F434612

General Info

Members Datasets Scaffolds Average Seq Length
400 222 400 103

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10025336|Ga0265340_100253364
Length 124
Sequence LSLLHWIGESADKRRLFLMVSEKDVSYVADLAHLDLTAEERARMLKDLNSILDYIDRLNQLDTSNVEPMAQVASRYGERKEEGDRFGYAMRADELVSCLPREEALRNAPESDGTFFKVPKVIER

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10539775 3300005293 Unclassified 749
2 Ga0070683_100042363 3300005329 Bacteria 4192
3 Ga0070680_100048910 3300005336 Bacteria 3446
4 Ga0070680_100547207 3300005336 Bacteria 992
5 Ga0070682_101547392 3300005337 Bacteria 572
6 Ga0068868_100064452 3300005338 Bacteria 2909
7 Ga0070660_100146934 3300005339 Bacteria 1894
8 Ga0070689_100106554 3300005340 Bacteria 2224
9 Ga0070689_101327222 3300005340 Unclassified 648
10 Ga0070669_100133080 3300005353 Bacteria 1910
11 Ga0070671_100144197 3300005355 Unclassified 2010
12 Ga0070659_100494925 3300005366 Unclassified 1041
13 Ga0070667_101259809 3300005367 Unclassified 692
14 Ga0070667_101393930 3300005367 Unclassified 657
15 Ga0070709_10057746 3300005434 Bacteria 2459
16 Ga0070709_10868749 3300005434 Bacteria 711
17 Ga0070714_100381158 3300005435 Bacteria 1329
18 Ga0070714_100703976 3300005435 Bacteria 975
19 Ga0070713_100024223 3300005436 Bacteria 4725
20 Ga0070713_100026899 3300005436 Bacteria 4523
21 Ga0070713_100155444 3300005436 Bacteria 2038
22 Ga0070713_100178585 3300005436 Bacteria 1906
23 Ga0070713_101055826 3300005436 Unclassified 784
24 Ga0070713_101136897 3300005436 Unclassified 755
25 Ga0070710_10501566 3300005437 Bacteria 831
26 Ga0070711_100010055 3300005439 Bacteria 5842
27 Ga0070711_100152450 3300005439 Bacteria 1744
28 Ga0070711_100311965 3300005439 Bacteria 1254
29 Ga0070711_100613072 3300005439 Unclassified 909
30 Ga0070711_101011784 3300005439 Bacteria 713
31 Ga0070711_101555948 3300005439 Unclassified 578
32 Ga0070711_102023957 3300005439 Unclassified 507
33 Ga0070700_101633476 3300005441 Unclassified 551
34 Ga0070708_100010439 3300005445 Bacteria 7528
35 Ga0070708_100018012 3300005445 Bacteria 5905
36 Ga0070708_100026648 3300005445 Bacteria 4950
37 Ga0070708_101756391 3300005445 Unclassified 576
38 Ga0070708_102067783 3300005445 Bacteria 527
39 Ga0070678_100021192 3300005456 Bacteria 4281
40 Ga0070681_10839885 3300005458 Unclassified 836
41 Ga0068867_101061238 3300005459 Unclassified 738
42 Ga0070706_100182463 3300005467 Bacteria 1960
43 Ga0070706_101612310 3300005467 Bacteria 592
44 Ga0070707_100115883 3300005468 Bacteria 2601
45 Ga0070707_100142222 3300005468 Bacteria 2335
46 Ga0070707_101160364 3300005468 Bacteria 738
47 Ga0070698_100014941 3300005471 Bacteria 8208
48 Ga0070698_100023896 3300005471 Bacteria 6381
49 Ga0070698_100218449 3300005471 Unclassified 1840
50 Ga0070698_100826766 3300005471 Bacteria 871
51 Ga0070699_100100573 3300005518 Bacteria 2534
52 Ga0070684_100006629 3300005535 Bacteria 8968
53 Ga0070684_100047418 3300005535 Bacteria 3723
54 Ga0070697_100009939 3300005536 Bacteria 7423
55 Ga0070697_100026380 3300005536 Bacteria 4640
56 Ga0070697_100432809 3300005536 Unclassified 1144
57 Ga0068853_100377334 3300005539 Unclassified 1324
58 Ga0068853_101242692 3300005539 Unclassified 719
59 Ga0070693_100047867 3300005547 Bacteria 2434
60 Ga0070693_100087797 3300005547 Bacteria 1868
61 Ga0070693_101060879 3300005547 Unclassified 616
62 Ga0070693_101278899 3300005547 Unclassified 566
63 Ga0070665_100002225 3300005548 Bacteria 21620
64 Ga0070704_100891023 3300005549 Unclassified 800
65 Ga0070664_101031202 3300005564 Unclassified 774
66 Ga0068857_100205135 3300005577 Bacteria 1798
67 Ga0068854_100535413 3300005578 Unclassified 991
68 Ga0068856_100190113 3300005614 Unclassified 2067
69 Ga0068856_101441403 3300005614 Unclassified 703
70 Ga0068852_100105396 3300005616 Bacteria 2554
71 Ga0068859_101050613 3300005617 Unclassified 895
72 Ga0068859_101107291 3300005617 Bacteria 871
73 Ga0068859_101210726 3300005617 Bacteria 832
74 Ga0068864_100991431 3300005618 Unclassified 833
75 Ga0068851_10057522 3300005834 Bacteria 1985
76 Ga0068863_100023515 3300005841 Bacteria 5883
77 Ga0068863_101945176 3300005841 Bacteria 598
78 Ga0068858_100429171 3300005842 Bacteria 1271
79 Ga0068858_102023646 3300005842 Unclassified 569
80 Ga0068860_100313640 3300005843 Bacteria 1538
81 Ga0081455_10026129 3300005937 Bacteria 5378
82 Ga0070717_10039650 3300006028 Bacteria 3833
83 Ga0070717_10050983 3300006028 Bacteria 3404
84 Ga0070717_10104323 3300006028 Bacteria 2411
85 Ga0070717_10180913 3300006028 Bacteria 1838
86 Ga0070717_10401009 3300006028 Bacteria 1232
87 Ga0070717_10894159 3300006028 Unclassified 808
88 Ga0070715_10146134 3300006163 Bacteria 1154
89 Ga0070716_100004266 3300006173 Bacteria 6811
90 Ga0070716_100022350 3300006173 Bacteria 3342
91 Ga0070716_100058088 3300006173 Bacteria 2225
92 Ga0070716_100149584 3300006173 Unclassified 1500
93 Ga0070716_100405207 3300006173 Bacteria 982
94 Ga0070712_100013458 3300006175 Bacteria 5229
95 Ga0070712_100034330 3300006175 Bacteria 3437
96 Ga0070712_100095655 3300006175 Bacteria 2186
97 Ga0070712_100111561 3300006175 Bacteria 2042
98 Ga0070712_100915892 3300006175 Bacteria 756
99 Ga0097621_100070611 3300006237 Bacteria 2884
100 Ga0068871_100180392 3300006358 Bacteria 1814
101 Ga0068871_100257653 3300006358 Bacteria 1521
102 Ga0075428_102305836 3300006844 Unclassified 554
103 Ga0075428_102348228 3300006844 Bacteria 548
104 Ga0075431_100050314 3300006847 Bacteria 4297
105 Ga0075433_10175498 3300006852 Bacteria 1907
106 Ga0075434_100031292 3300006871 Bacteria 5246
107 Ga0075434_100039702 3300006871 Bacteria 4663
108 Ga0075434_100175295 3300006871 Unclassified 2164
109 Ga0068865_100771520 3300006881 Unclassified 827
110 Ga0075436_100009463 3300006914 Bacteria 6661
111 Ga0075436_100474457 3300006914 Unclassified 913
112 Ga0075436_100642338 3300006914 Unclassified 784
113 Ga0075436_101544992 3300006914 Bacteria 504
114 Ga0097620_101050806 3300006931 Unclassified 895
115 Ga0097620_101107046 3300006931 Bacteria 871
116 Ga0097620_101210536 3300006931 Bacteria 832
117 Ga0075435_100037936 3300007076 Bacteria 3841
118 Ga0075435_100071662 3300007076 Bacteria 2830
119 Ga0075435_100079446 3300007076 Bacteria 2692
120 Ga0099795_10060202 3300007788 Bacteria 1407
121 Ga0099795_10332389 3300007788 Unclassified 676
122 Ga0105240_10007492 3300009093 Bacteria 15834
123 Ga0105240_10378123 3300009093 Unclassified 1600
124 Ga0105240_11082947 3300009093 Unclassified 853
125 Ga0105240_11415199 3300009093 Unclassified 731
126 Ga0105240_12751834 3300009093 Unclassified 506
127 Ga0105245_10103307 3300009098 Unclassified 2640
128 Ga0105245_11713832 3300009098 Bacteria 681
129 Ga0105247_11390721 3300009101 Unclassified 567
130 Ga0114129_10565800 3300009147 Bacteria 1476
131 Ga0105241_10085329 3300009174 Bacteria 2481
132 Ga0105241_10195801 3300009174 Bacteria 1685
133 Ga0105242_10050839 3300009176 Bacteria 3376
134 Ga0105242_10291350 3300009176 Bacteria 1486
135 Ga0105242_12335295 3300009176 Unclassified 581
136 Ga0105248_10391175 3300009177 Unclassified 1565
137 Ga0105248_10804305 3300009177 Unclassified 1061
138 Ga0105248_11090457 3300009177 Unclassified 902
139 Ga0105248_11097844 3300009177 Bacteria 899
140 Ga0105237_11245573 3300009545 Unclassified 750
141 Ga0105238_10085096 3300009551 Bacteria 3151
142 Ga0105238_10560410 3300009551 Unclassified 1148
143 Ga0105249_11192143 3300009553 Unclassified 832
144 Ga0099796_10023954 3300010159 Bacteria 1911
145 Ga0099796_10565529 3300010159 Unclassified 512
146 Ga0105239_10142743 3300010375 Bacteria 2669
147 Ga0105239_13123959 3300010375 Unclassified 539
148 Ga0157371_10682594 3300013102 Bacteria 768
149 Ga0157370_11855353 3300013104 Unclassified 541
150 Ga0157369_10011479 3300013105 Bacteria 10060
151 Ga0157369_10172382 3300013105 Bacteria 2279
152 Ga0157369_10280617 3300013105 Bacteria 1735
153 Ga0157374_10062655 3300013296 Bacteria 3486
154 Ga0157374_10069349 3300013296 Bacteria 3320
155 Ga0157374_10413759 3300013296 Bacteria 1346
156 Ga0157378_10082401 3300013297 Bacteria 2909
157 Ga0157378_10372030 3300013297 Bacteria 1401
158 Ga0157378_12179748 3300013297 Bacteria 605
159 Ga0157372_10362416 3300013307 Bacteria 1689
160 Ga0157372_12444637 3300013307 Unclassified 600
161 Ga0157375_11706622 3300013308 Bacteria 746
162 Ga0157375_12865206 3300013308 Bacteria 576
163 Ga0157375_13593320 3300013308 Unclassified 516
164 Ga0163163_10889247 3300014325 Bacteria 954
165 Ga0182008_10323550 3300014497 Unclassified 812
166 Ga0157379_10666622 3300014968 Unclassified 975
167 Ga0157376_10078376 3300014969 Bacteria 2829
168 Ga0157376_10978758 3300014969 Bacteria 868
169 Ga0213875_10000019 3300021388 Bacteria 231333
170 Ga0224569_109770 3300022732 Unclassified 679
171 Ga0207656_10280115 3300025321 Unclassified 822
172 Ga0207692_10232025 3300025898 Bacteria 1099
173 Ga0207685_10097141 3300025905 Bacteria 1252
174 Ga0207699_10025322 3300025906 Bacteria 3256
175 Ga0207699_10044953 3300025906 Bacteria 2574
176 Ga0207699_10694215 3300025906 Unclassified 745
177 Ga0207645_10467201 3300025907 Unclassified 852
178 Ga0207684_10044403 3300025910 Bacteria 3768
179 Ga0207684_10173831 3300025910 Unclassified 1857
180 Ga0207684_11350735 3300025910 Bacteria 585
181 Ga0207654_11270536 3300025911 Unclassified 537
182 Ga0207707_10530583 3300025912 Unclassified 1002
183 Ga0207707_10956987 3300025912 Unclassified 705
184 Ga0207695_10003410 3300025913 Bacteria 22446
185 Ga0207695_10482173 3300025913 Unclassified 1122
186 Ga0207693_10021795 3300025915 Bacteria 5094
187 Ga0207693_10059628 3300025915 Bacteria 2989
188 Ga0207693_10070386 3300025915 Bacteria 2737
189 Ga0207693_10099599 3300025915 Bacteria 2279
190 Ga0207663_10028826 3300025916 Bacteria 3254
191 Ga0207663_10105099 3300025916 Bacteria 1905
192 Ga0207663_10485383 3300025916 Unclassified 958
193 Ga0207662_10221352 3300025918 Bacteria 1233
194 Ga0207657_10143681 3300025919 Bacteria 1948
195 Ga0207646_10001819 3300025922 Bacteria 25765
196 Ga0207646_10300639 3300025922 Bacteria 1450
197 Ga0207646_10736715 3300025922 Bacteria 880
198 Ga0207646_10956516 3300025922 Unclassified 758
199 Ga0207681_10102576 3300025923 Bacteria 2066
200 Ga0207694_10130094 3300025924 Unclassified 2017
201 Ga0207700_10008891 3300025928 Bacteria 6247
202 Ga0207700_10010609 3300025928 Bacteria 5825
203 Ga0207700_10035912 3300025928 Bacteria 3575
204 Ga0207700_10099183 3300025928 Bacteria 2319
205 Ga0207700_10311813 3300025928 Unclassified 1361
206 Ga0207700_11185271 3300025928 Unclassified 682
207 Ga0207664_10165526 3300025929 Bacteria 1889
208 Ga0207664_11234856 3300025929 Unclassified 666
209 Ga0207644_10356091 3300025931 Bacteria 1189
210 Ga0207644_10813355 3300025931 Unclassified 782
211 Ga0207690_10306573 3300025932 Unclassified 1244
212 Ga0207686_10159624 3300025934 Bacteria 1579
213 Ga0207686_10229323 3300025934 Unclassified 1345
214 Ga0207704_10696681 3300025938 Unclassified 841
215 Ga0207665_10003634 3300025939 Bacteria 10302
216 Ga0207665_10019078 3300025939 Bacteria 4506
217 Ga0207665_10066428 3300025939 Bacteria 2455
218 Ga0207711_10402426 3300025941 Bacteria 1272
219 Ga0207711_10568199 3300025941 Unclassified 1058
220 Ga0207711_10949855 3300025941 Unclassified 798
221 Ga0207667_12241982 3300025949 Unclassified 503
222 Ga0207651_10767805 3300025960 Bacteria 853
223 Ga0207703_10148043 3300026035 Bacteria 2044
224 Ga0207703_10792974 3300026035 Unclassified 904
225 Ga0207639_10326347 3300026041 Unclassified 1364
226 Ga0207639_11052580 3300026041 Unclassified 763
227 Ga0207702_10690122 3300026078 Unclassified 1006
228 Ga0207641_10010947 3300026088 Bacteria 7433
229 Ga0207641_11649299 3300026088 Bacteria 643
230 Ga0207648_10967756 3300026089 Bacteria 796
231 Ga0207674_10076258 3300026116 Bacteria 3361
232 Ga0207698_10012877 3300026142 Bacteria 5494
233 Ga0209179_1115436 3300027512 Unclassified 599
234 Ga0265356_1012055 3300028017 Unclassified 952
235 Ga0268266_10000144 3300028379 Bacteria 135508
236 Ga0268264_10165294 3300028381 Bacteria 1997
237 Ga0265326_10032659 3300028558 Unclassified 1482
238 Ga0265322_10000125 3300028654 Bacteria 35570
239 Ga0265338_10151881 3300028800 Bacteria 1798
240 Ga0265762_1002578 3300030760 Bacteria 3261
241 Ga0265765_1003937 3300030879 Unclassified 1509
242 Ga0265760_10006526 3300031090 Bacteria 3337
243 Ga0265760_10012962 3300031090 Bacteria 2387
244 Ga0265760_10261509 3300031090 Unclassified 602
245 Ga0265328_10211297 3300031239 Unclassified 738
246 Ga0265325_10015004 3300031241 Bacteria 4367
247 Ga0265325_10309180 3300031241 Bacteria 704
248 Ga0265340_10025336 3300031247 Bacteria 3004
249 Ga0265339_10018791 3300031249 Bacteria 4069
250 Ga0265327_10065509 3300031251 Unclassified 1837
251 Ga0265316_10203942 3300031344 Bacteria 1465
252 Ga0265316_10304614 3300031344 Unclassified 1160
253 Ga0265316_10659539 3300031344 Bacteria 739
254 Ga0307408_100004979 3300031548 Bacteria 8927
255 Ga0307408_101277907 3300031548 Unclassified 687
256 Ga0307408_101399964 3300031548 Bacteria 658
257 Ga0265314_10341235 3300031711 Bacteria 827
258 Ga0307405_10052763 3300031731 Bacteria 2530
259 Ga0307405_10285401 3300031731 Unclassified 1245
260 Ga0307413_10166830 3300031824 Unclassified 1554
261 Ga0307410_10011426 3300031852 Bacteria 5078
262 Ga0307410_10027337 3300031852 Bacteria 3605
263 Ga0307406_10111427 3300031901 Bacteria 1885
264 Ga0307412_11188390 3300031911 Unclassified 682
265 Ga0307416_100185410 3300032002 Bacteria 1955
266 Ga0307416_100304913 3300032002 Bacteria 1585
267 Ga0307414_11010145 3300032004 Unclassified 766
268 Ga0307411_10105769 3300032005 Bacteria 2001
269 Ga0307411_11713352 3300032005 Unclassified 582
270 Ga0307411_11789787 3300032005 Unclassified 570
271 Ga0373926_0007861 3300035083 Bacteria 3553
272 Ga0373944_0003881 3300035089 Bacteria 3873
273 Ga0373952_0235752 3300035092 Bacteria 549
274 Ga0373923_0059768 3300035111 Bacteria 1616
275 Ga0373936_0033477 3300035113 Bacteria 2037
276 Ga0373945_0002001 3300035116 Bacteria 6331
277 Ga0373957_0092546 3300035120 Bacteria 1203
278 Ga0373943_0034095 3300035170 Bacteria 2427
279 Ga0373946_0036715 3300035171 Bacteria 1988
280 Ga0373924_0000053 3300035410 Bacteria 29668
281 Ga0373924_0452903 3300035410 Unclassified 575
282 Ga0373931_0023816 3300035691 Bacteria 3094
283 Ga0373931_0162178 3300035691 Bacteria 1311
284 Ga0373931_0759133 3300035691 Unclassified 644
285 Ga0373935_0018019 3300035692 Bacteria 4291
286 Ga0373935_0089833 3300035692 Bacteria 2009
287 Ga0373935_0104391 3300035692 Bacteria 1873
288 Ga0373927_0003228 3300035695 Bacteria 11740
289 Ga0373927_0019756 3300035695 Bacteria 4417
290 Ga0373927_0097948 3300035695 Bacteria 1906
291 Ga0373947_0001620 3300035725 Bacteria 13811
292 Ga0373947_0086005 3300035725 Bacteria 1953
293 Ga0373947_0399738 3300035725 Bacteria 926
294 Ga0373947_0536645 3300035725 Unclassified 796
295 Ga0373947_0853376 3300035725 Unclassified 622
296 Ga0373937_0000340 3300036401 Bacteria 44240
297 Ga0373937_0677260 3300036401 Bacteria 977
298 Ga0373925_0000062 3300037068 Bacteria 114902
299 Ga0373925_0040771 3300037068 Bacteria 3438
300 Ga0373925_0859792 3300037068 Bacteria 747
301 Ga0373925_1068743 3300037068 Unclassified 664
302 Ga0373925_1316242 3300037068 Bacteria 593
303 Ga0373925_1694603 3300037068 Bacteria 516
304 Ga0373925_1716845 3300037068 Unclassified 512
305 Ga0395898_1059850 3300037466 Unclassified 745
306 Ga0436364_0366372 3300037853 Bacteria 231753
307 Ga0436364_0820647 3300037853 Archaea 578
308 Ga0436364_1055528 3300037853 Unclassified 961
309 Ga0395901_1095399 3300038443 Unclassified 767
310 Ga0436360_0484194 3300039438 Unclassified 568
311 Ga0436360_0674499 3300039438 Unclassified 858
312 Ga0436361_0993150 3300039447 Unclassified 635
313 Ga0451577_0114702 3300042876 Bacteria 2412
314 Ga0451577_1504784 3300042876 Bacteria 595
315 Ga0453683_0324225 3300044673 Bacteria 987
316 Ga0453683_0605677 3300044673 Unclassified 715
317 Ga0466964_0130801 3300044706 Bacteria 1143
318 Ga0466968_0113603 3300044735 Bacteria 1220
319 Ga0451576_0000338 3300045051 Bacteria 112906
320 Ga0451576_1059445 3300045051 Unclassified 849
321 Ga0466958_0094481 3300045836 Bacteria 1853
322 Ga0466967_0188296 3300045976 Bacteria 1949
323 Ga0466967_0207607 3300045976 Bacteria 1857
324 Ga0466967_2007354 3300045976 Unclassified 575
325 Ga0495603_0143608 3300046455 Bacteria 1388
326 Ga0495651_0228353 3300046462 Bacteria 1284
327 Ga0495580_0063696 3300046472 Bacteria 2585
328 Ga0495580_0152210 3300046472 Bacteria 1602
329 Ga0495580_0266203 3300046472 Bacteria 1171
330 Ga0495580_0295978 3300046472 Bacteria 1103
331 Ga0495580_0311911 3300046472 Bacteria 1070
332 Ga0495580_0673021 3300046472 Bacteria 679
333 Ga0495582_0124583 3300046473 Bacteria 1453
334 Ga0495605_0113373 3300046474 Unclassified 1235
335 Ga0495639_0074825 3300046475 Bacteria 1569
336 Ga0495594_0018806 3300046499 Bacteria 3665
337 Ga0495630_0072783 3300046517 Bacteria 2587
338 Ga0495666_0314726 3300046526 Bacteria 707
339 Ga0495642_0376815 3300046528 Unclassified 625
340 Ga0495652_0299294 3300046529 Bacteria 1170
341 Ga0495665_0011073 3300046531 Bacteria 4881
342 Ga0495665_0368889 3300046531 Unclassified 730
343 Ga0495586_0789799 3300046535 Unclassified 548
344 Ga0495645_0550374 3300046543 Unclassified 715
345 Ga0495667_0096934 3300046559 Bacteria 1909
346 Ga0495635_0110883 3300046663 Bacteria 1874
347 Ga0495635_0217243 3300046663 Unclassified 1294
348 Ga0495635_0678794 3300046663 Bacteria 669
349 Ga0495635_1050374 3300046663 Unclassified 517
350 Ga0495657_0063879 3300046675 Bacteria 2427
351 Ga0495599_0103843 3300046678 Bacteria 1771
352 Ga0495623_0064598 3300046679 Bacteria 2290
353 Ga0495658_0709986 3300046683 Unclassified 644
354 Ga0495669_0036573 3300046684 Bacteria 2171
355 Ga0495669_0170481 3300046684 Bacteria 1035
356 Ga0495613_0226310 3300046689 Bacteria 1312
357 Ga0495624_0407261 3300046690 Unclassified 816
358 Ga0495624_0871983 3300046690 Bacteria 530
359 Ga0495600_0094396 3300046809 Bacteria 1951
360 Ga0495581_0035153 3300047315 Bacteria 2899
361 Ga0495604_0217691 3300047317 Unclassified 1316
362 Ga0495636_0290470 3300047318 Unclassified 763
363 Ga0495674_0562236 3300047319 Bacteria 907
364 Ga0495676_0560646 3300047321 Bacteria 746
365 Ga0495683_0165790 3300047323 Bacteria 1019
366 Ga0495677_0065074 3300047445 Bacteria 1355
367 Ga0495684_0153853 3300047471 Bacteria 1719
368 Ga0495593_0034456 3300047673 Bacteria 2754
369 Ga0495602_0960154 3300048088 Unclassified 566
370 Ga0496104_0020078 3300048907 Bacteria 6120
371 Ga0496106_1218734 3300048909 Unclassified 586
372 Ga0496109_1345553 3300048912 Unclassified 650
373 Ga0496109_1356114 3300048912 Unclassified 647
374 Ga0496110_1196070 3300048913 Bacteria 669
375 Ga0496111_0094361 3300048914 Bacteria 2194
376 Ga0496112_0002331 3300048915 Bacteria 15237
377 Ga0496112_0002411 3300048915 Bacteria 15056
378 Ga0496113_0114290 3300048916 Bacteria 2104
379 Ga0496113_0508869 3300048916 Bacteria 967
380 Ga0496113_0621808 3300048916 Unclassified 864
381 Ga0496115_0008876 3300048918 Bacteria 7452
382 Ga0501264_036499 3300049761 Unclassified 587
383 Ga0501268_062337 3300049765 Unclassified 741
384 Ga0501268_133751 3300049765 Unclassified 560
385 nmdc:mga05p37_451614_c2 3300050507 Bacteria 1153
386 nmdc:mga05p37_931645_c1 3300050507 Bacteria 932
387 nmdc:mga09592_907116_c1 3300050508 Bacteria 740
388 nmdc:mga06r32_70648_c1 3300050510 Bacteria 3377
389 nmdc:mga0n895_12261_c1 3300050512 Bacteria 7682
390 nmdc:mga0n895_1435516_c1 3300050512 Unclassified 658
391 nmdc:mga0n895_157117_c1 3300050512 Bacteria 2305
392 nmdc:mga0n895_166128_c1 3300050512 Unclassified 2238
393 nmdc:mga0rr50_36304_c1 3300050513 Bacteria 2399
394 nmdc:mga0rr50_36394_c1 3300050513 Bacteria 3544
395 nmdc:mga08x19_222950_c1 3300050514 Bacteria 1296
396 nmdc:mga08x19_681924_c1 3300050514 Unclassified 729
397 nmdc:mga08x19_781844_c1 3300050514 Unclassified 678
398 nmdc:mga08x19_9103_c1 3300050514 Bacteria 5928
399 Ga0495619_0360047 3300053085 Bacteria 1006
400 Ga0587092_122968 3300059512 Unclassified 556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100144197 Ga0070671_1001441972 88
2 3300005436 Ga0070713_100178585 Ga0070713_1001785853 88
3 3300025928 Ga0207700_11185271 Ga0207700_111852712 88
4 3300025931 Ga0207644_10356091 Ga0207644_103560912 88
5 3300006175 Ga0070712_100915892 Ga0070712_1009158921 90
6 3300005471 Ga0070698_100023896 Ga0070698_1000238962 92
7 3300006881 Ga0068865_100771520 Ga0068865_1007715202 92
8 3300025938 Ga0207704_10696681 Ga0207704_106966812 92
9 3300031239 Ga0265328_10211297 Ga0265328_102112972 92
10 3300031344 Ga0265316_10304614 Ga0265316_103046142 92
11 3300005471 Ga0070698_100218449 Ga0070698_1002184491 93
12 3300006871 Ga0075434_100175295 Ga0075434_1001752952 93
13 3300006914 Ga0075436_101544992 Ga0075436_1015449922 93
14 3300028558 Ga0265326_10032659 Ga0265326_100326592 93
15 3300028654 Ga0265322_10000125 Ga0265322_1000012514 93
16 3300031241 Ga0265325_10309180 Ga0265325_103091801 93
17 3300031251 Ga0265327_10065509 Ga0265327_100655093 93
18 3300031344 Ga0265316_10203942 Ga0265316_102039421 93
19 3300031344 Ga0265316_10659539 Ga0265316_106595392 93
20 3300035691 Ga0373931_0759133 Ga0373931_0759133_337_627 93
21 3300042876 Ga0451577_0114702 Ga0451577_0114702_693_1007 93
22 3300044673 Ga0453683_0324225 Ga0453683_0324225_10_324 93
23 3300044673 Ga0453683_0605677 Ga0453683_0605677_181_471 93
24 3300045051 Ga0451576_0000338 Ga0451576_0000338_61077_61391 93
25 3300045976 Ga0466967_0207607 Ga0466967_0207607_1152_1469 93
26 3300050512 nmdc:mga0n895_166128_c1 nmdc:mga0n895_166128_c1_184_486 93
27 3300039447 Ga0436361_0993150 Ga0436361_0993150_286_597 94
28 3300046472 Ga0495580_0673021 Ga0495580_0673021_290_592 94
29 3300037068 Ga0373925_1716845 Ga0373925_1716845_123_440 96
30 3300037853 Ga0436364_1055528 Ga0436364_1055528_320_616 96
31 3300046472 Ga0495580_0266203 Ga0495580_0266203_614_931 96
32 3300005547 Ga0070693_101060879 Ga0070693_1010608791 97
33 3300046529 Ga0495652_0299294 Ga0495652_0299294_589_897 97
34 3300046678 Ga0495599_0103843 Ga0495599_0103843_1074_1382 97
35 3300005337 Ga0070682_101547392 Ga0070682_1015473922 98
36 3300005339 Ga0070660_100146934 Ga0070660_1001469342 98
37 3300005340 Ga0070689_100106554 Ga0070689_1001065542 98
38 3300005353 Ga0070669_100133080 Ga0070669_1001330802 98
39 3300005367 Ga0070667_101259809 Ga0070667_1012598091 98
40 3300005367 Ga0070667_101393930 Ga0070667_1013939302 98
41 3300005436 Ga0070713_100026899 Ga0070713_1000268992 98
42 3300005439 Ga0070711_101011784 Ga0070711_1010117841 98
43 3300005441 Ga0070700_101633476 Ga0070700_1016334762 98
44 3300005456 Ga0070678_100021192 Ga0070678_1000211925 98
45 3300005471 Ga0070698_100826766 Ga0070698_1008267661 98
46 3300005535 Ga0070684_100006629 Ga0070684_10000662910 98
47 3300005549 Ga0070704_100891023 Ga0070704_1008910232 98
48 3300005614 Ga0068856_100190113 Ga0068856_1001901132 98
49 3300005617 Ga0068859_101050613 Ga0068859_1010506132 98
50 3300005617 Ga0068859_101107291 Ga0068859_1011072912 98
51 3300005841 Ga0068863_101945176 Ga0068863_1019451762 98
52 3300005842 Ga0068858_100429171 Ga0068858_1004291713 98
53 3300005842 Ga0068858_102023646 Ga0068858_1020236461 98
54 3300005937 Ga0081455_10026129 Ga0081455_100261294 98
55 3300006028 Ga0070717_10050983 Ga0070717_100509835 98
56 3300006028 Ga0070717_10401009 Ga0070717_104010092 98
57 3300006173 Ga0070716_100405207 Ga0070716_1004052072 98
58 3300006237 Ga0097621_100070611 Ga0097621_1000706112 98
59 3300006358 Ga0068871_100180392 Ga0068871_1001803922 98
60 3300006358 Ga0068871_100257653 Ga0068871_1002576534 98
61 3300006844 Ga0075428_102305836 Ga0075428_1023058362 98
62 3300006844 Ga0075428_102348228 Ga0075428_1023482282 98
63 3300006847 Ga0075431_100050314 Ga0075431_1000503145 98
64 3300006931 Ga0097620_101050806 Ga0097620_1010508062 98
65 3300006931 Ga0097620_101107046 Ga0097620_1011070462 98
66 3300009093 Ga0105240_10007492 Ga0105240_1000749214 98
67 3300009098 Ga0105245_11713832 Ga0105245_117138322 98
68 3300009147 Ga0114129_10565800 Ga0114129_105658002 98
69 3300009174 Ga0105241_10195801 Ga0105241_101958013 98
70 3300009176 Ga0105242_10291350 Ga0105242_102913503 98
71 3300009176 Ga0105242_12335295 Ga0105242_123352952 98
72 3300009177 Ga0105248_10391175 Ga0105248_103911752 98
73 3300009177 Ga0105248_11097844 Ga0105248_110978442 98
74 3300010375 Ga0105239_13123959 Ga0105239_131239592 98
75 3300013102 Ga0157371_10682594 Ga0157371_106825942 98
76 3300013104 Ga0157370_11855353 Ga0157370_118553531 98
77 3300013105 Ga0157369_10011479 Ga0157369_100114792 98
78 3300013296 Ga0157374_10062655 Ga0157374_100626554 98
79 3300013297 Ga0157378_12179748 Ga0157378_121797482 98
80 3300013308 Ga0157375_11706622 Ga0157375_117066222 98
81 3300013308 Ga0157375_13593320 Ga0157375_135933201 98
82 3300014969 Ga0157376_10078376 Ga0157376_100783763 98
83 3300014969 Ga0157376_10978758 Ga0157376_109787582 98
84 3300021388 Ga0213875_10000019 Ga0213875_1000001935 98
85 3300025898 Ga0207692_10232025 Ga0207692_102320253 98
86 3300025907 Ga0207645_10467201 Ga0207645_104672012 98
87 3300025913 Ga0207695_10003410 Ga0207695_100034103 98
88 3300025918 Ga0207662_10221352 Ga0207662_102213522 98
89 3300025919 Ga0207657_10143681 Ga0207657_101436812 98
90 3300025923 Ga0207681_10102576 Ga0207681_101025763 98
91 3300025928 Ga0207700_10035912 Ga0207700_100359125 98
92 3300025928 Ga0207700_10099183 Ga0207700_100991832 98
93 3300025934 Ga0207686_10229323 Ga0207686_102293233 98
94 3300025941 Ga0207711_10402426 Ga0207711_104024262 98
95 3300025960 Ga0207651_10767805 Ga0207651_107678052 98
96 3300026035 Ga0207703_10792974 Ga0207703_107929743 98
97 3300026088 Ga0207641_11649299 Ga0207641_116492991 98
98 3300026089 Ga0207648_10967756 Ga0207648_109677562 98
99 3300028800 Ga0265338_10151881 Ga0265338_101518812 98
100 3300031090 Ga0265760_10012962 Ga0265760_100129623 98
101 3300031241 Ga0265325_10015004 Ga0265325_100150044 98
102 3300031548 Ga0307408_101277907 Ga0307408_1012779072 98
103 3300031711 Ga0265314_10341235 Ga0265314_103412351 98
104 3300031911 Ga0307412_11188390 Ga0307412_111883902 98
105 3300032005 Ga0307411_11789787 Ga0307411_117897872 98
106 3300035092 Ga0373952_0235752 Ga0373952_0235752_110_412 98
107 3300035691 Ga0373931_0162178 Ga0373931_0162178_167_469 98
108 3300035692 Ga0373935_0104391 Ga0373935_0104391_1124_1426 98
109 3300035695 Ga0373927_0003228 Ga0373927_0003228_7421_7723 98
110 3300035725 Ga0373947_0001620 Ga0373947_0001620_10459_10761 98
111 3300035725 Ga0373947_0536645 Ga0373947_0536645_290_589 98
112 3300036401 Ga0373937_0677260 Ga0373937_0677260_421_720 98
113 3300037068 Ga0373925_0000062 Ga0373925_0000062_16381_16683 98
114 3300037068 Ga0373925_1068743 Ga0373925_1068743_85_384 98
115 3300037068 Ga0373925_1694603 Ga0373925_1694603_60_359 98
116 3300037853 Ga0436364_0366372 Ga0436364_0366372_191658_191957 98
117 3300037853 Ga0436364_0820647 Ga0436364_0820647_178_477 98
118 3300039438 Ga0436360_0484194 Ga0436360_0484194_59_358 98
119 3300042876 Ga0451577_1504784 Ga0451577_1504784_110_412 98
120 3300045836 Ga0466958_0094481 Ga0466958_0094481_1256_1576 98
121 3300045976 Ga0466967_2007354 Ga0466967_2007354_23_343 98
122 3300046472 Ga0495580_0311911 Ga0495580_0311911_39_338 98
123 3300046543 Ga0495645_0550374 Ga0495645_0550374_217_516 98
124 3300046690 Ga0495624_0407261 Ga0495624_0407261_143_445 98
125 3300048088 Ga0495602_0960154 Ga0495602_0960154_183_482 98
126 3300048912 Ga0496109_1356114 Ga0496109_1356114_280_603 98
127 3300048918 Ga0496115_0008876 Ga0496115_0008876_3919_4218 98
128 3300050507 nmdc:mga05p37_451614_c2 nmdc:mga05p37_451614_c2_465_767 98
129 3300050507 nmdc:mga05p37_931645_c1 nmdc:mga05p37_931645_c1_549_848 98
130 3300050508 nmdc:mga09592_907116_c1 nmdc:mga09592_907116_c1_96_395 98
131 3300050510 nmdc:mga06r32_70648_c1 nmdc:mga06r32_70648_c1_868_1167 98
132 3300005329 Ga0070683_100042363 Ga0070683_1000423635 99
133 3300005338 Ga0068868_100064452 Ga0068868_1000644524 99
134 3300005366 Ga0070659_100494925 Ga0070659_1004949252 99
135 3300005435 Ga0070714_100703976 Ga0070714_1007039761 99
136 3300005439 Ga0070711_100613072 Ga0070711_1006130722 99
137 3300005458 Ga0070681_10839885 Ga0070681_108398852 99
138 3300005535 Ga0070684_100047418 Ga0070684_1000474183 99
139 3300005539 Ga0068853_100377334 Ga0068853_1003773343 99
140 3300005547 Ga0070693_100047867 Ga0070693_1000478674 99
141 3300005547 Ga0070693_100087797 Ga0070693_1000877971 99
142 3300005577 Ga0068857_100205135 Ga0068857_1002051353 99
143 3300005578 Ga0068854_100535413 Ga0068854_1005354132 99
144 3300005614 Ga0068856_101441403 Ga0068856_1014414032 99
145 3300005616 Ga0068852_100105396 Ga0068852_1001053964 99
146 3300005834 Ga0068851_10057522 Ga0068851_100575222 99
147 3300006028 Ga0070717_10180913 Ga0070717_101809132 99
148 3300009098 Ga0105245_10103307 Ga0105245_101033074 99
149 3300009174 Ga0105241_10085329 Ga0105241_100853292 99
150 3300009545 Ga0105237_11245573 Ga0105237_112455731 99
151 3300009551 Ga0105238_10085096 Ga0105238_100850963 99
152 3300010375 Ga0105239_10142743 Ga0105239_101427433 99
153 3300013105 Ga0157369_10172382 Ga0157369_101723822 99
154 3300013296 Ga0157374_10069349 Ga0157374_100693493 99
155 3300025321 Ga0207656_10280115 Ga0207656_102801151 99
156 3300025911 Ga0207654_11270536 Ga0207654_112705361 99
157 3300025912 Ga0207707_10530583 Ga0207707_105305832 99
158 3300025916 Ga0207663_10485383 Ga0207663_104853832 99
159 3300025924 Ga0207694_10130094 Ga0207694_101300942 99
160 3300025929 Ga0207664_10165526 Ga0207664_101655262 99
161 3300025932 Ga0207690_10306573 Ga0207690_103065732 99
162 3300026041 Ga0207639_10326347 Ga0207639_103263473 99
163 3300026078 Ga0207702_10690122 Ga0207702_106901222 99
164 3300026116 Ga0207674_10076258 Ga0207674_100762583 99
165 3300026142 Ga0207698_10012877 Ga0207698_100128773 99
166 3300031247 Ga0265340_10025336 Ga0265340_100253364 99
167 3300035083 Ga0373926_0007861 Ga0373926_0007861_1953_2261 99
168 3300035089 Ga0373944_0003881 Ga0373944_0003881_2792_3100 99
169 3300035111 Ga0373923_0059768 Ga0373923_0059768_69_377 99
170 3300035113 Ga0373936_0033477 Ga0373936_0033477_141_449 99
171 3300035116 Ga0373945_0002001 Ga0373945_0002001_5340_5648 99
172 3300035120 Ga0373957_0092546 Ga0373957_0092546_133_441 99
173 3300035170 Ga0373943_0034095 Ga0373943_0034095_1910_2218 99
174 3300035171 Ga0373946_0036715 Ga0373946_0036715_533_841 99
175 3300035410 Ga0373924_0000053 Ga0373924_0000053_15014_15322 99
176 3300035410 Ga0373924_0452903 Ga0373924_0452903_249_557 99
177 3300035692 Ga0373935_0018019 Ga0373935_0018019_309_617 99
178 3300035692 Ga0373935_0089833 Ga0373935_0089833_1398_1706 99
179 3300035695 Ga0373927_0019756 Ga0373927_0019756_2032_2340 99
180 3300035695 Ga0373927_0097948 Ga0373927_0097948_1526_1834 99
181 3300035725 Ga0373947_0086005 Ga0373947_0086005_399_707 99
182 3300035725 Ga0373947_0399738 Ga0373947_0399738_81_389 99
183 3300037068 Ga0373925_0040771 Ga0373925_0040771_1917_2225 99
184 3300037068 Ga0373925_0859792 Ga0373925_0859792_214_522 99
185 3300037466 Ga0395898_1059850 Ga0395898_1059850_101_415 99
186 3300045051 Ga0451576_1059445 Ga0451576_1059445_504_830 99
187 3300046472 Ga0495580_0152210 Ga0495580_0152210_1160_1468 99
188 3300046473 Ga0495582_0124583 Ga0495582_0124583_19_327 99
189 3300046475 Ga0495639_0074825 Ga0495639_0074825_317_625 99
190 3300046517 Ga0495630_0072783 Ga0495630_0072783_732_1040 99
191 3300046526 Ga0495666_0314726 Ga0495666_0314726_52_360 99
192 3300046531 Ga0495665_0011073 Ga0495665_0011073_1376_1684 99
193 3300046559 Ga0495667_0096934 Ga0495667_0096934_538_846 99
194 3300046663 Ga0495635_0110883 Ga0495635_0110883_832_1140 99
195 3300046683 Ga0495658_0709986 Ga0495658_0709986_98_406 99
196 3300046690 Ga0495624_0871983 Ga0495624_0871983_104_412 99
197 3300047315 Ga0495581_0035153 Ga0495581_0035153_1586_1894 99
198 3300047319 Ga0495674_0562236 Ga0495674_0562236_483_791 99
199 3300047321 Ga0495676_0560646 Ga0495676_0560646_282_590 99
200 3300047471 Ga0495684_0153853 Ga0495684_0153853_464_772 99
201 3300047673 Ga0495593_0034456 Ga0495593_0034456_274_582 99
202 3300048913 Ga0496110_1196070 Ga0496110_1196070_119_427 99
203 3300048914 Ga0496111_0094361 Ga0496111_0094361_166_474 99
204 3300048915 Ga0496112_0002411 Ga0496112_0002411_12463_12771 99
205 3300048916 Ga0496113_0114290 Ga0496113_0114290_1768_2076 99
206 3300053085 Ga0495619_0360047 Ga0495619_0360047_157_465 99
207 3300005293 Ga0065715_10539775 Ga0065715_105397752 100
208 3300005336 Ga0070680_100048910 Ga0070680_1000489103 100
209 3300005336 Ga0070680_100547207 Ga0070680_1005472071 100
210 3300005340 Ga0070689_101327222 Ga0070689_1013272221 100
211 3300005434 Ga0070709_10057746 Ga0070709_100577463 100
212 3300005434 Ga0070709_10868749 Ga0070709_108687491 100
213 3300005435 Ga0070714_100381158 Ga0070714_1003811582 100
214 3300005436 Ga0070713_100024223 Ga0070713_1000242232 100
215 3300005436 Ga0070713_100155444 Ga0070713_1001554443 100
216 3300005436 Ga0070713_101055826 Ga0070713_1010558262 100
217 3300005436 Ga0070713_101136897 Ga0070713_1011368971 100
218 3300005437 Ga0070710_10501566 Ga0070710_105015662 100
219 3300005439 Ga0070711_100010055 Ga0070711_1000100553 100
220 3300005439 Ga0070711_100152450 Ga0070711_1001524503 100
221 3300005439 Ga0070711_100311965 Ga0070711_1003119652 100
222 3300005439 Ga0070711_101555948 Ga0070711_1015559481 100
223 3300005439 Ga0070711_102023957 Ga0070711_1020239571 100
224 3300005445 Ga0070708_100010439 Ga0070708_1000104395 100
225 3300005445 Ga0070708_100018012 Ga0070708_1000180125 100
226 3300005445 Ga0070708_100026648 Ga0070708_1000266485 100
227 3300005445 Ga0070708_101756391 Ga0070708_1017563911 100
228 3300005445 Ga0070708_102067783 Ga0070708_1020677831 100
229 3300005459 Ga0068867_101061238 Ga0068867_1010612381 100
230 3300005467 Ga0070706_100182463 Ga0070706_1001824632 100
231 3300005467 Ga0070706_101612310 Ga0070706_1016123102 100
232 3300005468 Ga0070707_100115883 Ga0070707_1001158833 100
233 3300005468 Ga0070707_100142222 Ga0070707_1001422221 100
234 3300005468 Ga0070707_101160364 Ga0070707_1011603641 100
235 3300005471 Ga0070698_100014941 Ga0070698_1000149415 100
236 3300005518 Ga0070699_100100573 Ga0070699_1001005734 100
237 3300005536 Ga0070697_100009939 Ga0070697_1000099396 100
238 3300005536 Ga0070697_100026380 Ga0070697_1000263802 100
239 3300005536 Ga0070697_100432809 Ga0070697_1004328091 100
240 3300005539 Ga0068853_101242692 Ga0068853_1012426921 100
241 3300005547 Ga0070693_101278899 Ga0070693_1012788991 100
242 3300005548 Ga0070665_100002225 Ga0070665_1000022252 100
243 3300005564 Ga0070664_101031202 Ga0070664_1010312022 100
244 3300005617 Ga0068859_101210726 Ga0068859_1012107262 100
245 3300005618 Ga0068864_100991431 Ga0068864_1009914311 100
246 3300005841 Ga0068863_100023515 Ga0068863_1000235152 100
247 3300005843 Ga0068860_100313640 Ga0068860_1003136401 100
248 3300006028 Ga0070717_10039650 Ga0070717_100396503 100
249 3300006028 Ga0070717_10104323 Ga0070717_101043232 100
250 3300006028 Ga0070717_10894159 Ga0070717_108941592 100
251 3300006163 Ga0070715_10146134 Ga0070715_101461342 100
252 3300006173 Ga0070716_100004266 Ga0070716_1000042666 100
253 3300006173 Ga0070716_100022350 Ga0070716_1000223503 100
254 3300006173 Ga0070716_100058088 Ga0070716_1000580887 100
255 3300006173 Ga0070716_100149584 Ga0070716_1001495842 100
256 3300006175 Ga0070712_100013458 Ga0070712_1000134584 100
257 3300006175 Ga0070712_100034330 Ga0070712_1000343302 100
258 3300006175 Ga0070712_100095655 Ga0070712_1000956552 100
259 3300006175 Ga0070712_100111561 Ga0070712_1001115612 100
260 3300006852 Ga0075433_10175498 Ga0075433_101754981 100
261 3300006871 Ga0075434_100031292 Ga0075434_1000312922 100
262 3300006871 Ga0075434_100039702 Ga0075434_1000397024 100
263 3300006914 Ga0075436_100009463 Ga0075436_1000094636 100
264 3300006914 Ga0075436_100474457 Ga0075436_1004744572 100
265 3300006914 Ga0075436_100642338 Ga0075436_1006423382 100
266 3300006931 Ga0097620_101210536 Ga0097620_1012105362 100
267 3300007076 Ga0075435_100037936 Ga0075435_1000379364 100
268 3300007076 Ga0075435_100071662 Ga0075435_1000716622 100
269 3300007076 Ga0075435_100079446 Ga0075435_1000794463 100
270 3300007788 Ga0099795_10060202 Ga0099795_100602021 100
271 3300007788 Ga0099795_10332389 Ga0099795_103323892 100
272 3300009093 Ga0105240_10378123 Ga0105240_103781233 100
273 3300009093 Ga0105240_11082947 Ga0105240_110829472 100
274 3300009093 Ga0105240_11415199 Ga0105240_114151991 100
275 3300009093 Ga0105240_12751834 Ga0105240_127518341 100
276 3300009101 Ga0105247_11390721 Ga0105247_113907211 100
277 3300009176 Ga0105242_10050839 Ga0105242_100508394 100
278 3300009177 Ga0105248_10804305 Ga0105248_108043051 100
279 3300009177 Ga0105248_11090457 Ga0105248_110904571 100
280 3300009551 Ga0105238_10560410 Ga0105238_105604102 100
281 3300009553 Ga0105249_11192143 Ga0105249_111921432 100
282 3300010159 Ga0099796_10023954 Ga0099796_100239541 100
283 3300010159 Ga0099796_10565529 Ga0099796_105655291 100
284 3300013105 Ga0157369_10280617 Ga0157369_102806172 100
285 3300013296 Ga0157374_10413759 Ga0157374_104137592 100
286 3300013297 Ga0157378_10082401 Ga0157378_100824012 100
287 3300013297 Ga0157378_10372030 Ga0157378_103720302 100
288 3300013307 Ga0157372_10362416 Ga0157372_103624163 100
289 3300013307 Ga0157372_12444637 Ga0157372_124446371 100
290 3300013308 Ga0157375_12865206 Ga0157375_128652061 100
291 3300014325 Ga0163163_10889247 Ga0163163_108892471 100
292 3300014497 Ga0182008_10323550 Ga0182008_103235502 100
293 3300014968 Ga0157379_10666622 Ga0157379_106666222 100
294 3300022732 Ga0224569_109770 Ga0224569_1097701 100
295 3300025905 Ga0207685_10097141 Ga0207685_100971412 100
296 3300025906 Ga0207699_10025322 Ga0207699_100253225 100
297 3300025906 Ga0207699_10044953 Ga0207699_100449532 100
298 3300025906 Ga0207699_10694215 Ga0207699_106942151 100
299 3300025910 Ga0207684_10044403 Ga0207684_100444033 100
300 3300025910 Ga0207684_10173831 Ga0207684_101738312 100
301 3300025910 Ga0207684_11350735 Ga0207684_113507351 100
302 3300025912 Ga0207707_10956987 Ga0207707_109569872 100
303 3300025913 Ga0207695_10482173 Ga0207695_104821732 100
304 3300025915 Ga0207693_10021795 Ga0207693_100217954 100
305 3300025915 Ga0207693_10059628 Ga0207693_100596282 100
306 3300025915 Ga0207693_10070386 Ga0207693_100703862 100
307 3300025915 Ga0207693_10099599 Ga0207693_100995992 100
308 3300025916 Ga0207663_10028826 Ga0207663_100288262 100
309 3300025916 Ga0207663_10105099 Ga0207663_101050992 100
310 3300025922 Ga0207646_10001819 Ga0207646_1000181922 100
311 3300025922 Ga0207646_10300639 Ga0207646_103006391 100
312 3300025922 Ga0207646_10736715 Ga0207646_107367152 100
313 3300025922 Ga0207646_10956516 Ga0207646_109565161 100
314 3300025928 Ga0207700_10008891 Ga0207700_100088913 100
315 3300025928 Ga0207700_10010609 Ga0207700_100106097 100
316 3300025928 Ga0207700_10311813 Ga0207700_103118131 100
317 3300025929 Ga0207664_11234856 Ga0207664_112348561 100
318 3300025931 Ga0207644_10813355 Ga0207644_108133552 100
319 3300025934 Ga0207686_10159624 Ga0207686_101596242 100
320 3300025939 Ga0207665_10003634 Ga0207665_100036349 100
321 3300025939 Ga0207665_10019078 Ga0207665_100190785 100
322 3300025939 Ga0207665_10066428 Ga0207665_100664287 100
323 3300025941 Ga0207711_10568199 Ga0207711_105681991 100
324 3300025941 Ga0207711_10949855 Ga0207711_109498551 100
325 3300025949 Ga0207667_12241982 Ga0207667_122419821 100
326 3300026035 Ga0207703_10148043 Ga0207703_101480433 100
327 3300026041 Ga0207639_11052580 Ga0207639_110525801 100
328 3300026088 Ga0207641_10010947 Ga0207641_100109473 100
329 3300027512 Ga0209179_1115436 Ga0209179_11154361 100
330 3300028017 Ga0265356_1012055 Ga0265356_10120552 100
331 3300028379 Ga0268266_10000144 Ga0268266_1000014430 100
332 3300028381 Ga0268264_10165294 Ga0268264_101652942 100
333 3300030760 Ga0265762_1002578 Ga0265762_10025781 100
334 3300030879 Ga0265765_1003937 Ga0265765_10039373 100
335 3300031090 Ga0265760_10006526 Ga0265760_100065262 100
336 3300031090 Ga0265760_10261509 Ga0265760_102615091 100
337 3300031249 Ga0265339_10018791 Ga0265339_100187914 100
338 3300031548 Ga0307408_100004979 Ga0307408_1000049797 100
339 3300031548 Ga0307408_101399964 Ga0307408_1013999641 100
340 3300031731 Ga0307405_10052763 Ga0307405_100527632 100
341 3300031731 Ga0307405_10285401 Ga0307405_102854013 100
342 3300031824 Ga0307413_10166830 Ga0307413_101668302 100
343 3300031852 Ga0307410_10011426 Ga0307410_100114262 100
344 3300031852 Ga0307410_10027337 Ga0307410_100273374 100
345 3300031901 Ga0307406_10111427 Ga0307406_101114272 100
346 3300032002 Ga0307416_100185410 Ga0307416_1001854102 100
347 3300032002 Ga0307416_100304913 Ga0307416_1003049134 100
348 3300032004 Ga0307414_11010145 Ga0307414_110101452 100
349 3300032005 Ga0307411_10105769 Ga0307411_101057692 100
350 3300032005 Ga0307411_11713352 Ga0307411_117133521 100
351 3300035691 Ga0373931_0023816 Ga0373931_0023816_836_1138 100
352 3300035725 Ga0373947_0853376 Ga0373947_0853376_282_611 100
353 3300036401 Ga0373937_0000340 Ga0373937_0000340_32802_33128 100
354 3300037068 Ga0373925_1316242 Ga0373925_1316242_180_509 100
355 3300038443 Ga0395901_1095399 Ga0395901_1095399_122_424 100
356 3300039438 Ga0436360_0674499 Ga0436360_0674499_28_342 100
357 3300044706 Ga0466964_0130801 Ga0466964_0130801_354_683 100
358 3300044735 Ga0466968_0113603 Ga0466968_0113603_259_582 100
359 3300045976 Ga0466967_0188296 Ga0466967_0188296_723_1052 100
360 3300046455 Ga0495603_0143608 Ga0495603_0143608_566_892 100
361 3300046462 Ga0495651_0228353 Ga0495651_0228353_257_583 100
362 3300046472 Ga0495580_0063696 Ga0495580_0063696_1706_2032 100
363 3300046472 Ga0495580_0295978 Ga0495580_0295978_735_1037 100
364 3300046474 Ga0495605_0113373 Ga0495605_0113373_663_989 100
365 3300046499 Ga0495594_0018806 Ga0495594_0018806_2418_2744 100
366 3300046528 Ga0495642_0376815 Ga0495642_0376815_168_494 100
367 3300046531 Ga0495665_0368889 Ga0495665_0368889_192_518 100
368 3300046535 Ga0495586_0789799 Ga0495586_0789799_119_445 100
369 3300046663 Ga0495635_0217243 Ga0495635_0217243_421_747 100
370 3300046663 Ga0495635_0678794 Ga0495635_0678794_20_346 100
371 3300046663 Ga0495635_1050374 Ga0495635_1050374_58_384 100
372 3300046675 Ga0495657_0063879 Ga0495657_0063879_915_1241 100
373 3300046679 Ga0495623_0064598 Ga0495623_0064598_303_629 100
374 3300046684 Ga0495669_0036573 Ga0495669_0036573_813_1139 100
375 3300046684 Ga0495669_0170481 Ga0495669_0170481_255_581 100
376 3300046689 Ga0495613_0226310 Ga0495613_0226310_690_1016 100
377 3300046809 Ga0495600_0094396 Ga0495600_0094396_38_364 100
378 3300047317 Ga0495604_0217691 Ga0495604_0217691_127_453 100
379 3300047318 Ga0495636_0290470 Ga0495636_0290470_13_339 100
380 3300047323 Ga0495683_0165790 Ga0495683_0165790_637_963 100
381 3300047445 Ga0495677_0065074 Ga0495677_0065074_848_1174 100
382 3300048907 Ga0496104_0020078 Ga0496104_0020078_3883_4212 100
383 3300048909 Ga0496106_1218734 Ga0496106_1218734_85_387 100
384 3300048912 Ga0496109_1345553 Ga0496109_1345553_252_581 100
385 3300048915 Ga0496112_0002331 Ga0496112_0002331_4186_4515 100
386 3300048916 Ga0496113_0508869 Ga0496113_0508869_264_590 100
387 3300048916 Ga0496113_0621808 Ga0496113_0621808_408_737 100
388 3300049761 Ga0501264_036499 Ga0501264_036499_88_417 100
389 3300049765 Ga0501268_062337 Ga0501268_062337_73_402 100
390 3300049765 Ga0501268_133751 Ga0501268_133751_81_410 100
391 3300050512 nmdc:mga0n895_12261_c1 nmdc:mga0n895_12261_c1_4053_4355 100
392 3300050512 nmdc:mga0n895_1435516_c1 nmdc:mga0n895_1435516_c1_50_352 100
393 3300050512 nmdc:mga0n895_157117_c1 nmdc:mga0n895_157117_c1_1755_2057 100
394 3300050513 nmdc:mga0rr50_36304_c1 nmdc:mga0rr50_36304_c1_695_997 100
395 3300050513 nmdc:mga0rr50_36394_c1 nmdc:mga0rr50_36394_c1_620_922 100
396 3300050514 nmdc:mga08x19_222950_c1 nmdc:mga08x19_222950_c1_811_1113 100
397 3300050514 nmdc:mga08x19_681924_c1 nmdc:mga08x19_681924_c1_357_659 100
398 3300050514 nmdc:mga08x19_781844_c1 nmdc:mga08x19_781844_c1_62_364 100
399 3300050514 nmdc:mga08x19_9103_c1 nmdc:mga08x19_9103_c1_1101_1403 100
400 3300059512 Ga0587092_122968 Ga0587092_122968_119_448 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

36

118

0.88

Feature Viewer

pLDDT pTM Quality
79.4 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map