F434735

General Info

Members Datasets Scaffolds Average Seq Length
401 254 803 250

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10051259|rootH1_100512596
Length 280
Sequence LNCHDIQNLIDGYIDGGLDLVRNLEIEQHLQGCSTCVQIYKNRQALRTAIQTNPLYQKAPVHLQKRIQASLRQGNQPRSILHMTPLRLLSVAAALLIAAIMTWSLISSLLVPSVNEPXXXAVLSSHIRSLMANHLVDVTSSDKHTVKPWFDGKLDYSPPVVDLAQQGFPLVGGRLDYLNDRPVAALVYKRRNHFINLFIWPSTSAPVSNGNMTTLTRQGYYLITWTRSGTTYWAVSDLEESELQQFVQLVQHQITSATSTLPHNLSPPSLLMVPIYRAHR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
252 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.5
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0
Rhizoplane 0.25
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10051259 3300003316 Bacteria 1992
2 rootH1_10051259 3300003323 Bacteria 3967
3 SwRhRL3b_contig_140532 2162886006 Bacteria 2423
4 JGI25162J39368_1000015 3300002737 Bacteria 316381
5 JGI25165J46597_1000001 3300003214 Bacteria 1111887
6 rootH2_10195320 3300003320 Bacteria 3008
7 Ga0055538_1000001 3300003751 Bacteria 1111887
8 Ga0055539_1000001 3300003752 Bacteria 1111887
9 Ga0055533_1000003 3300003756 Bacteria 1111887
10 Ga0055525_1000003 3300003759 Bacteria 962094
11 Ga0055542_1007293 3300003762 Bacteria 2259
12 Ga0055541_1000001 3300003841 Bacteria 1111887
13 Ga0058859_11723521 3300004798 Bacteria 2039
14 Ga0065712_10068526 3300005290 Bacteria 10082
15 Ga0065715_10142038 3300005293 Bacteria 1768
16 Ga0065715_10283057 3300005293 Bacteria 1051
17 Ga0065707_10000697 3300005295 Bacteria 19287
18 Ga0070690_100000418 3300005330 Bacteria 21561
19 Ga0070690_100010526 3300005330 Bacteria 5386
20 Ga0070690_100067707 3300005330 Bacteria 2314
21 Ga0070690_100271802 3300005330 Bacteria 1206
22 Ga0070690_100483718 3300005330 Bacteria 923
23 Ga0070690_100554125 3300005330 Bacteria 867
24 Ga0068869_100001047 3300005334 Bacteria 16113
25 Ga0068869_100045704 3300005334 Bacteria 3154
26 Ga0068869_100144629 3300005334 Bacteria 1839
27 Ga0070680_100001261 3300005336 Bacteria 18287
28 Ga0070680_100165663 3300005336 Bacteria 1858
29 Ga0070680_100452936 3300005336 Bacteria 1096
30 Ga0070680_100601011 3300005336 Bacteria 944
31 Ga0070682_100010442 3300005337 Bacteria 5271
32 Ga0068868_100000810 3300005338 Bacteria 21184
33 Ga0070689_100001352 3300005340 Bacteria 15567
34 Ga0070689_100017745 3300005340 Bacteria 5233
35 Ga0070689_100747360 3300005340 Bacteria 857
36 Ga0070691_10011488 3300005341 Bacteria 4043
37 Ga0070687_100000111 3300005343 Bacteria 27592
38 Ga0070692_10000911 3300005345 Bacteria 10015
39 Ga0070669_100049040 3300005353 Bacteria 3083
40 Ga0070675_100170359 3300005354 Bacteria 1877
41 Ga0070671_100065672 3300005355 Bacteria 3023
42 Ga0070671_100380547 3300005355 Bacteria 1206
43 Ga0070688_100167553 3300005365 Bacteria 1513
44 Ga0070709_10126863 3300005434 Bacteria 1737
45 Ga0070714_100994399 3300005435 Bacteria 816
46 Ga0070701_10000124 3300005438 Bacteria 22615
47 Ga0070705_100002124 3300005440 Bacteria 10084
48 Ga0070700_100000756 3300005441 Bacteria 15955
49 Ga0070694_100000476 3300005444 Bacteria 21973
50 Ga0070662_100380226 3300005457 Bacteria 1162
51 Ga0070681_10012974 3300005458 Bacteria 8275
52 Ga0070681_10142565 3300005458 Bacteria 2325
53 Ga0070681_10218573 3300005458 Bacteria 1821
54 Ga0068867_100000433 3300005459 Bacteria 27996
55 Ga0070706_100140801 3300005467 Unclassified 2252
56 Ga0070707_100000509 3300005468 Bacteria 38647
57 Ga0070707_100017479 3300005468 Bacteria 6742
58 Ga0070707_100147976 3300005468 Bacteria 2286
59 Ga0070707_100211820 3300005468 Bacteria 1888
60 Ga0070707_100350818 3300005468 Unclassified 1433
61 Ga0070698_100221419 3300005471 Unclassified 1826
62 Ga0070698_100436336 3300005471 Bacteria 1245
63 Ga0070699_100045649 3300005518 Plasmid 3792
64 Ga0070679_100006815 3300005530 Bacteria 10654
65 Ga0070679_100075928 3300005530 Bacteria 3350
66 Ga0070679_100090129 3300005530 Bacteria 3054
67 Ga0070697_100345713 3300005536 Bacteria 1284
68 Ga0068853_100003228 3300005539 Bacteria 12468
69 Ga0070686_100000385 3300005544 Bacteria 28213
70 Ga0070686_100002219 3300005544 Bacteria 10728
71 Ga0070686_100049653 3300005544 Bacteria 2663
72 Ga0070686_100135769 3300005544 Bacteria 1707
73 Ga0070695_100000228 3300005545 Bacteria 27712
74 Ga0070695_100193172 3300005545 Unclassified 1450
75 Ga0070696_100000052 3300005546 Bacteria 53820
76 Ga0070696_100205991 3300005546 Bacteria 1470
77 Ga0070693_100001647 3300005547 Bacteria 10115
78 Ga0070693_100280151 3300005547 Bacteria 1116
79 Ga0070704_100000314 3300005549 Bacteria 21710
80 Ga0070704_100046868 3300005549 Bacteria 3018
81 Ga0070704_100167229 3300005549 Bacteria 1745
82 Ga0068855_100002153 3300005563 Bacteria 24336
83 Ga0068855_100240250 3300005563 Bacteria 2024
84 Ga0068857_100204598 3300005577 Bacteria 1800
85 Ga0068854_100001408 3300005578 Bacteria 14519
86 Ga0068854_100125728 3300005578 Bacteria 1952
87 Ga0068854_100205217 3300005578 Bacteria 1551
88 Ga0068856_100012650 3300005614 Bacteria 8171
89 Ga0070702_100000142 3300005615 Bacteria 22352
90 Ga0068852_100359068 3300005616 Bacteria 1425
91 Ga0068859_100000605 3300005617 Bacteria 35884
92 Ga0068864_100131558 3300005618 Bacteria 2248
93 Ga0068866_10000307 3300005718 Bacteria 23362
94 Ga0068861_100000164 3300005719 Bacteria 34852
95 Ga0068861_100230987 3300005719 Bacteria 1569
96 Ga0068861_100253685 3300005719 Bacteria 1502
97 Ga0068851_10009811 3300005834 Bacteria 4459
98 Ga0068870_10151286 3300005840 Bacteria 1367
99 Ga0068863_100033764 3300005841 Bacteria 4875
100 Ga0068863_100099733 3300005841 Bacteria 2760
101 Ga0068863_100212730 3300005841 Bacteria 1862
102 Ga0068858_100004098 3300005842 Bacteria 14354
103 Ga0068858_100388613 3300005842 Unclassified 1339
104 Ga0068860_100005449 3300005843 Bacteria 12902
105 Ga0068860_100125309 3300005843 Bacteria 2462
106 Ga0068862_100001243 3300005844 Bacteria 23999
107 Ga0068862_100359934 3300005844 Bacteria 1352
108 Ga0081455_10006957 3300005937 Bacteria 12025
109 Ga0081455_10021084 3300005937 Bacteria 6118
110 Ga0070715_10225942 3300006163 Bacteria 965
111 Ga0070712_100162605 3300006175 Unclassified 1725
112 Ga0097621_100004256 3300006237 Bacteria 9943
113 Ga0068871_100000751 3300006358 Bacteria 21875
114 Ga0075428_100000036 3300006844 Bacteria 107552
115 Ga0075428_100006227 3300006844 Bacteria 13272
116 Ga0075428_100052022 3300006844 Bacteria 4491
117 Ga0075428_100235407 3300006844 Bacteria 1976
118 Ga0075428_100811414 3300006844 Bacteria 994
119 Ga0075430_100052831 3300006846 Bacteria 3422
120 Ga0075431_100001620 3300006847 Bacteria 21015
121 Ga0075431_100116281 3300006847 Bacteria 2761
122 Ga0075431_100321440 3300006847 Bacteria 1560
123 Ga0075433_10000800 3300006852 Bacteria 21830
124 Ga0075433_10038298 3300006852 Bacteria 4140
125 Ga0075433_10065290 3300006852 Bacteria 3192
126 Ga0075433_10201802 3300006852 Bacteria 1768
127 Ga0075434_100000071 3300006871 Bacteria 53243
128 Ga0075434_100036128 3300006871 Bacteria 4886
129 Ga0075429_100000024 3300006880 Bacteria 67950
130 Ga0075429_100053458 3300006880 Bacteria 3514
131 Ga0075429_100270359 3300006880 Bacteria 1489
132 Ga0068865_100000130 3300006881 Bacteria 38946
133 Ga0075436_100000034 3300006914 Bacteria 86670
134 Ga0075436_100000538 3300006914 Bacteria 24703
135 Ga0075436_100008689 3300006914 Bacteria 6943
136 Ga0097620_100000605 3300006931 Bacteria 35884
137 Ga0075435_100001775 3300007076 Bacteria 14049
138 Ga0075435_100048914 3300007076 Bacteria 3398
139 Ga0075435_100239663 3300007076 Bacteria 1542
140 Ga0105250_10200619 3300009092 Unclassified 841
141 Ga0105240_10070862 3300009093 Bacteria 4311
142 Ga0105245_10000704 3300009098 Bacteria 30127
143 Ga0105245_10049972 3300009098 Bacteria 3746
144 Ga0105245_10453247 3300009098 Bacteria 1292
145 Ga0114129_10120749 3300009147 Bacteria 3608
146 Ga0114129_10331040 3300009147 Bacteria 2022
147 Ga0105243_10000889 3300009148 Bacteria 28135
148 Ga0105241_10061425 3300009174 Bacteria 2894
149 Ga0105242_10000432 3300009176 Bacteria 33401
150 Ga0105242_10763136 3300009176 Bacteria 953
151 Ga0105248_10040629 3300009177 Bacteria 5215
152 Ga0105248_10064644 3300009177 Bacteria 4107
153 Ga0105248_10065979 3300009177 Bacteria 4064
154 Ga0105237_10608175 3300009545 Bacteria 1100
155 Ga0105249_10001318 3300009553 Bacteria 21719
156 Ga0105249_10273291 3300009553 Unclassified 1684
157 Ga0105239_10314217 3300010375 Bacteria 1766
158 Ga0105246_10046458 3300011119 Bacteria 2962
159 Ga0157371_10149908 3300013102 Bacteria 1663
160 Ga0157371_10259825 3300013102 Bacteria 1252
161 Ga0157370_10032351 3300013104 Bacteria 5108
162 Ga0157369_10408943 3300013105 Bacteria 1407
163 Ga0157378_10000467 3300013297 Bacteria 38541
164 Ga0157378_10052259 3300013297 Bacteria 3636
165 Ga0163162_10117573 3300013306 Bacteria 2760
166 Ga0157375_10168213 3300013308 Bacteria 2338
167 Ga0157377_10036240 3300014745 Bacteria 2713
168 Ga0157379_10155586 3300014968 Bacteria 2062
169 Ga0157376_10006468 3300014969 Bacteria 8278
170 Ga0182006_1018335 3300015261 Bacteria 2959
171 Ga0182007_10027516 3300015262 Bacteria 1960
172 Ga0182005_1001101 3300015265 Bacteria 11303
173 Ga0206349_1274527 3300020075 Bacteria 1501
174 Ga0213876_10110411 3300021384 Bacteria 1460
175 Ga0209760_100870 3300025207 Bacteria 3871
176 Ga0209784_100004 3300025224 Bacteria 1378156
177 Ga0209566_100004 3300025225 Bacteria 1531866
178 Ga0209674_100006 3300025226 Bacteria 1531866
179 Ga0209672_105073 3300025228 Bacteria 2315
180 Ga0209563_100009 3300025230 Bacteria 1378156
181 Ga0207427_100732 3300025231 Bacteria 15274
182 Ga0209437_100004 3300025233 Bacteria 1378156
183 Ga0209677_100005 3300025253 Bacteria 1378156
184 Ga0209148_1000530 3300025254 Bacteria 37591
185 Ga0209233_1000005 3300025261 Bacteria 1531866
186 Ga0209455_1000326 3300025272 Bacteria 46230
187 Ga0207692_10202498 3300025898 Unclassified 1168
188 Ga0207642_10000946 3300025899 Bacteria 9087
189 Ga0207699_10089666 3300025906 Bacteria 1928
190 Ga0207699_10155617 3300025906 Unclassified 1517
191 Ga0207684_10036178 3300025910 Bacteria 4191
192 Ga0207707_10010362 3300025912 Bacteria 8089
193 Ga0207707_10028146 3300025912 Bacteria 4913
194 Ga0207695_10051699 3300025913 Bacteria 4311
195 Ga0207660_10025053 3300025917 Unclassified 4047
196 Ga0207660_10107486 3300025917 Bacteria 2094
197 Ga0207662_10000085 3300025918 Bacteria 43688
198 Ga0207652_10018668 3300025921 Bacteria 5691
199 Ga0207652_10048684 3300025921 Bacteria 3624
200 Ga0207652_10177638 3300025921 Bacteria 1912
201 Ga0207646_10000723 3300025922 Bacteria 42789
202 Ga0207646_10002477 3300025922 Bacteria 21814
203 Ga0207646_10066980 3300025922 Bacteria 3205
204 Ga0207646_10145511 3300025922 Bacteria 2136
205 Ga0207681_10174961 3300025923 Bacteria 1630
206 Ga0207659_10431753 3300025926 Bacteria 1106
207 Ga0207687_10166087 3300025927 Bacteria 1698
208 Ga0207700_10068519 3300025928 Bacteria 2720
209 Ga0207700_10714199 3300025928 Unclassified 895
210 Ga0207664_10855204 3300025929 Bacteria 817
211 Ga0207644_10126687 3300025931 Unclassified 1950
212 Ga0207686_10004064 3300025934 Bacteria 7852
213 Ga0207709_10003194 3300025935 Bacteria 9852
214 Ga0207704_10001608 3300025938 Bacteria 10159
215 Ga0207665_10166619 3300025939 Bacteria 1589
216 Ga0207711_10035406 3300025941 Bacteria 4231
217 Ga0207711_10061510 3300025941 Bacteria 3238
218 Ga0207711_10360325 3300025941 Bacteria 1347
219 Ga0207689_10000453 3300025942 Bacteria 38540
220 Ga0207689_10031660 3300025942 Bacteria 4401
221 Ga0207679_10172075 3300025945 Bacteria 1784
222 Ga0207667_10030075 3300025949 Bacteria 5879
223 Ga0207651_10443737 3300025960 Bacteria 1112
224 Ga0207712_10003791 3300025961 Bacteria 9540
225 Ga0207712_10291205 3300025961 Unclassified 1336
226 Ga0207640_10000998 3300025981 Bacteria 15667
227 Ga0207640_10436504 3300025981 Bacteria 1075
228 Ga0207677_10000333 3300026023 Bacteria 33980
229 Ga0207703_10003029 3300026035 Bacteria 14223
230 Ga0207639_10078432 3300026041 Bacteria 2607
231 Ga0207708_10000727 3300026075 Bacteria 24747
232 Ga0207702_10050396 3300026078 Bacteria 3515
233 Ga0207641_10150574 3300026088 Bacteria 2107
234 Ga0207641_10186543 3300026088 Bacteria 1903
235 Ga0207641_10219053 3300026088 Bacteria 1764
236 Ga0207641_10242982 3300026088 Bacteria 1678
237 Ga0207648_10000398 3300026089 Bacteria 48319
238 Ga0207676_10116365 3300026095 Bacteria 2246
239 Ga0207674_10218241 3300026116 Bacteria 1855
240 Ga0207675_100000474 3300026118 Bacteria 39052
241 Ga0207675_100263971 3300026118 Bacteria 1669
242 Ga0207675_100337939 3300026118 Bacteria 1474
243 Ga0268265_10001192 3300028380 Bacteria 22645
244 Ga0268264_10001994 3300028381 Bacteria 18346
245 Ga0268264_10244239 3300028381 Bacteria 1665
246 Ga0265338_10000243 3300028800 Bacteria 100885
247 Ga0265338_10046248 3300028800 Bacteria 3990
248 Ga0265338_10070781 3300028800 Bacteria 2988
249 Ga0265338_10266132 3300028800 Bacteria 1258
250 Ga0265332_10043908 3300031238 Bacteria 1929
251 Ga0265340_10007924 3300031247 Bacteria 5759
252 Ga0265339_10015200 3300031249 Bacteria 4622
253 Ga0265316_10310072 3300031344 Bacteria 1148
254 Ga0265314_10051193 3300031711 Bacteria 2878
255 Ga0307410_10085544 3300031852 Bacteria 2226
256 Ga0307407_10106754 3300031903 Bacteria 1750
257 Ga0307416_100004270 3300032002 Bacteria 8585
258 Ga0307414_10004922 3300032004 Bacteria 7303
259 Ga0373948_0108989 3300034817 Bacteria 659
260 Ga0373950_0001161 3300034818 Bacteria 3385
261 Ga0373928_0000040 3300035084 Bacteria 22037
262 Ga0373929_0000353 3300035085 Bacteria 8570
263 Ga0373940_0045273 3300035088 Bacteria 1221
264 Ga0373944_0000214 3300035089 Bacteria 12433
265 Ga0373949_0001509 3300035090 Bacteria 6605
266 Ga0373951_0002578 3300035091 Bacteria 4554
267 Ga0373932_0000006 3300035112 Bacteria 208547
268 Ga0373945_0008649 3300035116 Bacteria 3320
269 Ga0373953_0065952 3300035117 Unclassified 1487
270 Ga0373954_0047735 3300035118 Unclassified 2005
271 Ga0373961_0064127 3300035241 Bacteria 1122
272 Ga0373962_0000031 3300035242 Bacteria 36127
273 Ga0373931_0000009 3300035691 Bacteria 349854
274 Ga0373931_0017060 3300035691 Bacteria 3583
275 Ga0373931_0090989 3300035691 Bacteria 1700
276 Ga0373931_0416194 3300035691 Unclassified 854
277 Ga0373935_0014587 3300035692 Bacteria 4743
278 Ga0373927_0006395 3300035695 Bacteria 8024
279 Ga0373927_0218902 3300035695 Unclassified 1251
280 Ga0373933_0053083 3300035724 Bacteria 2427
281 Ga0373947_0123370 3300035725 Bacteria 1647
282 Ga0373937_0266136 3300036401 Bacteria 1617
283 Ga0395899_0119015 3300037312 Bacteria 1894
284 Ga0436365_1541738 3300039437 Bacteria 6161
285 Ga0436363_0022150 3300039450 Bacteria 1098
286 Ga0451577_0039260 3300042876 Bacteria 4254
287 Ga0451577_0125980 3300042876 Bacteria 2295
288 Ga0466969_0035577 3300044656 Bacteria 2518
289 Ga0453683_0005369 3300044673 Bacteria 8954
290 Ga0453683_0006455 3300044673 Bacteria 8052
291 Ga0466966_0004316 3300044684 Bacteria 9373
292 Ga0466966_0009881 3300044684 Bacteria 6325
293 Ga0466961_0000145 3300044693 Bacteria 47999
294 Ga0466961_0011191 3300044693 Bacteria 5736
295 Ga0453684_0028978 3300044712 Bacteria 7878
296 Ga0466970_0066097 3300044765 Unclassified 1941
297 Ga0466970_0166924 3300044765 Unclassified 1219
298 Ga0466957_0001647 3300044842 Bacteria 11722
299 Ga0466959_0034429 3300045049 Bacteria 3746
300 Ga0466959_0272363 3300045049 Unclassified 1163
301 Ga0451576_0039279 3300045051 Bacteria 5009
302 Ga0451576_0132202 3300045051 Bacteria 2602
303 Ga0451576_0279989 3300045051 Unclassified 1744
304 Ga0451576_0631838 3300045051 Bacteria 1125
305 Ga0466958_0002979 3300045836 Bacteria 8675
306 Ga0495592_0000231 3300046454 Bacteria 48322
307 Ga0495592_0022831 3300046454 Bacteria 4759
308 Ga0495592_0032968 3300046454 Unclassified 3908
309 Ga0495592_0109525 3300046454 Bacteria 1956
310 Ga0495603_0051350 3300046455 Bacteria 2451
311 Ga0495651_0001072 3300046462 Bacteria 21066
312 Ga0495580_0049063 3300046472 Bacteria 2987
313 Ga0495662_0024265 3300046476 Bacteria 2926
314 Ga0495664_0054440 3300046477 Bacteria 2379
315 Ga0495606_0003931 3300046507 Bacteria 15287
316 Ga0495608_0036309 3300046511 Bacteria 3318
317 Ga0495608_0037477 3300046511 Bacteria 3260
318 Ga0495608_0090447 3300046511 Bacteria 1980
319 Ga0495618_0005618 3300046514 Bacteria 7626
320 Ga0495628_0000634 3300046516 Bacteria 32129
321 Ga0495628_0001985 3300046516 Bacteria 18552
322 Ga0495628_0032314 3300046516 Unclassified 4226
323 Ga0495628_0130859 3300046516 Bacteria 1919
324 Ga0495630_0007161 3300046517 Bacteria 7950
325 Ga0495630_0060874 3300046517 Unclassified 2835
326 Ga0495666_0057862 3300046526 Bacteria 1855
327 Ga0495652_0003861 3300046529 Bacteria 14620
328 Ga0495652_0006933 3300046529 Bacteria 10483
329 Ga0495652_0011264 3300046529 Bacteria 8093
330 Ga0495652_0366743 3300046529 Bacteria 1027
331 Ga0495640_0600082 3300046533 Unclassified 665
332 Ga0495586_0004182 3300046535 Bacteria 7733
333 Ga0495587_0000750 3300046536 Bacteria 21634
334 Ga0495645_0003824 3300046543 Bacteria 10242
335 Ga0495645_0007621 3300046543 Bacteria 7533
336 Ga0495645_0021421 3300046543 Bacteria 4671
337 Ga0495645_0045457 3300046543 Bacteria 3204
338 Ga0495645_0056288 3300046543 Unclassified 2855
339 Ga0495667_0033326 3300046559 Bacteria 3448
340 Ga0495634_0153355 3300046642 Bacteria 1456
341 Ga0495657_0019873 3300046675 Bacteria 4840
342 Ga0495657_0040218 3300046675 Bacteria 3209
343 Ga0495599_0006435 3300046678 Bacteria 7085
344 Ga0495599_0011172 3300046678 Bacteria 5512
345 Ga0495599_0018661 3300046678 Unclassified 4321
346 Ga0495599_0124099 3300046678 Unclassified 1605
347 Ga0495623_0031331 3300046679 Bacteria 3419
348 Ga0495623_0228375 3300046679 Unclassified 1057
349 Ga0495646_0118241 3300046680 Bacteria 1502
350 Ga0495658_0211059 3300046683 Bacteria 1213
351 Ga0495613_0012022 3300046689 Bacteria 6433
352 Ga0495613_0103393 3300046689 Bacteria 2057
353 Ga0495624_0013246 3300046690 Bacteria 5622
354 Ga0495670_0096677 3300046691 Bacteria 1517
355 Ga0495600_0000495 3300046809 Bacteria 20363
356 Ga0495600_0003466 3300046809 Bacteria 9282
357 Ga0495604_0060102 3300047317 Unclassified 2911
358 Ga0495604_0150327 3300047317 Bacteria 1655
359 Ga0495674_0013110 3300047319 Bacteria 7796
360 Ga0495674_0046712 3300047319 Unclassified 3843
361 Ga0495680_0020341 3300047322 Bacteria 5586
362 Ga0495675_0000052 3300047444 Bacteria 79959
363 Ga0495675_0023834 3300047444 Bacteria 3900
364 Ga0495675_0045274 3300047444 Unclassified 2802
365 Ga0495675_0198190 3300047444 Bacteria 1223
366 Ga0495684_0000552 3300047471 Bacteria 30354
367 Ga0495684_0006905 3300047471 Bacteria 8813
368 Ga0495684_0040385 3300047471 Bacteria 3577
369 Ga0495686_0000852 3300047472 Bacteria 39191
370 Ga0495686_0008302 3300047472 Bacteria 7637
371 Ga0495686_0089275 3300047472 Bacteria 1873
372 Ga0495602_0068524 3300048088 Unclassified 3046
373 Ga0496101_0159180 3300048904 Bacteria 1731
374 Ga0496121_0032490 3300048924 Bacteria 4742
375 Ga0496121_0376853 3300048924 Bacteria 937
376 Ga0501037_0294342 3300049573 Bacteria 1128
377 Ga0501044_0307124 3300049823 Bacteria 1513
378 nmdc:mga05p37_110423_c1 3300050507 Unclassified 3383
379 nmdc:mga09592_57_c1 3300050508 Bacteria 61784
380 nmdc:mga09592_584555_c1 3300050508 Bacteria 958
381 nmdc:mga09592_75873_c1 3300050508 Bacteria 2859
382 nmdc:mga06r32_1747_c1 3300050510 Bacteria 19527
383 nmdc:mga06r32_434310_c1 3300050510 Bacteria 1294
384 nmdc:mga08y16_76610_c1 3300050511 Bacteria 3486
385 nmdc:mga0n895_1130_c1 3300050512 Bacteria 19511
386 nmdc:mga0n895_386229_c1 3300050512 Unclassified 1416
387 nmdc:mga0n895_796618_c1 3300050512 Bacteria 936
388 nmdc:mga0rr50_149345_c1 3300050513 Bacteria 1887
389 nmdc:mga0rr50_2366_c1 3300050513 Bacteria 10603
390 nmdc:mga08x19_6414_c1 3300050514 Bacteria 6965
391 nmdc:mga08x19_67478_c1 3300050514 Bacteria 2326
392 nmdc:mga08x19_85_c1 3300050514 Bacteria 83524
393 nmdc:mga0a205_213317_c1 3300050515 Bacteria 1818
394 nmdc:mga0a205_3310_c2 3300050515 Bacteria 13261
395 nmdc:mga0a205_74475_c1 3300050515 Bacteria 3281
396 nmdc:mga0a205_766666_c1 3300050515 Unclassified 813
397 Ga0495601_0002725 3300053077 Bacteria 10034
398 Ga0500595_000338 3300053119 Bacteria 30737
399 Ga0500574_000565 3300053141 Bacteria 4774
400 Ga0500619_000425 3300053154 Bacteria 7635
401 Ga0530510_0032423 3300061734 Unclassified 3759
402 2819540953 2818991436 Bacteria 5376622
403 rootH1_10051259
404 SwRhRL3b_contig_140532
405 JGI25162J39368_1000015
406 JGI25165J46597_1000001
407 rootH2_10195320
408 Ga0055538_1000001
409 Ga0055539_1000001
410 Ga0055533_1000003
411 Ga0055525_1000003
412 Ga0055542_1007293
413 Ga0055541_1000001
414 Ga0058859_11723521
415 Ga0065712_10068526
416 Ga0065715_10142038
417 Ga0065715_10283057
418 Ga0065707_10000697
419 Ga0070690_100000418
420 Ga0070690_100010526
421 Ga0070690_100067707
422 Ga0070690_100271802
423 Ga0070690_100483718
424 Ga0070690_100554125
425 Ga0068869_100001047
426 Ga0068869_100045704
427 Ga0068869_100144629
428 Ga0070680_100001261
429 Ga0070680_100165663
430 Ga0070680_100452936
431 Ga0070680_100601011
432 Ga0070682_100010442
433 Ga0068868_100000810
434 Ga0070689_100001352
435 Ga0070689_100017745
436 Ga0070689_100747360
437 Ga0070691_10011488
438 Ga0070687_100000111
439 Ga0070692_10000911
440 Ga0070669_100049040
441 Ga0070675_100170359
442 Ga0070671_100065672
443 Ga0070671_100380547
444 Ga0070688_100167553
445 Ga0070709_10126863
446 Ga0070714_100994399
447 Ga0070701_10000124
448 Ga0070705_100002124
449 Ga0070700_100000756
450 Ga0070694_100000476
451 Ga0070662_100380226
452 Ga0070681_10012974
453 Ga0070681_10142565
454 Ga0070681_10218573
455 Ga0068867_100000433
456 Ga0070706_100140801
457 Ga0070707_100000509
458 Ga0070707_100017479
459 Ga0070707_100147976
460 Ga0070707_100211820
461 Ga0070707_100350818
462 Ga0070698_100221419
463 Ga0070698_100436336
464 Ga0070699_100045649
465 Ga0070679_100006815
466 Ga0070679_100075928
467 Ga0070679_100090129
468 Ga0070697_100345713
469 Ga0068853_100003228
470 Ga0070686_100000385
471 Ga0070686_100002219
472 Ga0070686_100049653
473 Ga0070686_100135769
474 Ga0070695_100000228
475 Ga0070695_100193172
476 Ga0070696_100000052
477 Ga0070696_100205991
478 Ga0070693_100001647
479 Ga0070693_100280151
480 Ga0070704_100000314
481 Ga0070704_100046868
482 Ga0070704_100167229
483 Ga0068855_100002153
484 Ga0068855_100240250
485 Ga0068857_100204598
486 Ga0068854_100001408
487 Ga0068854_100125728
488 Ga0068854_100205217
489 Ga0068856_100012650
490 Ga0070702_100000142
491 Ga0068852_100359068
492 Ga0068859_100000605
493 Ga0068864_100131558
494 Ga0068866_10000307
495 Ga0068861_100000164
496 Ga0068861_100230987
497 Ga0068861_100253685
498 Ga0068851_10009811
499 Ga0068870_10151286
500 Ga0068863_100033764
501 Ga0068863_100099733
502 Ga0068863_100212730
503 Ga0068858_100004098
504 Ga0068858_100388613
505 Ga0068860_100005449
506 Ga0068860_100125309
507 Ga0068862_100001243
508 Ga0068862_100359934
509 Ga0081455_10006957
510 Ga0081455_10021084
511 Ga0070715_10225942
512 Ga0070712_100162605
513 Ga0097621_100004256
514 Ga0068871_100000751
515 Ga0075428_100000036
516 Ga0075428_100006227
517 Ga0075428_100052022
518 Ga0075428_100235407
519 Ga0075428_100811414
520 Ga0075430_100052831
521 Ga0075431_100001620
522 Ga0075431_100116281
523 Ga0075431_100321440
524 Ga0075433_10000800
525 Ga0075433_10038298
526 Ga0075433_10065290
527 Ga0075433_10201802
528 Ga0075434_100000071
529 Ga0075434_100036128
530 Ga0075429_100000024
531 Ga0075429_100053458
532 Ga0075429_100270359
533 Ga0068865_100000130
534 Ga0075436_100000034
535 Ga0075436_100000538
536 Ga0075436_100008689
537 Ga0097620_100000605
538 Ga0075435_100001775
539 Ga0075435_100048914
540 Ga0075435_100239663
541 Ga0105250_10200619
542 Ga0105240_10070862
543 Ga0105245_10000704
544 Ga0105245_10049972
545 Ga0105245_10453247
546 Ga0114129_10120749
547 Ga0114129_10331040
548 Ga0105243_10000889
549 Ga0105241_10061425
550 Ga0105242_10000432
551 Ga0105242_10763136
552 Ga0105248_10040629
553 Ga0105248_10064644
554 Ga0105248_10065979
555 Ga0105237_10608175
556 Ga0105249_10001318
557 Ga0105249_10273291
558 Ga0105239_10314217
559 Ga0105246_10046458
560 Ga0157371_10149908
561 Ga0157371_10259825
562 Ga0157370_10032351
563 Ga0157369_10408943
564 Ga0157378_10000467
565 Ga0157378_10052259
566 Ga0163162_10117573
567 Ga0157375_10168213
568 Ga0157377_10036240
569 Ga0157379_10155586
570 Ga0157376_10006468
571 Ga0182006_1018335
572 Ga0182007_10027516
573 Ga0182005_1001101
574 Ga0206349_1274527
575 Ga0213876_10110411
576 Ga0209760_100870
577 Ga0209784_100004
578 Ga0209566_100004
579 Ga0209674_100006
580 Ga0209672_105073
581 Ga0209563_100009
582 Ga0207427_100732
583 Ga0209437_100004
584 Ga0209677_100005
585 Ga0209148_1000530
586 Ga0209233_1000005
587 Ga0209455_1000326
588 Ga0207692_10202498
589 Ga0207642_10000946
590 Ga0207699_10089666
591 Ga0207699_10155617
592 Ga0207684_10036178
593 Ga0207707_10010362
594 Ga0207707_10028146
595 Ga0207695_10051699
596 Ga0207660_10025053
597 Ga0207660_10107486
598 Ga0207662_10000085
599 Ga0207652_10018668
600 Ga0207652_10048684
601 Ga0207652_10177638
602 Ga0207646_10000723
603 Ga0207646_10002477
604 Ga0207646_10066980
605 Ga0207646_10145511
606 Ga0207681_10174961
607 Ga0207659_10431753
608 Ga0207687_10166087
609 Ga0207700_10068519
610 Ga0207700_10714199
611 Ga0207664_10855204
612 Ga0207644_10126687
613 Ga0207686_10004064
614 Ga0207709_10003194
615 Ga0207704_10001608
616 Ga0207665_10166619
617 Ga0207711_10035406
618 Ga0207711_10061510
619 Ga0207711_10360325
620 Ga0207689_10000453
621 Ga0207689_10031660
622 Ga0207679_10172075
623 Ga0207667_10030075
624 Ga0207651_10443737
625 Ga0207712_10003791
626 Ga0207712_10291205
627 Ga0207640_10000998
628 Ga0207640_10436504
629 Ga0207677_10000333
630 Ga0207703_10003029
631 Ga0207639_10078432
632 Ga0207708_10000727
633 Ga0207702_10050396
634 Ga0207641_10150574
635 Ga0207641_10186543
636 Ga0207641_10219053
637 Ga0207641_10242982
638 Ga0207648_10000398
639 Ga0207676_10116365
640 Ga0207674_10218241
641 Ga0207675_100000474
642 Ga0207675_100263971
643 Ga0207675_100337939
644 Ga0268265_10001192
645 Ga0268264_10001994
646 Ga0268264_10244239
647 Ga0265338_10000243
648 Ga0265338_10046248
649 Ga0265338_10070781
650 Ga0265338_10266132
651 Ga0265332_10043908
652 Ga0265340_10007924
653 Ga0265339_10015200
654 Ga0265316_10310072
655 Ga0265314_10051193
656 Ga0307410_10085544
657 Ga0307407_10106754
658 Ga0307416_100004270
659 Ga0307414_10004922
660 Ga0373948_0108989
661 Ga0373950_0001161
662 Ga0373928_0000040
663 Ga0373929_0000353
664 Ga0373940_0045273
665 Ga0373944_0000214
666 Ga0373949_0001509
667 Ga0373951_0002578
668 Ga0373932_0000006
669 Ga0373945_0008649
670 Ga0373953_0065952
671 Ga0373954_0047735
672 Ga0373961_0064127
673 Ga0373962_0000031
674 Ga0373931_0000009
675 Ga0373931_0017060
676 Ga0373931_0090989
677 Ga0373931_0416194
678 Ga0373935_0014587
679 Ga0373927_0006395
680 Ga0373927_0218902
681 Ga0373933_0053083
682 Ga0373947_0123370
683 Ga0373937_0266136
684 Ga0395899_0119015
685 Ga0436365_1541738
686 Ga0436363_0022150
687 Ga0451577_0039260
688 Ga0451577_0125980
689 Ga0466969_0035577
690 Ga0453683_0005369
691 Ga0453683_0006455
692 Ga0466966_0004316
693 Ga0466966_0009881
694 Ga0466961_0000145
695 Ga0466961_0011191
696 Ga0453684_0028978
697 Ga0466970_0066097
698 Ga0466970_0166924
699 Ga0466957_0001647
700 Ga0466959_0034429
701 Ga0466959_0272363
702 Ga0451576_0039279
703 Ga0451576_0132202
704 Ga0451576_0279989
705 Ga0451576_0631838
706 Ga0466958_0002979
707 Ga0495592_0000231
708 Ga0495592_0022831
709 Ga0495592_0032968
710 Ga0495592_0109525
711 Ga0495603_0051350
712 Ga0495651_0001072
713 Ga0495580_0049063
714 Ga0495662_0024265
715 Ga0495664_0054440
716 Ga0495606_0003931
717 Ga0495608_0036309
718 Ga0495608_0037477
719 Ga0495608_0090447
720 Ga0495618_0005618
721 Ga0495628_0000634
722 Ga0495628_0001985
723 Ga0495628_0032314
724 Ga0495628_0130859
725 Ga0495630_0007161
726 Ga0495630_0060874
727 Ga0495666_0057862
728 Ga0495652_0003861
729 Ga0495652_0006933
730 Ga0495652_0011264
731 Ga0495652_0366743
732 Ga0495640_0600082
733 Ga0495586_0004182
734 Ga0495587_0000750
735 Ga0495645_0003824
736 Ga0495645_0007621
737 Ga0495645_0021421
738 Ga0495645_0045457
739 Ga0495645_0056288
740 Ga0495667_0033326
741 Ga0495634_0153355
742 Ga0495657_0019873
743 Ga0495657_0040218
744 Ga0495599_0006435
745 Ga0495599_0011172
746 Ga0495599_0018661
747 Ga0495599_0124099
748 Ga0495623_0031331
749 Ga0495623_0228375
750 Ga0495646_0118241
751 Ga0495658_0211059
752 Ga0495613_0012022
753 Ga0495613_0103393
754 Ga0495624_0013246
755 Ga0495670_0096677
756 Ga0495600_0000495
757 Ga0495600_0003466
758 Ga0495604_0060102
759 Ga0495604_0150327
760 Ga0495674_0013110
761 Ga0495674_0046712
762 Ga0495680_0020341
763 Ga0495675_0000052
764 Ga0495675_0023834
765 Ga0495675_0045274
766 Ga0495675_0198190
767 Ga0495684_0000552
768 Ga0495684_0006905
769 Ga0495684_0040385
770 Ga0495686_0000852
771 Ga0495686_0008302
772 Ga0495686_0089275
773 Ga0495602_0068524
774 Ga0496101_0159180
775 Ga0496121_0032490
776 Ga0496121_0376853
777 Ga0501037_0294342
778 Ga0501044_0307124
779 nmdc:mga05p37_110423_c1
780 nmdc:mga09592_57_c1
781 nmdc:mga09592_584555_c1
782 nmdc:mga09592_75873_c1
783 nmdc:mga06r32_1747_c1
784 nmdc:mga06r32_434310_c1
785 nmdc:mga08y16_76610_c1
786 nmdc:mga0n895_1130_c1
787 nmdc:mga0n895_386229_c1
788 nmdc:mga0n895_796618_c1
789 nmdc:mga0rr50_149345_c1
790 nmdc:mga0rr50_2366_c1
791 nmdc:mga08x19_6414_c1
792 nmdc:mga08x19_67478_c1
793 nmdc:mga08x19_85_c1
794 nmdc:mga0a205_213317_c1
795 nmdc:mga0a205_3310_c2
796 nmdc:mga0a205_74475_c1
797 nmdc:mga0a205_766666_c1
798 Ga0495601_0002725
799 Ga0500595_000338
800 Ga0500574_000565
801 Ga0500619_000425
802 Ga0530510_0032423
803 2819540953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

3

36

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zl1-assembly1.cif.gz_B mp1-p14 scaffolding complex 0.8179 211 252
5y3a-assembly1.cif.gz_B crystal structure of ragulator complex (p18 49-161) 0.7878 211 248
3m4w-assembly1.cif.gz_C structural basis for the negative regulation of bacterial stress response by rseb 0.7503 166 246
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.7352 2 69
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.7332 6 70
ID Description Score Start End Superfamily
af_Q54F59_1_120_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8562 211 252 3.30.450.30
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7654 7 55 1.10.10.1320
af_Q9BI89_43_458_3.30.450.70 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.754 212 235 3.30.450.70
af_Q6ZC59_24_148_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7465 211 235 3.30.450.50
af_P26200_1_123_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7359 203 253 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A2V6FUE9-F1-model_v4 Anti-sigma factor 0.981 115 248
AF-A0A2V8TLS2-F1-model_v4 Anti-sigma factor 0.9806 123 247
AF-A0A7R6WFZ0-F1-model_v4 Anti-sigma factor 0.9624 117 251
AF-A0A531M551-F1-model_v4 Anti-sigma factor 0.9515 165 252
AF-A0A4R6CQM4-F1-model_v4 Anti-sigma factor 0.9479 170 253

Map