F434680

General Info

Members Datasets Scaffolds Average Seq Length
400 210 800 161

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_1642161|Ga0496112_1642161_26_526
Length 166
Sequence MMRLMIRLLPFPVVSASVLVVWLLLNQSLSLGQILLGAAIALVGGWGLARLDVPKAHPHRLGAIFHLAAIVLVDIVRSNIAVARIILGLEERRWVSGFVEIPLELRDPYGLATLACIITATPGTLWVAFDATSGTLTIHVLDLLDETQWIRTIKGRYERRLLEIFE

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
209 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
210 2848858292 Azospirillum brasilense Az39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 7.5
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_1642161 3300048915 Bacteria 556
2 rootL2_10338223 3300003322 Bacteria 1700
3 Ga0070683_100014927 3300005329 Bacteria 6809
4 Ga0070683_100164491 3300005329 Bacteria 2105
5 Ga0070683_100176216 3300005329 Bacteria 2030
6 Ga0070683_100180822 3300005329 Bacteria 2002
7 Ga0070683_100207451 3300005329 Bacteria 1861
8 Ga0070690_100124493 3300005330 Bacteria 1734
9 Ga0068869_100014018 3300005334 Bacteria 5348
10 Ga0070680_100020613 3300005336 Bacteria 5235
11 Ga0070680_100061943 3300005336 Bacteria 3063
12 Ga0070680_100063774 3300005336 Bacteria 3019
13 Ga0070680_101262105 3300005336 Unclassified 639
14 Ga0070682_100089566 3300005337 Bacteria 2010
15 Ga0070682_100623547 3300005337 Unclassified 855
16 Ga0068868_100491943 3300005338 Bacteria 1073
17 Ga0070691_10015036 3300005341 Bacteria 3554
18 Ga0070691_10152325 3300005341 Bacteria 1186
19 Ga0070687_100100854 3300005343 Bacteria 1616
20 Ga0070687_100224480 3300005343 Bacteria 1152
21 Ga0070687_100422112 3300005343 Bacteria 880
22 Ga0070661_100010269 3300005344 Bacteria 6506
23 Ga0070661_100811387 3300005344 Bacteria 768
24 Ga0070692_10022193 3300005345 Bacteria 3098
25 Ga0070668_100076893 3300005347 Bacteria 2608
26 Ga0070668_100297727 3300005347 Bacteria 1352
27 Ga0070668_100846059 3300005347 Unclassified 815
28 Ga0070669_100089827 3300005353 Bacteria 2302
29 Ga0070671_100359625 3300005355 Bacteria 1243
30 Ga0070674_100375882 3300005356 Bacteria 1155
31 Ga0070659_100028608 3300005366 Bacteria 4306
32 Ga0070659_100127702 3300005366 Bacteria 2063
33 Ga0070667_100101024 3300005367 Bacteria 2491
34 Ga0070703_10019779 3300005406 Bacteria 1954
35 Ga0070705_100000901 3300005440 Bacteria 16586
36 Ga0070705_100124782 3300005440 Bacteria 1669
37 Ga0070700_100001924 3300005441 Bacteria 10504
38 Ga0070694_100001405 3300005444 Bacteria 14089
39 Ga0070708_100016481 3300005445 Bacteria 6134
40 Ga0070663_100038744 3300005455 Bacteria 3326
41 Ga0070663_100065164 3300005455 Bacteria 2636
42 Ga0070663_100198443 3300005455 Bacteria 1565
43 Ga0070663_100260723 3300005455 Bacteria 1375
44 Ga0070678_100054493 3300005456 Bacteria 2914
45 Ga0070678_100078226 3300005456 Bacteria 2498
46 Ga0070678_100574215 3300005456 Bacteria 1004
47 Ga0070662_100136753 3300005457 Bacteria 1895
48 Ga0070681_10060278 3300005458 Bacteria 3772
49 Ga0070681_10107835 3300005458 Bacteria 2725
50 Ga0070681_10161077 3300005458 Bacteria 2168
51 Ga0070681_10174999 3300005458 Bacteria 2068
52 Ga0070681_10259660 3300005458 Bacteria 1649
53 Ga0070681_10284077 3300005458 Bacteria 1565
54 Ga0070681_10303823 3300005458 Bacteria 1505
55 Ga0070681_10741145 3300005458 Bacteria 899
56 Ga0068867_100072516 3300005459 Bacteria 2578
57 Ga0070706_100029463 3300005467 Bacteria 5057
58 Ga0070698_100017908 3300005471 Bacteria 7463
59 Ga0070699_100015194 3300005518 Bacteria 6615
60 Ga0070679_100204142 3300005530 Bacteria 1941
61 Ga0070679_100482859 3300005530 Bacteria 1183
62 Ga0070679_100764175 3300005530 Bacteria 909
63 Ga0070679_100918268 3300005530 Unclassified 819
64 Ga0070684_100004031 3300005535 Bacteria 11116
65 Ga0070684_100602167 3300005535 Bacteria 1022
66 Ga0068853_100570951 3300005539 Bacteria 1073
67 Ga0070672_100098034 3300005543 Bacteria 2374
68 Ga0070672_100152234 3300005543 Bacteria 1914
69 Ga0070695_100000158 3300005545 Bacteria 32227
70 Ga0070696_100233450 3300005546 Bacteria 1385
71 Ga0070693_100155021 3300005547 Bacteria 1454
72 Ga0070665_100081964 3300005548 Bacteria 3231
73 Ga0070665_100724693 3300005548 Bacteria 1007
74 Ga0070704_100008256 3300005549 Bacteria 6233
75 Ga0068855_100408200 3300005563 Bacteria 1487
76 Ga0068855_100777803 3300005563 Unclassified 1019
77 Ga0070664_100118502 3300005564 Bacteria 2316
78 Ga0070664_100373844 3300005564 Bacteria 1300
79 Ga0070664_100881094 3300005564 Unclassified 839
80 Ga0068857_100009560 3300005577 Bacteria 8420
81 Ga0068857_100271570 3300005577 Bacteria 1558
82 Ga0068857_100654587 3300005577 Bacteria 996
83 Ga0068856_100612157 3300005614 Bacteria 1110
84 Ga0070702_100016066 3300005615 Bacteria 3834
85 Ga0068852_100392752 3300005616 Bacteria 1363
86 Ga0068852_101670021 3300005616 Unclassified 659
87 Ga0068859_100003502 3300005617 Bacteria 15988
88 Ga0068859_100194379 3300005617 Bacteria 2113
89 Ga0068864_100025178 3300005618 Bacteria 5009
90 Ga0068864_100299911 3300005618 Bacteria 1504
91 Ga0068864_101206950 3300005618 Bacteria 755
92 Ga0068861_100023390 3300005719 Bacteria 4456
93 Ga0068861_100450526 3300005719 Bacteria 1153
94 Ga0068870_10159334 3300005840 Bacteria 1337
95 Ga0068863_100107338 3300005841 Bacteria 2657
96 Ga0068863_100250601 3300005841 Bacteria 1710
97 Ga0068860_100001841 3300005843 Bacteria 22590
98 Ga0068860_100080379 3300005843 Bacteria 3100
99 Ga0068862_100002731 3300005844 Bacteria 15492
100 Ga0068862_100017501 3300005844 Bacteria 5970
101 Ga0068862_100296142 3300005844 Bacteria 1487
102 Ga0075365_10076577 3300006038 Bacteria 2259
103 Ga0075368_10103147 3300006042 Bacteria 1173
104 Ga0075364_10030113 3300006051 Unclassified 3483
105 Ga0075362_10045679 3300006177 Unclassified 1946
106 Ga0075367_10098355 3300006178 Unclassified 1786
107 Ga0075366_10021454 3300006195 Bacteria 3753
108 Ga0097621_100565015 3300006237 Bacteria 1037
109 Ga0075370_10060801 3300006353 Bacteria 2152
110 Ga0068871_101124101 3300006358 Bacteria 735
111 Ga0075428_100251939 3300006844 Bacteria 1903
112 Ga0075431_100470881 3300006847 Bacteria 1250
113 Ga0097620_100003500 3300006931 Bacteria 15988
114 Ga0097620_100194396 3300006931 Bacteria 2113
115 Ga0105251_10129128 3300009011 Bacteria 1146
116 Ga0105240_10159100 3300009093 Bacteria 2684
117 Ga0105240_10239529 3300009093 Bacteria 2104
118 Ga0105240_10553123 3300009093 Bacteria 1273
119 Ga0105245_10067879 3300009098 Bacteria 3230
120 Ga0105243_10056569 3300009148 Bacteria 3120
121 Ga0105243_10057408 3300009148 Bacteria 3099
122 Ga0105243_11417754 3300009148 Bacteria 716
123 Ga0105242_10205554 3300009176 Bacteria 1751
124 Ga0105248_10555022 3300009177 Bacteria 1296
125 Ga0105237_10130058 3300009545 Bacteria 2512
126 Ga0105238_10317910 3300009551 Bacteria 1542
127 Ga0105238_11030473 3300009551 Bacteria 844
128 Ga0105238_11372983 3300009551 Bacteria 733
129 Ga0105249_10046892 3300009553 Bacteria 3935
130 Ga0105249_10921608 3300009553 Bacteria 941
131 Ga0105249_11736288 3300009553 Bacteria 697
132 Ga0105239_10053150 3300010375 Bacteria 4444
133 Ga0105239_10346368 3300010375 Bacteria 1677
134 Ga0105239_11180782 3300010375 Unclassified 882
135 Ga0105246_10012864 3300011119 Bacteria 5234
136 Ga0105246_10040416 3300011119 Bacteria 3147
137 Ga0105246_10162168 3300011119 Bacteria 1704
138 Ga0105246_10883316 3300011119 Bacteria 800
139 Ga0105246_11231248 3300011119 Bacteria 690
140 Ga0157373_10285492 3300013100 Bacteria 1170
141 Ga0157370_10015905 3300013104 Bacteria 7634
142 Ga0157370_10417584 3300013104 Bacteria 1234
143 Ga0157370_10463279 3300013104 Unclassified 1165
144 Ga0157370_11433915 3300013104 Bacteria 621
145 Ga0157369_10008159 3300013105 Bacteria 12014
146 Ga0157369_10148213 3300013105 Bacteria 2481
147 Ga0157369_10484025 3300013105 Bacteria 1281
148 Ga0157369_10586600 3300013105 Bacteria 1151
149 Ga0157369_10900740 3300013105 Unclassified 907
150 Ga0157374_10716311 3300013296 Bacteria 1014
151 Ga0157378_10099522 3300013297 Bacteria 2653
152 Ga0157378_10595505 3300013297 Bacteria 1116
153 Ga0163162_10214861 3300013306 Bacteria 2053
154 Ga0163162_10528127 3300013306 Bacteria 1309
155 Ga0157372_10051543 3300013307 Bacteria 4581
156 Ga0157372_10215758 3300013307 Bacteria 2224
157 Ga0157372_12316102 3300013307 Unclassified 617
158 Ga0157375_10306008 3300013308 Unclassified 1753
159 Ga0163163_10044059 3300014325 Bacteria 4376
160 Ga0163163_10051486 3300014325 Bacteria 4060
161 Ga0157380_10035122 3300014326 Bacteria 3871
162 Ga0157380_10888827 3300014326 Bacteria 916
163 Ga0157379_11300073 3300014968 Unclassified 702
164 Ga0157376_10222379 3300014969 Bacteria 1749
165 Ga0206353_11258788 3300020082 Bacteria 882
166 Ga0207653_10102885 3300025885 Bacteria 1012
167 Ga0207688_10030603 3300025901 Bacteria 2969
168 Ga0207680_10418292 3300025903 Bacteria 949
169 Ga0207643_10015598 3300025908 Bacteria 4136
170 Ga0207643_10094685 3300025908 Bacteria 1745
171 Ga0207707_10061591 3300025912 Bacteria 3265
172 Ga0207707_10126494 3300025912 Bacteria 2235
173 Ga0207707_10137067 3300025912 Bacteria 2140
174 Ga0207707_10141199 3300025912 Bacteria 2106
175 Ga0207707_10284392 3300025912 Bacteria 1432
176 Ga0207695_10180820 3300025913 Bacteria 2029
177 Ga0207660_10015931 3300025917 Bacteria 4970
178 Ga0207660_10824227 3300025917 Unclassified 757
179 Ga0207649_10099608 3300025920 Bacteria 1920
180 Ga0207652_10664871 3300025921 Bacteria 931
181 Ga0207652_10837897 3300025921 Unclassified 815
182 Ga0207681_10055802 3300025923 Bacteria 2693
183 Ga0207694_10203407 3300025924 Bacteria 1611
184 Ga0207694_10343267 3300025924 Unclassified 1235
185 Ga0207687_10096947 3300025927 Bacteria 2162
186 Ga0207644_10535143 3300025931 Bacteria 969
187 Ga0207690_10112399 3300025932 Bacteria 1964
188 Ga0207706_10036082 3300025933 Bacteria 4393
189 Ga0207706_10150165 3300025933 Bacteria 2049
190 Ga0207706_10154749 3300025933 Bacteria 2017
191 Ga0207686_10543129 3300025934 Bacteria 908
192 Ga0207709_10097817 3300025935 Bacteria 1934
193 Ga0207669_10028127 3300025937 Bacteria 3089
194 Ga0207691_10068902 3300025940 Bacteria 3196
195 Ga0207691_10125677 3300025940 Bacteria 2270
196 Ga0207711_10133727 3300025941 Bacteria 2226
197 Ga0207711_10568357 3300025941 Bacteria 1058
198 Ga0207689_10089709 3300025942 Bacteria 2525
199 Ga0207661_10000186 3300025944 Bacteria 40168
200 Ga0207661_10168132 3300025944 Bacteria 1907
201 Ga0207661_10420400 3300025944 Unclassified 1214
202 Ga0207679_10167946 3300025945 Bacteria 1803
203 Ga0207679_10797717 3300025945 Bacteria 861
204 Ga0207667_10716459 3300025949 Bacteria 1002
205 Ga0207667_10763596 3300025949 Bacteria 965
206 Ga0207712_10023018 3300025961 Bacteria 4108
207 Ga0207712_10868713 3300025961 Bacteria 796
208 Ga0207668_10024309 3300025972 Bacteria 3908
209 Ga0207677_10127328 3300026023 Bacteria 1927
210 Ga0207677_10145170 3300026023 Bacteria 1822
211 Ga0207639_10024518 3300026041 Bacteria 4366
212 Ga0207678_10044918 3300026067 Bacteria 3821
213 Ga0207678_10183237 3300026067 Bacteria 1788
214 Ga0207678_10435184 3300026067 Bacteria 1139
215 Ga0207678_10609085 3300026067 Bacteria 958
216 Ga0207708_10001399 3300026075 Bacteria 18108
217 Ga0207708_10103918 3300026075 Bacteria 2201
218 Ga0207708_10255035 3300026075 Bacteria 1415
219 Ga0207702_10052860 3300026078 Bacteria 3439
220 Ga0207641_10131630 3300026088 Bacteria 2247
221 Ga0207641_10164075 3300026088 Bacteria 2022
222 Ga0207676_10003912 3300026095 Bacteria 10515
223 Ga0207676_10080910 3300026095 Bacteria 2638
224 Ga0207676_10661791 3300026095 Bacteria 1009
225 Ga0207674_10001143 3300026116 Bacteria 34428
226 Ga0207674_10242253 3300026116 Bacteria 1750
227 Ga0207674_11034362 3300026116 Bacteria 790
228 Ga0207675_100048221 3300026118 Bacteria 3977
229 Ga0207675_100135123 3300026118 Unclassified 2339
230 Ga0207683_10053612 3300026121 Bacteria 3537
231 Ga0207683_10168119 3300026121 Bacteria 1985
232 Ga0207698_10319495 3300026142 Bacteria 1453
233 Ga0207698_11788614 3300026142 Unclassified 630
234 Ga0209813_10013463 3300027866 Unclassified 2184
235 Ga0268266_10119099 3300028379 Bacteria 2348
236 Ga0268265_10000626 3300028380 Bacteria 35203
237 Ga0268265_10036784 3300028380 Bacteria 3588
238 Ga0268265_10235949 3300028380 Bacteria 1611
239 Ga0268264_10003320 3300028381 Bacteria 13903
240 Ga0307405_10119658 3300031731 Bacteria 1800
241 Ga0307413_10240172 3300031824 Bacteria 1337
242 Ga0307413_10325848 3300031824 Bacteria 1175
243 Ga0326468_10004035 3300031889 Bacteria 1269
244 Ga0307406_10007814 3300031901 Bacteria 5949
245 Ga0307407_10073940 3300031903 Bacteria 2038
246 Ga0307409_100027346 3300031995 Bacteria 4040
247 Ga0307416_100092630 3300032002 Bacteria 2600
248 Ga0307411_10141110 3300032005 Bacteria 1777
249 Ga0307415_100071786 3300032126 Bacteria 2436
250 Ga0307415_100632381 3300032126 Bacteria 957
251 Ga0373931_0296164 3300035691 Bacteria 998
252 Ga0395899_0735821 3300037312 Bacteria 615
253 Ga0395901_0339236 3300038443 Bacteria 1553
254 Ga0451800_0144451 3300041459 Unclassified 676
255 Ga0451807_0753102 3300041486 Unclassified 594
256 Ga0451853_2901402 3300041512 Bacteria 1043
257 Ga0451853_2966075 3300041512 Unclassified 584
258 Ga0439442_160298 3300042002 Unclassified 503
259 Ga0439459_0044804 3300042438 Bacteria 952
260 Ga0495603_0084753 3300046455 Bacteria 1856
261 Ga0495629_0217343 3300046459 Bacteria 1319
262 Ga0496100_0245892 3300048903 Bacteria 1322
263 Ga0496101_0109131 3300048904 Bacteria 2081
264 Ga0496101_0291161 3300048904 Bacteria 1278
265 Ga0496102_0009559 3300048905 Bacteria 8340
266 Ga0496102_0039333 3300048905 Bacteria 4273
267 Ga0496102_0251716 3300048905 Bacteria 1666
268 Ga0496103_0036330 3300048906 Bacteria 3017
269 Ga0496103_0161053 3300048906 Bacteria 1439
270 Ga0496104_0132289 3300048907 Bacteria 2396
271 Ga0496104_0425223 3300048907 Bacteria 1240
272 Ga0496105_0052219 3300048908 Bacteria 3376
273 Ga0496105_0121824 3300048908 Bacteria 2151
274 Ga0496105_0591261 3300048908 Bacteria 862
275 Ga0496105_1068102 3300048908 Unclassified 601
276 Ga0496106_0042073 3300048909 Bacteria 3425
277 Ga0496106_0255921 3300048909 Bacteria 1400
278 Ga0496107_0011296 3300048910 Bacteria 6217
279 Ga0496107_0067379 3300048910 Bacteria 2597
280 Ga0496108_0040335 3300048911 Bacteria 3891
281 Ga0496108_0622801 3300048911 Bacteria 939
282 Ga0496109_0039540 3300048912 Bacteria 4269
283 Ga0496109_0336834 3300048912 Bacteria 1425
284 Ga0496110_0017647 3300048913 Bacteria 5967
285 Ga0496112_0015803 3300048915 Bacteria 7052
286 Ga0496112_0016184 3300048915 Bacteria 6978
287 Ga0496113_0205497 3300048916 Bacteria 1566
288 Ga0496114_0040997 3300048917 Bacteria 3836
289 Ga0501031_0021962 3300049568 Bacteria 4158
290 Ga0501031_0121925 3300049568 Bacteria 1703
291 Ga0501031_0445807 3300049568 Unclassified 836
292 Ga0501032_0038787 3300049569 Bacteria 3242
293 Ga0501032_0082015 3300049569 Bacteria 2146
294 Ga0501032_0507393 3300049569 Bacteria 770
295 Ga0501033_0004294 3300049570 Bacteria 11449
296 Ga0501033_0029981 3300049570 Bacteria 4089
297 Ga0501033_0364429 3300049570 Bacteria 1011
298 Ga0501033_0755164 3300049570 Bacteria 659
299 Ga0501034_0073146 3300049571 Bacteria 3436
300 Ga0501034_0139192 3300049571 Bacteria 2407
301 Ga0501034_0720472 3300049571 Bacteria 895
302 Ga0501034_0750292 3300049571 Bacteria 871
303 Ga0501034_0774770 3300049571 Bacteria 853
304 Ga0501036_0039590 3300049572 Bacteria 3988
305 Ga0501036_0043106 3300049572 Bacteria 3821
306 Ga0501036_0043249 3300049572 Bacteria 3814
307 Ga0501037_0015413 3300049573 Bacteria 5624
308 Ga0501037_0029303 3300049573 Bacteria 4067
309 Ga0501037_0290347 3300049573 Bacteria 1138
310 Ga0501037_0421132 3300049573 Bacteria 914
311 Ga0501038_0023114 3300049574 Bacteria 5562
312 Ga0501038_0134187 3300049574 Bacteria 2030
313 Ga0501038_0695400 3300049574 Bacteria 762
314 Ga0501038_1096881 3300049574 Bacteria 581
315 Ga0501039_0312463 3300049575 Bacteria 1235
316 Ga0501040_0209868 3300049576 Bacteria 1384
317 Ga0501041_0009961 3300049577 Bacteria 5600
318 Ga0501041_0137308 3300049577 Bacteria 1524
319 Ga0501042_0016734 3300049578 Bacteria 5041
320 Ga0501043_0023357 3300049579 Bacteria 4850
321 Ga0501043_0083685 3300049579 Bacteria 2508
322 Ga0501043_0315158 3300049579 Bacteria 1193
323 Ga0501043_0662765 3300049579 Bacteria 765
324 Ga0501046_0006239 3300049580 Bacteria 10582
325 Ga0501046_0597111 3300049580 Unclassified 784
326 Ga0501047_0025205 3300049581 Bacteria 5714
327 Ga0501047_0038746 3300049581 Bacteria 4611
328 Ga0501047_0125964 3300049581 Bacteria 2442
329 Ga0501047_0192145 3300049581 Bacteria 1904
330 Ga0501047_0558962 3300049581 Bacteria 968
331 Ga0501048_0022535 3300049582 Bacteria 4605
332 Ga0501048_0250462 3300049582 Bacteria 1257
333 Ga0501068_0344050 3300049584 Bacteria 958
334 Ga0501069_0080090 3300049585 Bacteria 1839
335 Ga0501069_0105697 3300049585 Bacteria 1600
336 Ga0501070_0047983 3300049586 Bacteria 3548
337 Ga0501070_0227971 3300049586 Bacteria 1527
338 Ga0501070_0330595 3300049586 Bacteria 1239
339 Ga0501070_0341639 3300049586 Bacteria 1216
340 Ga0501071_0017556 3300049587 Bacteria 4938
341 Ga0501071_0083056 3300049587 Bacteria 2347
342 Ga0501071_0307763 3300049587 Bacteria 1202
343 Ga0501071_0410503 3300049587 Bacteria 1034
344 Ga0501072_0149597 3300049588 Bacteria 1861
345 Ga0501072_0366370 3300049588 Bacteria 1144
346 Ga0501072_0600302 3300049588 Bacteria 868
347 Ga0501073_0152782 3300049589 Bacteria 1600
348 Ga0501073_0201448 3300049589 Bacteria 1376
349 Ga0501074_0245665 3300049590 Bacteria 1273
350 Ga0501074_0314240 3300049590 Bacteria 1113
351 Ga0501075_0016047 3300049591 Bacteria 5388
352 Ga0501076_0013015 3300049592 Bacteria 6229
353 Ga0501076_0093445 3300049592 Bacteria 2420
354 Ga0501077_0067608 3300049593 Bacteria 2265
355 Ga0501077_0226749 3300049593 Bacteria 1188
356 Ga0501079_0226542 3300049741 Bacteria 1460
357 Ga0501080_0084392 3300049742 Bacteria 2951
358 Ga0501080_0110362 3300049742 Bacteria 2549
359 Ga0501081_0025471 3300049743 Bacteria 3979
360 Ga0501081_0252915 3300049743 Bacteria 1287
361 Ga0501081_0641650 3300049743 Bacteria 796
362 Ga0501083_0868237 3300049744 Bacteria 587
363 Ga0501035_0039585 3300049822 Bacteria 4265
364 Ga0501035_0054537 3300049822 Bacteria 3572
365 Ga0501035_0066879 3300049822 Bacteria 3189
366 Ga0501035_0230153 3300049822 Bacteria 1580
367 Ga0501035_0631049 3300049822 Unclassified 870
368 Ga0501044_0030874 3300049823 Bacteria 5643
369 Ga0501044_0145612 3300049823 Bacteria 2355
370 Ga0501044_0215578 3300049823 Bacteria 1872
371 Ga0501044_0444462 3300049823 Bacteria 1204
372 Ga0501044_0820185 3300049823 Unclassified 808
373 Ga0501044_0895694 3300049823 Bacteria 762
374 Ga0501044_0940940 3300049823 Unclassified 737
375 Ga0501045_0109607 3300049824 Bacteria 2046
376 Ga0501045_0164076 3300049824 Bacteria 1654
377 nmdc:mga03683_359453_c1 3300050489 Bacteria 690
378 nmdc:mga00v17_292984_c1 3300050491 Bacteria 1057
379 nmdc:mga0yw44_260214_c1 3300050492 Bacteria 1156
380 nmdc:mga0k408_197401_c1 3300050493 Bacteria 1201
381 nmdc:mga0k408_220406_c1 3300050493 Bacteria 1132
382 nmdc:mga0k408_346791_c1 3300050493 Bacteria 885
383 nmdc:mga06z11_110892_c1 3300050494 Bacteria 1519
384 nmdc:mga06z11_9784_c1 3300050494 Bacteria 4053
385 nmdc:mga04h51_10906_c1 3300050495 Unclassified 2509
386 nmdc:mga07m45_37513_c1 3300050496 Unclassified 2703
387 nmdc:mga07m45_579645_c1 3300050496 Bacteria 648
388 nmdc:mga0qj67_893337_c1 3300050509 Bacteria 700
389 nmdc:mga06r32_26679_c1 3300050510 Bacteria 5389
390 nmdc:mga06r32_848374_c1 3300050510 Unclassified 872
391 nmdc:mga0sz30_80476_c1 3300050516 Unclassified 1409
392 Ga0500641_0016481 3300053096 Bacteria 2752
393 Ga0501082_0049267 3300060353 Bacteria 3632
394 Ga0501082_0385566 3300060353 Bacteria 1223
395 Ga0501082_0571287 3300060353 Bacteria 989
396 Ga0530510_0002984 3300061734 Bacteria 11600
397 Ga0530510_0062570 3300061734 Bacteria 2694
398 2599104604 2597490356 Bacteria 7030811
399 2846955461 2846952575 Bacteria 6587527
400 2848862660 2848858292 Bacteria 7391279
401 Ga0496112_1642161
402 rootL2_10338223
403 Ga0070683_100014927
404 Ga0070683_100164491
405 Ga0070683_100176216
406 Ga0070683_100180822
407 Ga0070683_100207451
408 Ga0070690_100124493
409 Ga0068869_100014018
410 Ga0070680_100020613
411 Ga0070680_100061943
412 Ga0070680_100063774
413 Ga0070680_101262105
414 Ga0070682_100089566
415 Ga0070682_100623547
416 Ga0068868_100491943
417 Ga0070691_10015036
418 Ga0070691_10152325
419 Ga0070687_100100854
420 Ga0070687_100224480
421 Ga0070687_100422112
422 Ga0070661_100010269
423 Ga0070661_100811387
424 Ga0070692_10022193
425 Ga0070668_100076893
426 Ga0070668_100297727
427 Ga0070668_100846059
428 Ga0070669_100089827
429 Ga0070671_100359625
430 Ga0070674_100375882
431 Ga0070659_100028608
432 Ga0070659_100127702
433 Ga0070667_100101024
434 Ga0070703_10019779
435 Ga0070705_100000901
436 Ga0070705_100124782
437 Ga0070700_100001924
438 Ga0070694_100001405
439 Ga0070708_100016481
440 Ga0070663_100038744
441 Ga0070663_100065164
442 Ga0070663_100198443
443 Ga0070663_100260723
444 Ga0070678_100054493
445 Ga0070678_100078226
446 Ga0070678_100574215
447 Ga0070662_100136753
448 Ga0070681_10060278
449 Ga0070681_10107835
450 Ga0070681_10161077
451 Ga0070681_10174999
452 Ga0070681_10259660
453 Ga0070681_10284077
454 Ga0070681_10303823
455 Ga0070681_10741145
456 Ga0068867_100072516
457 Ga0070706_100029463
458 Ga0070698_100017908
459 Ga0070699_100015194
460 Ga0070679_100204142
461 Ga0070679_100482859
462 Ga0070679_100764175
463 Ga0070679_100918268
464 Ga0070684_100004031
465 Ga0070684_100602167
466 Ga0068853_100570951
467 Ga0070672_100098034
468 Ga0070672_100152234
469 Ga0070695_100000158
470 Ga0070696_100233450
471 Ga0070693_100155021
472 Ga0070665_100081964
473 Ga0070665_100724693
474 Ga0070704_100008256
475 Ga0068855_100408200
476 Ga0068855_100777803
477 Ga0070664_100118502
478 Ga0070664_100373844
479 Ga0070664_100881094
480 Ga0068857_100009560
481 Ga0068857_100271570
482 Ga0068857_100654587
483 Ga0068856_100612157
484 Ga0070702_100016066
485 Ga0068852_100392752
486 Ga0068852_101670021
487 Ga0068859_100003502
488 Ga0068859_100194379
489 Ga0068864_100025178
490 Ga0068864_100299911
491 Ga0068864_101206950
492 Ga0068861_100023390
493 Ga0068861_100450526
494 Ga0068870_10159334
495 Ga0068863_100107338
496 Ga0068863_100250601
497 Ga0068860_100001841
498 Ga0068860_100080379
499 Ga0068862_100002731
500 Ga0068862_100017501
501 Ga0068862_100296142
502 Ga0075365_10076577
503 Ga0075368_10103147
504 Ga0075364_10030113
505 Ga0075362_10045679
506 Ga0075367_10098355
507 Ga0075366_10021454
508 Ga0097621_100565015
509 Ga0075370_10060801
510 Ga0068871_101124101
511 Ga0075428_100251939
512 Ga0075431_100470881
513 Ga0097620_100003500
514 Ga0097620_100194396
515 Ga0105251_10129128
516 Ga0105240_10159100
517 Ga0105240_10239529
518 Ga0105240_10553123
519 Ga0105245_10067879
520 Ga0105243_10056569
521 Ga0105243_10057408
522 Ga0105243_11417754
523 Ga0105242_10205554
524 Ga0105248_10555022
525 Ga0105237_10130058
526 Ga0105238_10317910
527 Ga0105238_11030473
528 Ga0105238_11372983
529 Ga0105249_10046892
530 Ga0105249_10921608
531 Ga0105249_11736288
532 Ga0105239_10053150
533 Ga0105239_10346368
534 Ga0105239_11180782
535 Ga0105246_10012864
536 Ga0105246_10040416
537 Ga0105246_10162168
538 Ga0105246_10883316
539 Ga0105246_11231248
540 Ga0157373_10285492
541 Ga0157370_10015905
542 Ga0157370_10417584
543 Ga0157370_10463279
544 Ga0157370_11433915
545 Ga0157369_10008159
546 Ga0157369_10148213
547 Ga0157369_10484025
548 Ga0157369_10586600
549 Ga0157369_10900740
550 Ga0157374_10716311
551 Ga0157378_10099522
552 Ga0157378_10595505
553 Ga0163162_10214861
554 Ga0163162_10528127
555 Ga0157372_10051543
556 Ga0157372_10215758
557 Ga0157372_12316102
558 Ga0157375_10306008
559 Ga0163163_10044059
560 Ga0163163_10051486
561 Ga0157380_10035122
562 Ga0157380_10888827
563 Ga0157379_11300073
564 Ga0157376_10222379
565 Ga0206353_11258788
566 Ga0207653_10102885
567 Ga0207688_10030603
568 Ga0207680_10418292
569 Ga0207643_10015598
570 Ga0207643_10094685
571 Ga0207707_10061591
572 Ga0207707_10126494
573 Ga0207707_10137067
574 Ga0207707_10141199
575 Ga0207707_10284392
576 Ga0207695_10180820
577 Ga0207660_10015931
578 Ga0207660_10824227
579 Ga0207649_10099608
580 Ga0207652_10664871
581 Ga0207652_10837897
582 Ga0207681_10055802
583 Ga0207694_10203407
584 Ga0207694_10343267
585 Ga0207687_10096947
586 Ga0207644_10535143
587 Ga0207690_10112399
588 Ga0207706_10036082
589 Ga0207706_10150165
590 Ga0207706_10154749
591 Ga0207686_10543129
592 Ga0207709_10097817
593 Ga0207669_10028127
594 Ga0207691_10068902
595 Ga0207691_10125677
596 Ga0207711_10133727
597 Ga0207711_10568357
598 Ga0207689_10089709
599 Ga0207661_10000186
600 Ga0207661_10168132
601 Ga0207661_10420400
602 Ga0207679_10167946
603 Ga0207679_10797717
604 Ga0207667_10716459
605 Ga0207667_10763596
606 Ga0207712_10023018
607 Ga0207712_10868713
608 Ga0207668_10024309
609 Ga0207677_10127328
610 Ga0207677_10145170
611 Ga0207639_10024518
612 Ga0207678_10044918
613 Ga0207678_10183237
614 Ga0207678_10435184
615 Ga0207678_10609085
616 Ga0207708_10001399
617 Ga0207708_10103918
618 Ga0207708_10255035
619 Ga0207702_10052860
620 Ga0207641_10131630
621 Ga0207641_10164075
622 Ga0207676_10003912
623 Ga0207676_10080910
624 Ga0207676_10661791
625 Ga0207674_10001143
626 Ga0207674_10242253
627 Ga0207674_11034362
628 Ga0207675_100048221
629 Ga0207675_100135123
630 Ga0207683_10053612
631 Ga0207683_10168119
632 Ga0207698_10319495
633 Ga0207698_11788614
634 Ga0209813_10013463
635 Ga0268266_10119099
636 Ga0268265_10000626
637 Ga0268265_10036784
638 Ga0268265_10235949
639 Ga0268264_10003320
640 Ga0307405_10119658
641 Ga0307413_10240172
642 Ga0307413_10325848
643 Ga0326468_10004035
644 Ga0307406_10007814
645 Ga0307407_10073940
646 Ga0307409_100027346
647 Ga0307416_100092630
648 Ga0307411_10141110
649 Ga0307415_100071786
650 Ga0307415_100632381
651 Ga0373931_0296164
652 Ga0395899_0735821
653 Ga0395901_0339236
654 Ga0451800_0144451
655 Ga0451807_0753102
656 Ga0451853_2901402
657 Ga0451853_2966075
658 Ga0439442_160298
659 Ga0439459_0044804
660 Ga0495603_0084753
661 Ga0495629_0217343
662 Ga0496100_0245892
663 Ga0496101_0109131
664 Ga0496101_0291161
665 Ga0496102_0009559
666 Ga0496102_0039333
667 Ga0496102_0251716
668 Ga0496103_0036330
669 Ga0496103_0161053
670 Ga0496104_0132289
671 Ga0496104_0425223
672 Ga0496105_0052219
673 Ga0496105_0121824
674 Ga0496105_0591261
675 Ga0496105_1068102
676 Ga0496106_0042073
677 Ga0496106_0255921
678 Ga0496107_0011296
679 Ga0496107_0067379
680 Ga0496108_0040335
681 Ga0496108_0622801
682 Ga0496109_0039540
683 Ga0496109_0336834
684 Ga0496110_0017647
685 Ga0496112_0015803
686 Ga0496112_0016184
687 Ga0496113_0205497
688 Ga0496114_0040997
689 Ga0501031_0021962
690 Ga0501031_0121925
691 Ga0501031_0445807
692 Ga0501032_0038787
693 Ga0501032_0082015
694 Ga0501032_0507393
695 Ga0501033_0004294
696 Ga0501033_0029981
697 Ga0501033_0364429
698 Ga0501033_0755164
699 Ga0501034_0073146
700 Ga0501034_0139192
701 Ga0501034_0720472
702 Ga0501034_0750292
703 Ga0501034_0774770
704 Ga0501036_0039590
705 Ga0501036_0043106
706 Ga0501036_0043249
707 Ga0501037_0015413
708 Ga0501037_0029303
709 Ga0501037_0290347
710 Ga0501037_0421132
711 Ga0501038_0023114
712 Ga0501038_0134187
713 Ga0501038_0695400
714 Ga0501038_1096881
715 Ga0501039_0312463
716 Ga0501040_0209868
717 Ga0501041_0009961
718 Ga0501041_0137308
719 Ga0501042_0016734
720 Ga0501043_0023357
721 Ga0501043_0083685
722 Ga0501043_0315158
723 Ga0501043_0662765
724 Ga0501046_0006239
725 Ga0501046_0597111
726 Ga0501047_0025205
727 Ga0501047_0038746
728 Ga0501047_0125964
729 Ga0501047_0192145
730 Ga0501047_0558962
731 Ga0501048_0022535
732 Ga0501048_0250462
733 Ga0501068_0344050
734 Ga0501069_0080090
735 Ga0501069_0105697
736 Ga0501070_0047983
737 Ga0501070_0227971
738 Ga0501070_0330595
739 Ga0501070_0341639
740 Ga0501071_0017556
741 Ga0501071_0083056
742 Ga0501071_0307763
743 Ga0501071_0410503
744 Ga0501072_0149597
745 Ga0501072_0366370
746 Ga0501072_0600302
747 Ga0501073_0152782
748 Ga0501073_0201448
749 Ga0501074_0245665
750 Ga0501074_0314240
751 Ga0501075_0016047
752 Ga0501076_0013015
753 Ga0501076_0093445
754 Ga0501077_0067608
755 Ga0501077_0226749
756 Ga0501079_0226542
757 Ga0501080_0084392
758 Ga0501080_0110362
759 Ga0501081_0025471
760 Ga0501081_0252915
761 Ga0501081_0641650
762 Ga0501083_0868237
763 Ga0501035_0039585
764 Ga0501035_0054537
765 Ga0501035_0066879
766 Ga0501035_0230153
767 Ga0501035_0631049
768 Ga0501044_0030874
769 Ga0501044_0145612
770 Ga0501044_0215578
771 Ga0501044_0444462
772 Ga0501044_0820185
773 Ga0501044_0895694
774 Ga0501044_0940940
775 Ga0501045_0109607
776 Ga0501045_0164076
777 nmdc:mga03683_359453_c1
778 nmdc:mga00v17_292984_c1
779 nmdc:mga0yw44_260214_c1
780 nmdc:mga0k408_197401_c1
781 nmdc:mga0k408_220406_c1
782 nmdc:mga0k408_346791_c1
783 nmdc:mga06z11_110892_c1
784 nmdc:mga06z11_9784_c1
785 nmdc:mga04h51_10906_c1
786 nmdc:mga07m45_37513_c1
787 nmdc:mga07m45_579645_c1
788 nmdc:mga0qj67_893337_c1
789 nmdc:mga06r32_26679_c1
790 nmdc:mga06r32_848374_c1
791 nmdc:mga0sz30_80476_c1
792 Ga0500641_0016481
793 Ga0501082_0049267
794 Ga0501082_0385566
795 Ga0501082_0571287
796 Ga0530510_0002984
797 Ga0530510_0062570
798 2599104604
799 2846955461
800 2848862660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

15

164

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jk9-assembly1.cif.gz_B heterodimer between h48f-ysod1 and yccs 0.871 92 136
1qup-assembly1.cif.gz_B crystal structure of the copper chaperone for superoxide dismutase 0.8477 91 136
2ggp-assembly1.cif.gz_B solution structure of the atx1-cu(i)-ccc2a complex 0.8176 92 149
6fon-assembly1.cif.gz_C elongated conformer of the human copper chaperone for sod1 complexed with human sod1 0.8123 94 149
6fp6-assembly4.cif.gz_H complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.809 91 149
ID Description Score Start End Superfamily
af_I1JM65_169_393_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9146 94 136 3.30.70.100
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8669 91 145 3.30.70.100
1jk9D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8634 92 136 3.30.70.100
af_A0A1D6KPQ3_20_86_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8616 89 149 3.30.70.100
af_Q54Q77_94_172_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8524 94 136 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4U0YBI4-F1-model_v4 Pesticidal protein Cry1Ia 0.9101 87 161 GO:0008324
GO:0016020
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.9078 76 162 GO:0005886
GO:0008324
AF-A0A7Z1V1R0-F1-model_v4 deleted 0.8959 54 161
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.8887 76 162 GO:0005886
GO:0008324
AF-A0A7W7V745-F1-model_v4 Multisubunit Na+/H+ antiporter MnhE subunit 0.8874 56 162 GO:0005886
GO:0008324

Map