 Ga0307416_1000974622 272
326 3300032002 Ga0307416_100251177 Ga0307416_1002511772 272
327 3300032002 Ga0307416_100287721 Ga0307416_1002877212 272
328 3300032005 Ga0307411_10033331 Ga0307411_100333313 272
329 3300032005 Ga0307411_10035708 Ga0307411_100357082 272
330 3300035692 Ga0373935_0345278 Ga0373935_0345278_112_972 272
331 3300035695 Ga0373927_0006762 Ga0373927_0006762_5406_6266 272
332 3300036401 Ga0373937_0004919 Ga0373937_0004919_9354_10214 272
333 3300037068 Ga0373925_0214891 Ga0373925_0214891_461_1321 272
334 3300038443 Ga0395901_0010836 Ga0395901_0010836_6883_7809 272
335 3300048088 Ga0495602_0152045 Ga0495602_0152045_628_1488 272
336 3300048904 Ga0496101_0042243 Ga0496101_0042243_2032_2922 272
337 3300048905 Ga0496102_0222561 Ga0496102_0222561_397_1335 272
338 3300048906 Ga0496103_0057781 Ga0496103_0057781_1321_2259 272
339 3300048908 Ga0496105_0169335 Ga0496105_0169335_86_976 272
340 3300048910 Ga0496107_0059483 Ga0496107_0059483_551_1441 272
341 3300048911 Ga0496108_0048725 Ga0496108_0048725_2054_2935 272
342 3300048911 Ga0496108_0052505 Ga0496108_0052505_2165_3055 272
343 3300048911 Ga0496108_0230386 Ga0496108_0230386_759_1589 272
344 3300048912 Ga0496109_0008442 Ga0496109_0008442_1509_2399 272
345 3300048913 Ga0496110_0446201 Ga0496110_0446201_41_943 272
346 3300048914 Ga0496111_0161715 Ga0496111_0161715_181_1071 272
347 3300048917 Ga0496114_0162151 Ga0496114_0162151_81_911 272
348 3300048919 Ga0496116_0028247 Ga0496116_0028247_1943_2773 272
349 3300049591 Ga0501075_0064744 Ga0501075_0064744_95_937 272
350 3300049592 Ga0501076_0548730 Ga0501076_0548730_39_881 272
351 3300049593 Ga0501077_0114853 Ga0501077_0114853_795_1637 272
352 3300050508 nmdc:mga09592_72769_c1 nmdc:mga09592_72769_c1_502_1410 272
353 3300050510 nmdc:mga06r32_28672_c1 nmdc:mga06r32_28672_c1_4230_5138 272
354 3300050511 nmdc:mga08y16_123813_c1 nmdc:mga08y16_123813_c1_1039_1926 272
355 3300050512 nmdc:mga0n895_379333_c1 nmdc:mga0n895_379333_c1_539_1396 272
356 3300050513 nmdc:mga0rr50_263308_c1 nmdc:mga0rr50_263308_c1_426_1283 272
357 3300053078 Ga0495612_0027861 Ga0495612_0027861_730_1590 272
358 3300059421 Ga0590071_006646 Ga0590071_006646_633_1505 272
359 3300025932 Ga0207690_10113112 Ga0207690_101131122 273
360 3300049587 Ga0501071_0195577 Ga0501071_0195577_334_1191 273
361 3300005614 Ga0068856_100548316 Ga0068856_1005483161 274
362 3300031727 Ga0316576_10018511 Ga0316576_100185112 274
363 3300031728 Ga0316578_10031093 Ga0316578_100310933 274
364 3300032139 Ga0316580_10018477 Ga0316580_100184772 274
365 3300032168 Ga0316593_10043809 Ga0316593_100438092 274
366 3300033524 Ga0316592_1007206 Ga0316592_10072062 274
367 3300033524 Ga0316592_1022793 Ga0316592_10227931 274
368 3300033527 Ga0316586_1008021 Ga0316586_10080212 274
369 3300033541 Ga0316596_1010069 Ga0316596_10100692 274
370 3300035398 Ga0316574_0002258 Ga0316574_0002258_249_1199 274
371 3300044684 Ga0466966_0192709 Ga0466966_0192709_218_1096 274
372 3300046500 Ga0495596_0000134 Ga0495596_0000134_24682_25566 274
373 3300046528 Ga0495642_0019892 Ga0495642_0019892_645_1523 274
374 3300046528 Ga0495642_0039559 Ga0495642_0039559_998_1876 274
375 3300046528 Ga0495642_0039826 Ga0495642_0039826_991_1869 274
376 3300046616 Ga0495668_0251143 Ga0495668_0251143_23_901 274
377 3300046665 Ga0495661_0051430 Ga0495661_0051430_620_1498 274
378 3300046691 Ga0495670_0138538 Ga0495670_0138538_375_1253 274
379 3300005338 Ga0068868_100023171 Ga0068868_1000231713 275
380 3300005340 Ga0070689_100181993 Ga0070689_1001819932 275
381 3300005535 Ga0070684_100147280 Ga0070684_1001472802 275
382 3300005548 Ga0070665_100195159 Ga0070665_1001951592 275
383 3300006881 Ga0068865_100009764 Ga0068865_1000097643 275
384 3300009093 Ga0105240_10184224 Ga0105240_101842242 275
385 3300009545 Ga0105237_10132463 Ga0105237_101324632 275
386 3300013105 Ga0157369_10611022 Ga0157369_106110222 275
387 3300013296 Ga0157374_10019992 Ga0157374_100199925 275
388 3300013297 Ga0157378_10054523 Ga0157378_100545233 275
389 3300013297 Ga0157378_10426743 Ga0157378_104267431 275
390 3300025914 Ga0207671_10120711 Ga0207671_101207112 275
391 3300026023 Ga0207677_10077305 Ga0207677_100773055 275
392 3300005353 Ga0070669_100000122 Ga0070669_10000012225 276
393 3300005365 Ga0070688_100052313 Ga0070688_1000523132 276
394 3300005466 Ga0070685_10231411 Ga0070685_102314112 276
395 3300025923 Ga0207681_10000151 Ga0207681_1000015130 276
396 3300035085 Ga0373929_0000006 Ga0373929_0000006_299209_300039 276
397 3300041486 Ga0451807_2675329 Ga0451807_2675329_211_1041 276
398 3300044712 Ga0453684_0068558 Ga0453684_0068558_1914_2744 276
399 3300061734 Ga0530510_0259567 Ga0530510_0259567_229_1059 276
400 3300004801 Ga0058860_11765155 Ga0058860_117651552 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11959

DUF3473

Domain of unknown function (DUF3473)

195

322

0.99

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

73

194

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j13-assembly1.cif.gz_A structure of a family 4 carbohydrate esterase from bacillus anthracis 0.7964 4 276
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.7736 2 275
4u10-assembly2.cif.gz_B probing the structure and mechanism of de-n-acetylase from aggregatibacter actinomycetemcomitans 0.7718 38 156
6h8l-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis 0.7661 2 276
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.7652 2 275
ID Description Score Start End Superfamily
2j13A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7964 4 276 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7672 2 277 3.20.20.370
2y8uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7593 2 276 3.20.20.370
4f9dB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.758 35 147 3.20.20.370
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7566 4 276 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A536UC78-F1-model_v4 Polysaccharide deacetylase family protein 0.9916 1 128 GO:0005975
GO:0016810
AF-A0A5A7ND05-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9906 1 131 GO:0005975
GO:0016810
AF-A0A351A2E7-F1-model_v4 Polysaccharide deacetylase family protein 0.9895 1 121 GO:0005975
GO:0016810
AF-A0A2V8KEE4-F1-model_v4 Polysaccharide deacetylase family protein 0.9854 75 276 GO:0005975
GO:0016810
AF-A0A3L7RMC8-F1-model_v4 DUF3473 domain-containing protein 0.9829 3 275 GO:0005975
GO:0016810

Feature Viewer

pLDDT pTM Quality
92.14 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map