F434802

General Info

Members Datasets Scaffolds Average Seq Length
401 230 802 180

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10397195|Ga0068866_103971952
Length 211
Sequence MIHAKSPFHTIADQQPALSNAPSSHKQVIHMIALILRYGFVAGLIVGVPMVWRMLAAKAGATEEPVAGMLLGYLTMIVALTAVFLGVKTYRDKVLGGAIRFLPALGVGLGISAVASIMYVIAWEISMAYSSFDFIAFYKAYIVNAAKAKGASGAELNQAIADAESFAIMYKNPLYRMPMTFIEMFPVGLLISLITAAILRNSRVLPARAVS

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
229 2739367700 Dyella sp. YR388 Isolate Unclassified
230 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 0
Rhizoplane 3.74
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10397195 3300005718 Unclassified 888
2 JGI24740J21852_10003120 3300001979 Bacteria 7313
3 JGI24739J22299_10001068 3300001989 Bacteria 10203
4 JGI24737J22298_10082118 3300001990 Bacteria 959
5 JGI25162J39368_1000761 3300002737 Bacteria 21822
6 JGI25162J39368_1001404 3300002737 Bacteria 13132
7 JGI25157J39369_1000691 3300002741 Bacteria 18222
8 JGI25164J39214_1000837 3300002772 Bacteria 10652
9 JGI25164J39214_1000950 3300002772 Bacteria 9371
10 JGI25165J46597_1000907 3300003214 Bacteria 20573
11 JGI25165J46597_1005279 3300003214 Bacteria 2531
12 JGI25165J46597_1024746 3300003214 Bacteria 779
13 JGI25153J46596_10022049 3300003215 Bacteria 2360
14 rootH1_10035900 3300003316 Bacteria 12744
15 rootH2_10023246 3300003320 Bacteria 19919
16 rootL2_10355094 3300003322 Bacteria 1424
17 JGI26145J50221_1003265 3300003371 Bacteria 1289
18 Ga0055537_1002117 3300003773 Bacteria 6958
19 Ga0065165_1002552 3300005262 Bacteria 15100
20 Ga0070676_10003995 3300005328 Bacteria 7739
21 Ga0070676_10196330 3300005328 Bacteria 1320
22 Ga0070676_10371449 3300005328 Unclassified 988
23 Ga0070683_100726162 3300005329 Bacteria 952
24 Ga0070670_100697706 3300005331 Bacteria 913
25 Ga0070670_100747506 3300005331 Bacteria 881
26 Ga0070670_100974463 3300005331 Bacteria 770
27 Ga0070677_10003439 3300005333 Bacteria 5107
28 Ga0070677_10291570 3300005333 Bacteria 826
29 Ga0070677_10389704 3300005333 Bacteria 732
30 Ga0068869_100419830 3300005334 Bacteria 1103
31 Ga0070666_10484716 3300005335 Bacteria 895
32 Ga0070680_100406641 3300005336 Bacteria 1161
33 Ga0070680_100696888 3300005336 Bacteria 874
34 Ga0070682_100055169 3300005337 Bacteria 2495
35 Ga0070682_100778361 3300005337 Bacteria 775
36 Ga0068868_100164398 3300005338 Bacteria 1835
37 Ga0068868_100188931 3300005338 Bacteria 1712
38 Ga0070689_100056096 3300005340 Unclassified 3054
39 Ga0070689_100524820 3300005340 Unclassified 1017
40 Ga0070691_10079064 3300005341 Unclassified 1607
41 Ga0070691_10100311 3300005341 Bacteria 1437
42 Ga0070687_100107624 3300005343 Unclassified 1572
43 Ga0070692_10086474 3300005345 Bacteria 1697
44 Ga0070669_100785300 3300005353 Unclassified 809
45 Ga0070675_100006493 3300005354 Bacteria 8979
46 Ga0070675_100054217 3300005354 Bacteria 3298
47 Ga0070671_100367656 3300005355 Bacteria 1228
48 Ga0070671_100516048 3300005355 Bacteria 1029
49 Ga0070674_100011074 3300005356 Bacteria 5474
50 Ga0070674_100014097 3300005356 Bacteria 4961
51 Ga0070673_100017751 3300005364 Bacteria 5069
52 Ga0070673_100117952 3300005364 Bacteria 2209
53 Ga0070659_100293804 3300005366 Bacteria 1353
54 Ga0070659_100619320 3300005366 Bacteria 931
55 Ga0070659_101034224 3300005366 Bacteria 722
56 Ga0070667_100063974 3300005367 Bacteria 3120
57 Ga0070667_100089979 3300005367 Bacteria 2637
58 Ga0070667_100312176 3300005367 Bacteria 1417
59 Ga0070714_100025035 3300005435 Bacteria 4921
60 Ga0070711_100202060 3300005439 Bacteria 1534
61 Ga0070700_100017790 3300005441 Bacteria 4072
62 Ga0070700_100506836 3300005441 Unclassified 929
63 Ga0070694_100120841 3300005444 Bacteria 1879
64 Ga0070694_101353479 3300005444 Unclassified 600
65 Ga0070663_100210258 3300005455 Bacteria 1523
66 Ga0070678_100020929 3300005456 Bacteria 4301
67 Ga0070678_100441140 3300005456 Bacteria 1139
68 Ga0070662_100184840 3300005457 Bacteria 1645
69 Ga0070662_100640422 3300005457 Bacteria 896
70 Ga0070681_10000006 3300005458 Bacteria 169066
71 Ga0070681_10018340 3300005458 Bacteria 6993
72 Ga0070681_10196745 3300005458 Bacteria 1935
73 Ga0068867_100714471 3300005459 Bacteria 886
74 Ga0070685_10004833 3300005466 Bacteria 6820
75 Ga0070685_10102233 3300005466 Bacteria 1752
76 Ga0070685_10203857 3300005466 Bacteria 1287
77 Ga0070679_100178896 3300005530 Bacteria 2094
78 Ga0070679_100272131 3300005530 Bacteria 1648
79 Ga0068853_100014923 3300005539 Bacteria 6381
80 Ga0068853_100057766 3300005539 Bacteria 3349
81 Ga0068853_100424856 3300005539 Bacteria 1247
82 Ga0070672_100003839 3300005543 Bacteria 9784
83 Ga0070672_100243406 3300005543 Bacteria 1513
84 Ga0070686_100034644 3300005544 Bacteria 3113
85 Ga0070686_100577593 3300005544 Unclassified 883
86 Ga0070696_100020244 3300005546 Bacteria 4510
87 Ga0070696_100024069 3300005546 Bacteria 4139
88 Ga0070693_100005503 3300005547 Bacteria 6090
89 Ga0070693_100020966 3300005547 Bacteria 3454
90 Ga0070693_100116235 3300005547 Bacteria 1653
91 Ga0070665_100000026 3300005548 Bacteria 365176
92 Ga0070665_100166687 3300005548 Bacteria 2205
93 Ga0070665_101130053 3300005548 Bacteria 795
94 Ga0070704_100023598 3300005549 Bacteria 4022
95 Ga0068855_100023255 3300005563 Bacteria 7424
96 Ga0070664_100140066 3300005564 Bacteria 2129
97 Ga0070664_100858102 3300005564 Bacteria 850
98 Ga0068857_100003232 3300005577 Bacteria 13531
99 Ga0068857_100022225 3300005577 Bacteria 5580
100 Ga0068854_100001358 3300005578 Bacteria 14764
101 Ga0068854_100016445 3300005578 Bacteria 4932
102 Ga0068854_100379979 3300005578 Unclassified 1164
103 Ga0068854_101069014 3300005578 Bacteria 718
104 Ga0068856_100039139 3300005614 Bacteria 4655
105 Ga0068856_100407384 3300005614 Bacteria 1379
106 Ga0068852_100009054 3300005616 Bacteria 7370
107 Ga0068852_100077082 3300005616 Bacteria 2945
108 Ga0068852_100627532 3300005616 Unclassified 1081
109 Ga0068864_100241100 3300005618 Bacteria 1675
110 Ga0068851_10007203 3300005834 Bacteria 5097
111 Ga0068851_10177214 3300005834 Bacteria 1179
112 Ga0068870_10002465 3300005840 Bacteria 7709
113 Ga0068863_100024255 3300005841 Bacteria 5785
114 Ga0068863_100165801 3300005841 Bacteria 2118
115 Ga0068863_100208075 3300005841 Bacteria 1883
116 Ga0068858_100293237 3300005842 Bacteria 1551
117 Ga0068858_100300180 3300005842 Bacteria 1532
118 Ga0068860_100000013 3300005843 Bacteria 323055
119 Ga0068860_100078776 3300005843 Bacteria 3133
120 Ga0068862_100290748 3300005844 Bacteria 1501
121 Ga0068862_100700696 3300005844 Bacteria 981
122 Ga0070717_10068967 3300006028 Bacteria 2943
123 Ga0070712_100485299 3300006175 Bacteria 1034
124 Ga0075366_10102550 3300006195 Bacteria 1718
125 Ga0097621_100078784 3300006237 Bacteria 2738
126 Ga0097621_100357389 3300006237 Bacteria 1300
127 Ga0097621_100373563 3300006237 Unclassified 1272
128 Ga0097621_100464936 3300006237 Bacteria 1141
129 Ga0068871_100249468 3300006358 Unclassified 1546
130 Ga0068871_100378315 3300006358 Bacteria 1257
131 Ga0068871_101265394 3300006358 Bacteria 693
132 Ga0075428_100026771 3300006844 Bacteria 6385
133 Ga0075430_100961545 3300006846 Unclassified 704
134 Ga0068865_100158442 3300006881 Bacteria 1724
135 Ga0068865_100233443 3300006881 Bacteria 1444
136 Ga0105240_10000916 3300009093 Bacteria 52586
137 Ga0105240_10036642 3300009093 Bacteria 6307
138 Ga0105240_10077253 3300009093 Bacteria 4102
139 Ga0105240_10136270 3300009093 Bacteria 2940
140 Ga0111539_10192006 3300009094 Bacteria 2383
141 Ga0111539_10258409 3300009094 Bacteria 2028
142 Ga0111539_11052475 3300009094 Bacteria 946
143 Ga0105245_10397949 3300009098 Bacteria 1376
144 Ga0105243_10228228 3300009148 Unclassified 1650
145 Ga0105241_10386680 3300009174 Bacteria 1224
146 Ga0105241_11039633 3300009174 Bacteria 768
147 Ga0105248_11214914 3300009177 Unclassified 852
148 Ga0105237_10000010 3300009545 Bacteria 324528
149 Ga0105237_10655723 3300009545 Bacteria 1056
150 Ga0105238_10011643 3300009551 Bacteria 8862
151 Ga0105238_10098364 3300009551 Bacteria 2910
152 Ga0105238_10206673 3300009551 Bacteria 1939
153 Ga0105239_10000080 3300010375 Bacteria 134982
154 Ga0105239_10267246 3300010375 Bacteria 1923
155 Ga0105239_10525504 3300010375 Bacteria 1346
156 Ga0157373_10058604 3300013100 Bacteria 2730
157 Ga0157373_10528251 3300013100 Bacteria 854
158 Ga0157373_10575460 3300013100 Bacteria 818
159 Ga0157369_10033934 3300013105 Bacteria 5604
160 Ga0157374_10225171 3300013296 Bacteria 1841
161 Ga0157378_10000319 3300013297 Bacteria 47265
162 Ga0157378_10171549 3300013297 Bacteria 2035
163 Ga0163162_10648542 3300013306 Bacteria 1179
164 Ga0163162_10773525 3300013306 Bacteria 1078
165 Ga0157372_10234725 3300013307 Bacteria 2127
166 Ga0157372_11209580 3300013307 Unclassified 873
167 Ga0157375_10292212 3300013308 Bacteria 1793
168 Ga0163163_10226412 3300014325 Bacteria 1919
169 Ga0157380_10033462 3300014326 Bacteria 3958
170 Ga0157380_10192708 3300014326 Unclassified 1801
171 Ga0157380_10195393 3300014326 Bacteria 1790
172 Ga0157380_10334632 3300014326 Bacteria 1409
173 Ga0157380_10669678 3300014326 Unclassified 1038
174 Ga0157380_11301375 3300014326 Bacteria 774
175 Ga0182008_10027622 3300014497 Bacteria 2872
176 Ga0182008_10064723 3300014497 Bacteria 1800
177 Ga0157376_10018171 3300014969 Bacteria 5382
178 Ga0157376_10254183 3300014969 Bacteria 1643
179 Ga0157376_10462863 3300014969 Bacteria 1239
180 Ga0182006_1204995 3300015261 Bacteria 652
181 Ga0182007_10014206 3300015262 Bacteria 3010
182 Ga0163161_10127850 3300017792 Bacteria 1915
183 Ga0163161_10460281 3300017792 Bacteria 1030
184 Ga0209672_100643 3300025228 Bacteria 17974
185 Ga0207427_100105 3300025231 Bacteria 118241
186 Ga0207427_100107 3300025231 Bacteria 116422
187 Ga0207427_109700 3300025231 Bacteria 1025
188 Ga0209437_100039 3300025233 Bacteria 448321
189 Ga0209437_100129 3300025233 Bacteria 184661
190 Ga0209026_1000051 3300025250 Bacteria 250792
191 Ga0209759_1006017 3300025256 Bacteria 4136
192 Ga0209129_1002999 3300025258 Bacteria 7690
193 Ga0209233_1000224 3300025261 Bacteria 103605
194 Ga0209233_1000227 3300025261 Bacteria 102833
195 Ga0209233_1000300 3300025261 Bacteria 59294
196 Ga0209233_1007990 3300025261 Bacteria 3306
197 Ga0209455_1006266 3300025272 Bacteria 3539
198 Ga0209758_1000051 3300025297 Bacteria 342477
199 Ga0209758_1060287 3300025297 Bacteria 1257
200 Ga0209257_1046043 3300025304 Bacteria 1262
201 Ga0207656_10022063 3300025321 Bacteria 2551
202 Ga0207682_10000852 3300025893 Bacteria 14156
203 Ga0207682_10011070 3300025893 Bacteria 3530
204 Ga0207680_10499483 3300025903 Bacteria 866
205 Ga0207647_10034333 3300025904 Bacteria 3239
206 Ga0207645_10050116 3300025907 Bacteria 2666
207 Ga0207643_10002494 3300025908 Bacteria 9941
208 Ga0207705_10052421 3300025909 Bacteria 2937
209 Ga0207707_10000529 3300025912 Bacteria 39088
210 Ga0207707_10010757 3300025912 Bacteria 7951
211 Ga0207707_10110496 3300025912 Bacteria 2403
212 Ga0207707_10439129 3300025912 Bacteria 1117
213 Ga0207695_10000251 3300025913 Bacteria 139891
214 Ga0207695_10000885 3300025913 Bacteria 54423
215 Ga0207695_10049103 3300025913 Bacteria 4451
216 Ga0207695_10064893 3300025913 Bacteria 3756
217 Ga0207671_10000013 3300025914 Bacteria 478458
218 Ga0207671_10430758 3300025914 Bacteria 1050
219 Ga0207671_10481798 3300025914 Bacteria 989
220 Ga0207671_10640928 3300025914 Bacteria 846
221 Ga0207671_10822140 3300025914 Unclassified 736
222 Ga0207693_10156639 3300025915 Bacteria 1791
223 Ga0207693_11053650 3300025915 Bacteria 619
224 Ga0207660_10116675 3300025917 Unclassified 2017
225 Ga0207660_10630600 3300025917 Bacteria 874
226 Ga0207662_10139155 3300025918 Bacteria 1536
227 Ga0207649_10299570 3300025920 Bacteria 1175
228 Ga0207649_10465394 3300025920 Bacteria 956
229 Ga0207652_10404217 3300025921 Bacteria 1232
230 Ga0207694_10055627 3300025924 Bacteria 3071
231 Ga0207694_10073470 3300025924 Bacteria 2676
232 Ga0207694_10105783 3300025924 Bacteria 2234
233 Ga0207694_10122360 3300025924 Bacteria 2078
234 Ga0207650_10250887 3300025925 Bacteria 1433
235 Ga0207659_10011317 3300025926 Bacteria 5635
236 Ga0207659_10079646 3300025926 Bacteria 2417
237 Ga0207700_10002954 3300025928 Bacteria 9807
238 Ga0207664_10153262 3300025929 Bacteria 1959
239 Ga0207690_10000125 3300025932 Bacteria 63317
240 Ga0207690_10005841 3300025932 Bacteria 7281
241 Ga0207690_10378464 3300025932 Bacteria 1124
242 Ga0207709_10151514 3300025935 Unclassified 1606
243 Ga0207709_10446176 3300025935 Bacteria 999
244 Ga0207670_10234602 3300025936 Bacteria 1410
245 Ga0207670_10399828 3300025936 Bacteria 1098
246 Ga0207670_10526834 3300025936 Bacteria 963
247 Ga0207670_10566900 3300025936 Bacteria 929
248 Ga0207669_10041061 3300025937 Bacteria 2689
249 Ga0207704_10006048 3300025938 Bacteria 5610
250 Ga0207691_10001927 3300025940 Bacteria 20242
251 Ga0207691_10008428 3300025940 Bacteria 9900
252 Ga0207691_10018598 3300025940 Bacteria 6585
253 Ga0207711_10125860 3300025941 Bacteria 2292
254 Ga0207689_10024361 3300025942 Bacteria 5078
255 Ga0207689_10477342 3300025942 Unclassified 1044
256 Ga0207661_10317588 3300025944 Bacteria 1400
257 Ga0207667_10000081 3300025949 Bacteria 162100
258 Ga0207667_10335216 3300025949 Bacteria 1544
259 Ga0207667_11168382 3300025949 Unclassified 750
260 Ga0207651_10006473 3300025960 Bacteria 6137
261 Ga0207651_10322891 3300025960 Bacteria 1291
262 Ga0207651_10618584 3300025960 Bacteria 948
263 Ga0207712_10168462 3300025961 Unclassified 1710
264 Ga0207640_10211878 3300025981 Unclassified 1477
265 Ga0207640_10243644 3300025981 Bacteria 1391
266 Ga0207640_10397666 3300025981 Bacteria 1121
267 Ga0207658_10043753 3300025986 Bacteria 3257
268 Ga0207677_10091556 3300026023 Bacteria 2212
269 Ga0207677_10114700 3300026023 Bacteria 2014
270 Ga0207703_10119589 3300026035 Bacteria 2260
271 Ga0207639_10005100 3300026041 Bacteria 8854
272 Ga0207639_10147627 3300026041 Bacteria 1966
273 Ga0207639_10151135 3300026041 Bacteria 1945
274 Ga0207639_10184736 3300026041 Bacteria 1776
275 Ga0207639_11376973 3300026041 Bacteria 662
276 Ga0207678_10019990 3300026067 Bacteria 5885
277 Ga0207678_10237390 3300026067 Bacteria 1561
278 Ga0207678_10308661 3300026067 Unclassified 1360
279 Ga0207678_10598077 3300026067 Bacteria 967
280 Ga0207708_10021543 3300026075 Bacteria 4861
281 Ga0207708_10046788 3300026075 Bacteria 3294
282 Ga0207702_10028481 3300026078 Bacteria 4644
283 Ga0207641_10004281 3300026088 Bacteria 12408
284 Ga0207641_10216586 3300026088 Bacteria 1773
285 Ga0207641_10366113 3300026088 Bacteria 1377
286 Ga0207648_10105594 3300026089 Bacteria 2471
287 Ga0207648_10346726 3300026089 Bacteria 1338
288 Ga0207648_11678188 3300026089 Unclassified 597
289 Ga0207676_10610389 3300026095 Unclassified 1049
290 Ga0207676_10672103 3300026095 Bacteria 1001
291 Ga0207676_10694436 3300026095 Bacteria 985
292 Ga0207674_10000099 3300026116 Bacteria 97953
293 Ga0207674_10011593 3300026116 Bacteria 9901
294 Ga0207674_10020406 3300026116 Bacteria 7159
295 Ga0207675_100047781 3300026118 Bacteria 3995
296 Ga0207683_10007884 3300026121 Bacteria 9107
297 Ga0207683_10095443 3300026121 Bacteria 2651
298 Ga0207698_10840110 3300026142 Bacteria 923
299 Ga0209969_1006486 3300027360 Bacteria 1649
300 Ga0210000_1041517 3300027462 Bacteria 730
301 Ga0209999_1007502 3300027543 Bacteria 1965
302 Ga0209982_1003126 3300027552 Bacteria 2338
303 Ga0209970_1032936 3300027614 Bacteria 905
304 Ga0209983_1002957 3300027665 Bacteria 3671
305 Ga0209974_10004818 3300027876 Bacteria 4784
306 Ga0268266_10000001 3300028379 Bacteria 4040580
307 Ga0268266_10196160 3300028379 Bacteria 1846
308 Ga0268265_10066033 3300028380 Bacteria 2795
309 Ga0268265_10100300 3300028380 Bacteria 2337
310 Ga0268265_10157230 3300028380 Bacteria 1925
311 Ga0268264_10000039 3300028381 Bacteria 376641
312 Ga0268264_10456709 3300028381 Bacteria 1239
313 Ga0265332_10078871 3300031238 Bacteria 1398
314 Ga0307513_10019665 3300031456 Bacteria 8032
315 Ga0307513_10839655 3300031456 Bacteria 625
316 Ga0307508_10255836 3300031616 Bacteria 1346
317 Ga0307416_100508614 3300032002 Bacteria 1270
318 Ga0307415_101278571 3300032126 Bacteria 694
319 Ga0373926_0170348 3300035083 Bacteria 833
320 Ga0395899_0066850 3300037312 Bacteria 2639
321 Ga0395898_0322387 3300037466 Bacteria 1474
322 Ga0395901_0005107 3300038443 Bacteria 13256
323 Ga0436360_1077157 3300039438 Unclassified 644
324 Ga0451791_1616774 3300041451 Bacteria 705
325 Ga0451807_0571001 3300041486 Unclassified 607
326 Ga0451849_1117033 3300041505 Unclassified 1136
327 Ga0439448_0084375 3300042005 Bacteria 1069
328 Ga0439449_0117197 3300042007 Bacteria 988
329 Ga0450918_053097 3300042531 Bacteria 740
330 Ga0495590_0245750 3300046457 Bacteria 665
331 Ga0495638_0000009 3300046460 Bacteria 525345
332 Ga0495638_0000094 3300046460 Bacteria 142168
333 Ga0495638_0003221 3300046460 Bacteria 12910
334 Ga0495650_0000111 3300046471 Bacteria 197931
335 Ga0495580_0120763 3300046472 Bacteria 1819
336 Ga0495582_0022156 3300046473 Bacteria 3476
337 Ga0495606_0000056 3300046507 Bacteria 198575
338 Ga0495640_0349400 3300046533 Bacteria 913
339 Ga0495597_0331421 3300046542 Bacteria 586
340 Ga0495622_0033435 3300046557 Bacteria 2400
341 Ga0495656_0321896 3300046615 Unclassified 797
342 Ga0495625_0009285 3300046660 Bacteria 8246
343 Ga0495588_0150064 3300046674 Bacteria 1232
344 Ga0495658_0000646 3300046683 Bacteria 18837
345 Ga0495670_0000006 3300046691 Bacteria 255322
346 Ga0495649_0007309 3300046694 Bacteria 6750
347 Ga0495649_0090598 3300046694 Bacteria 1630
348 Ga0495581_0142771 3300047315 Bacteria 1397
349 Ga0495672_0120502 3300047320 Bacteria 1395
350 Ga0495672_0149285 3300047320 Unclassified 1213
351 Ga0495673_0283965 3300047469 Bacteria 597
352 Ga0495686_0065650 3300047472 Unclassified 2243
353 Ga0495686_0187237 3300047472 Unclassified 1195
354 Ga0496100_0264275 3300048903 Bacteria 1277
355 Ga0496101_0137371 3300048904 Bacteria 1861
356 Ga0496104_0021593 3300048907 Bacteria 5912
357 Ga0496104_0257109 3300048907 Bacteria 1659
358 Ga0496107_0086864 3300048910 Bacteria 2283
359 Ga0496107_0135432 3300048910 Bacteria 1819
360 Ga0496109_0679718 3300048912 Bacteria 967
361 Ga0496114_0356645 3300048917 Bacteria 1294
362 Ga0496115_0000013 3300048918 Bacteria 213060
363 Ga0496115_0017345 3300048918 Bacteria 5502
364 Ga0496115_0022173 3300048918 Bacteria 4916
365 Ga0496115_0133730 3300048918 Bacteria 2045
366 Ga0496115_0282105 3300048918 Bacteria 1363
367 Ga0496116_0115157 3300048919 Bacteria 1569
368 Ga0496117_0005520 3300048920 Bacteria 13246
369 Ga0496117_0026294 3300048920 Bacteria 4556
370 Ga0496118_0002973 3300048921 Bacteria 21922
371 Ga0496118_0004147 3300048921 Bacteria 17507
372 Ga0496119_0000236 3300048922 Bacteria 77862
373 Ga0496120_0000055 3300048923 Bacteria 180856
374 Ga0496121_0000101 3300048924 Bacteria 195984
375 Ga0496121_0016674 3300048924 Bacteria 7562
376 Ga0496121_0055593 3300048924 Bacteria 3295
377 Ga0496121_0148003 3300048924 Bacteria 1732
378 Ga0496125_0000436 3300048928 Bacteria 76104
379 Ga0496126_0000134 3300048929 Bacteria 169693
380 Ga0496126_0057624 3300048929 Bacteria 3506
381 Ga0496126_0096861 3300048929 Bacteria 2586
382 Ga0495682_0170206 3300049460 Bacteria 775
383 Ga0501037_0113959 3300049573 Bacteria 1946
384 Ga0501040_0084577 3300049576 Bacteria 2201
385 Ga0501040_0466911 3300049576 Bacteria 909
386 Ga0501043_0734423 3300049579 Unclassified 719
387 Ga0501047_0133857 3300049581 Bacteria 2359
388 Ga0501047_0249404 3300049581 Bacteria 1624
389 Ga0501048_0160964 3300049582 Bacteria 1589
390 Ga0501071_0202277 3300049587 Unclassified 1492
391 Ga0501080_0701663 3300049742 Bacteria 892
392 Ga0501044_0131164 3300049823 Bacteria 2500
393 Ga0501044_0588257 3300049823 Bacteria 1007
394 nmdc:mga0k408_309414_c1 3300050493 Bacteria 943
395 nmdc:mga0qj67_371798_c1 3300050509 Unclassified 1154
396 nmdc:mga0qj67_651132_c1 3300050509 Archaea 840
397 nmdc:mga08y16_888032_c1 3300050511 Unclassified 878
398 Ga0500651_0026596 3300053093 Bacteria 3638
399 2630649769 2627854209 Bacteria 3093011
400 2739731235 2739367700 Bacteria 4747630
401 2939614703 2939611941 Bacteria 3892017
402 Ga0068866_10397195
403 JGI24740J21852_10003120
404 JGI24739J22299_10001068
405 JGI24737J22298_10082118
406 JGI25162J39368_1000761
407 JGI25162J39368_1001404
408 JGI25157J39369_1000691
409 JGI25164J39214_1000837
410 JGI25164J39214_1000950
411 JGI25165J46597_1000907
412 JGI25165J46597_1005279
413 JGI25165J46597_1024746
414 JGI25153J46596_10022049
415 rootH1_10035900
416 rootH2_10023246
417 rootL2_10355094
418 JGI26145J50221_1003265
419 Ga0055537_1002117
420 Ga0065165_1002552
421 Ga0070676_10003995
422 Ga0070676_10196330
423 Ga0070676_10371449
424 Ga0070683_100726162
425 Ga0070670_100697706
426 Ga0070670_100747506
427 Ga0070670_100974463
428 Ga0070677_10003439
429 Ga0070677_10291570
430 Ga0070677_10389704
431 Ga0068869_100419830
432 Ga0070666_10484716
433 Ga0070680_100406641
434 Ga0070680_100696888
435 Ga0070682_100055169
436 Ga0070682_100778361
437 Ga0068868_100164398
438 Ga0068868_100188931
439 Ga0070689_100056096
440 Ga0070689_100524820
441 Ga0070691_10079064
442 Ga0070691_10100311
443 Ga0070687_100107624
444 Ga0070692_10086474
445 Ga0070669_100785300
446 Ga0070675_100006493
447 Ga0070675_100054217
448 Ga0070671_100367656
449 Ga0070671_100516048
450 Ga0070674_100011074
451 Ga0070674_100014097
452 Ga0070673_100017751
453 Ga0070673_100117952
454 Ga0070659_100293804
455 Ga0070659_100619320
456 Ga0070659_101034224
457 Ga0070667_100063974
458 Ga0070667_100089979
459 Ga0070667_100312176
460 Ga0070714_100025035
461 Ga0070711_100202060
462 Ga0070700_100017790
463 Ga0070700_100506836
464 Ga0070694_100120841
465 Ga0070694_101353479
466 Ga0070663_100210258
467 Ga0070678_100020929
468 Ga0070678_100441140
469 Ga0070662_100184840
470 Ga0070662_100640422
471 Ga0070681_10000006
472 Ga0070681_10018340
473 Ga0070681_10196745
474 Ga0068867_100714471
475 Ga0070685_10004833
476 Ga0070685_10102233
477 Ga0070685_10203857
478 Ga0070679_100178896
479 Ga0070679_100272131
480 Ga0068853_100014923
481 Ga0068853_100057766
482 Ga0068853_100424856
483 Ga0070672_100003839
484 Ga0070672_100243406
485 Ga0070686_100034644
486 Ga0070686_100577593
487 Ga0070696_100020244
488 Ga0070696_100024069
489 Ga0070693_100005503
490 Ga0070693_100020966
491 Ga0070693_100116235
492 Ga0070665_100000026
493 Ga0070665_100166687
494 Ga0070665_101130053
495 Ga0070704_100023598
496 Ga0068855_100023255
497 Ga0070664_100140066
498 Ga0070664_100858102
499 Ga0068857_100003232
500 Ga0068857_100022225
501 Ga0068854_100001358
502 Ga0068854_100016445
503 Ga0068854_100379979
504 Ga0068854_101069014
505 Ga0068856_100039139
506 Ga0068856_100407384
507 Ga0068852_100009054
508 Ga0068852_100077082
509 Ga0068852_100627532
510 Ga0068864_100241100
511 Ga0068851_10007203
512 Ga0068851_10177214
513 Ga0068870_10002465
514 Ga0068863_100024255
515 Ga0068863_100165801
516 Ga0068863_100208075
517 Ga0068858_100293237
518 Ga0068858_100300180
519 Ga0068860_100000013
520 Ga0068860_100078776
521 Ga0068862_100290748
522 Ga0068862_100700696
523 Ga0070717_10068967
524 Ga0070712_100485299
525 Ga0075366_10102550
526 Ga0097621_100078784
527 Ga0097621_100357389
528 Ga0097621_100373563
529 Ga0097621_100464936
530 Ga0068871_100249468
531 Ga0068871_100378315
532 Ga0068871_101265394
533 Ga0075428_100026771
534 Ga0075430_100961545
535 Ga0068865_100158442
536 Ga0068865_100233443
537 Ga0105240_10000916
538 Ga0105240_10036642
539 Ga0105240_10077253
540 Ga0105240_10136270
541 Ga0111539_10192006
542 Ga0111539_10258409
543 Ga0111539_11052475
544 Ga0105245_10397949
545 Ga0105243_10228228
546 Ga0105241_10386680
547 Ga0105241_11039633
548 Ga0105248_11214914
549 Ga0105237_10000010
550 Ga0105237_10655723
551 Ga0105238_10011643
552 Ga0105238_10098364
553 Ga0105238_10206673
554 Ga0105239_10000080
555 Ga0105239_10267246
556 Ga0105239_10525504
557 Ga0157373_10058604
558 Ga0157373_10528251
559 Ga0157373_10575460
560 Ga0157369_10033934
561 Ga0157374_10225171
562 Ga0157378_10000319
563 Ga0157378_10171549
564 Ga0163162_10648542
565 Ga0163162_10773525
566 Ga0157372_10234725
567 Ga0157372_11209580
568 Ga0157375_10292212
569 Ga0163163_10226412
570 Ga0157380_10033462
571 Ga0157380_10192708
572 Ga0157380_10195393
573 Ga0157380_10334632
574 Ga0157380_10669678
575 Ga0157380_11301375
576 Ga0182008_10027622
577 Ga0182008_10064723
578 Ga0157376_10018171
579 Ga0157376_10254183
580 Ga0157376_10462863
581 Ga0182006_1204995
582 Ga0182007_10014206
583 Ga0163161_10127850
584 Ga0163161_10460281
585 Ga0209672_100643
586 Ga0207427_100105
587 Ga0207427_100107
588 Ga0207427_109700
589 Ga0209437_100039
590 Ga0209437_100129
591 Ga0209026_1000051
592 Ga0209759_1006017
593 Ga0209129_1002999
594 Ga0209233_1000224
595 Ga0209233_1000227
596 Ga0209233_1000300
597 Ga0209233_1007990
598 Ga0209455_1006266
599 Ga0209758_1000051
600 Ga0209758_1060287
601 Ga0209257_1046043
602 Ga0207656_10022063
603 Ga0207682_10000852
604 Ga0207682_10011070
605 Ga0207680_10499483
606 Ga0207647_10034333
607 Ga0207645_10050116
608 Ga0207643_10002494
609 Ga0207705_10052421
610 Ga0207707_10000529
611 Ga0207707_10010757
612 Ga0207707_10110496
613 Ga0207707_10439129
614 Ga0207695_10000251
615 Ga0207695_10000885
616 Ga0207695_10049103
617 Ga0207695_10064893
618 Ga0207671_10000013
619 Ga0207671_10430758
620 Ga0207671_10481798
621 Ga0207671_10640928
622 Ga0207671_10822140
623 Ga0207693_10156639
624 Ga0207693_11053650
625 Ga0207660_10116675
626 Ga0207660_10630600
627 Ga0207662_10139155
628 Ga0207649_10299570
629 Ga0207649_10465394
630 Ga0207652_10404217
631 Ga0207694_10055627
632 Ga0207694_10073470
633 Ga0207694_10105783
634 Ga0207694_10122360
635 Ga0207650_10250887
636 Ga0207659_10011317
637 Ga0207659_10079646
638 Ga0207700_10002954
639 Ga0207664_10153262
640 Ga0207690_10000125
641 Ga0207690_10005841
642 Ga0207690_10378464
643 Ga0207709_10151514
644 Ga0207709_10446176
645 Ga0207670_10234602
646 Ga0207670_10399828
647 Ga0207670_10526834
648 Ga0207670_10566900
649 Ga0207669_10041061
650 Ga0207704_10006048
651 Ga0207691_10001927
652 Ga0207691_10008428
653 Ga0207691_10018598
654 Ga0207711_10125860
655 Ga0207689_10024361
656 Ga0207689_10477342
657 Ga0207661_10317588
658 Ga0207667_10000081
659 Ga0207667_10335216
660 Ga0207667_11168382
661 Ga0207651_10006473
662 Ga0207651_10322891
663 Ga0207651_10618584
664 Ga0207712_10168462
665 Ga0207640_10211878
666 Ga0207640_10243644
667 Ga0207640_10397666
668 Ga0207658_10043753
669 Ga0207677_10091556
670 Ga0207677_10114700
671 Ga0207703_10119589
672 Ga0207639_10005100
673 Ga0207639_10147627
674 Ga0207639_10151135
675 Ga0207639_10184736
676 Ga0207639_11376973
677 Ga0207678_10019990
678 Ga0207678_10237390
679 Ga0207678_10308661
680 Ga0207678_10598077
681 Ga0207708_10021543
682 Ga0207708_10046788
683 Ga0207702_10028481
684 Ga0207641_10004281
685 Ga0207641_10216586
686 Ga0207641_10366113
687 Ga0207648_10105594
688 Ga0207648_10346726
689 Ga0207648_11678188
690 Ga0207676_10610389
691 Ga0207676_10672103
692 Ga0207676_10694436
693 Ga0207674_10000099
694 Ga0207674_10011593
695 Ga0207674_10020406
696 Ga0207675_100047781
697 Ga0207683_10007884
698 Ga0207683_10095443
699 Ga0207698_10840110
700 Ga0209969_1006486
701 Ga0210000_1041517
702 Ga0209999_1007502
703 Ga0209982_1003126
704 Ga0209970_1032936
705 Ga0209983_1002957
706 Ga0209974_10004818
707 Ga0268266_10000001
708 Ga0268266_10196160
709 Ga0268265_10066033
710 Ga0268265_10100300
711 Ga0268265_10157230
712 Ga0268264_10000039
713 Ga0268264_10456709
714 Ga0265332_10078871
715 Ga0307513_10019665
716 Ga0307513_10839655
717 Ga0307508_10255836
718 Ga0307416_100508614
719 Ga0307415_101278571
720 Ga0373926_0170348
721 Ga0395899_0066850
722 Ga0395898_0322387
723 Ga0395901_0005107
724 Ga0436360_1077157
725 Ga0451791_1616774
726 Ga0451807_0571001
727 Ga0451849_1117033
728 Ga0439448_0084375
729 Ga0439449_0117197
730 Ga0450918_053097
731 Ga0495590_0245750
732 Ga0495638_0000009
733 Ga0495638_0000094
734 Ga0495638_0003221
735 Ga0495650_0000111
736 Ga0495580_0120763
737 Ga0495582_0022156
738 Ga0495606_0000056
739 Ga0495640_0349400
740 Ga0495597_0331421
741 Ga0495622_0033435
742 Ga0495656_0321896
743 Ga0495625_0009285
744 Ga0495588_0150064
745 Ga0495658_0000646
746 Ga0495670_0000006
747 Ga0495649_0007309
748 Ga0495649_0090598
749 Ga0495581_0142771
750 Ga0495672_0120502
751 Ga0495672_0149285
752 Ga0495673_0283965
753 Ga0495686_0065650
754 Ga0495686_0187237
755 Ga0496100_0264275
756 Ga0496101_0137371
757 Ga0496104_0021593
758 Ga0496104_0257109
759 Ga0496107_0086864
760 Ga0496107_0135432
761 Ga0496109_0679718
762 Ga0496114_0356645
763 Ga0496115_0000013
764 Ga0496115_0017345
765 Ga0496115_0022173
766 Ga0496115_0133730
767 Ga0496115_0282105
768 Ga0496116_0115157
769 Ga0496117_0005520
770 Ga0496117_0026294
771 Ga0496118_0002973
772 Ga0496118_0004147
773 Ga0496119_0000236
774 Ga0496120_0000055
775 Ga0496121_0000101
776 Ga0496121_0016674
777 Ga0496121_0055593
778 Ga0496121_0148003
779 Ga0496125_0000436
780 Ga0496126_0000134
781 Ga0496126_0057624
782 Ga0496126_0096861
783 Ga0495682_0170206
784 Ga0501037_0113959
785 Ga0501040_0084577
786 Ga0501040_0466911
787 Ga0501043_0734423
788 Ga0501047_0133857
789 Ga0501047_0249404
790 Ga0501048_0160964
791 Ga0501071_0202277
792 Ga0501080_0701663
793 Ga0501044_0131164
794 Ga0501044_0588257
795 nmdc:mga0k408_309414_c1
796 nmdc:mga0qj67_371798_c1
797 nmdc:mga0qj67_651132_c1
798 nmdc:mga08y16_888032_c1
799 Ga0500651_0026596
800 2630649769
801 2739731235
802 2939614703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13858

DUF4199

Protein of unknown function (DUF4199)

37

201

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ooq-assembly1.cif.gz_A nitroreductase from e-coli in complex with the inhibitor dicoumarol 0.5534 105 166
8w6i-assembly1.cif.gz_A cryo-em structure of escherichia coli str k12 ftsex complex with atp-gamma-s in peptidisc 0.5269 34 167
8hd0-assembly1.cif.gz_D cell divisome spg hydrolysis machinery ftsex-envc 0.4936 33 174
7v8l-assembly1.cif.gz_C lolcde with bound rcsf in nanodiscs 0.4912 34 168
5xu1-assembly1.cif.gz_M structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.4711 37 175
ID Description Score Start End Superfamily
af_Q2QQD1_96_187_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.5662 101 169 1.10.287.110
af_Q54SV5_129_469_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4755 3 118 1.20.120.550
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4464 3 168 1.20.140.150
af_A0A1D6JR45_49_209_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4257 7 171 1.10.1760.20
af_A0A143ZY25_2_123_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4224 7 165 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A1V3PG59-F1-model_v4 DUF4199 domain-containing protein 0.9832 67 178 GO:0016020
AF-A0A1V3PG59-F1-model_v4 DUF4199 domain-containing protein 0.9746 67 178 GO:0016020
AF-L8JHL3-F1-model_v4 DUF4199 domain-containing protein 0.9657 1 176 GO:0016020
AF-L8JHL3-F1-model_v4 DUF4199 domain-containing protein 0.9604 1 176 GO:0016020
AF-A0A223NUA9-F1-model_v4 DUF4199 domain-containing protein 0.9548 3 169 GO:0016020

Map