F434816

General Info

Members Datasets Scaffolds Average Seq Length
401 204 802 134

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10099210|Ga0075370_100992101
Length 147
Sequence MSGKIVSRKVLFAALGATVLVAGPLAAHHSTAMFEWGKEMPMKEATVDKWEWTNPHTFLYVTVKERDGKLHKWALEGMSPNHLIRYGWSKNAVKPGDKVNLTYYPLRDKRRGGFNVTITKADGKKLYQFGEGGSQTAKAQAEGAKKN

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 1.25
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 23.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10099210 3300006353 Bacteria 1684
2 MRS1b_contig_7525407 2162886011 Bacteria 1094
3 JGI24746J21847_1013603 3300001977 Unclassified 1181
4 Ga0065704_10181847 3300005289 Bacteria 1233
5 Ga0065704_10240174 3300005289 Unclassified 1001
6 Ga0065712_10035346 3300005290 Unclassified 944
7 Ga0065712_10203782 3300005290 Bacteria 1098
8 Ga0065712_10296296 3300005290 Bacteria 843
9 Ga0065715_10094100 3300005293 Bacteria 4444
10 Ga0065715_10117223 3300005293 Bacteria 2355
11 Ga0065715_10223959 3300005293 Bacteria 1260
12 Ga0065707_10117977 3300005295 Bacteria 2197
13 Ga0065707_10118737 3300005295 Bacteria 2178
14 Ga0070658_10466089 3300005327 Bacteria 1089
15 Ga0070658_11308106 3300005327 Bacteria 629
16 Ga0070658_11721198 3300005327 Bacteria 543
17 Ga0070676_10362883 3300005328 Bacteria 999
18 Ga0070676_10507759 3300005328 Unclassified 857
19 Ga0070676_10645525 3300005328 Bacteria 768
20 Ga0070676_11363985 3300005328 Bacteria 543
21 Ga0070683_100044463 3300005329 Bacteria 4095
22 Ga0070683_100321109 3300005329 Bacteria 1474
23 Ga0070683_102111009 3300005329 Unclassified 541
24 Ga0070690_100197174 3300005330 Bacteria 1399
25 Ga0070670_101127887 3300005331 Bacteria 716
26 Ga0070677_10300422 3300005333 Bacteria 815
27 Ga0068869_100431326 3300005334 Bacteria 1089
28 Ga0068869_100624960 3300005334 Unclassified 912
29 Ga0070666_11307258 3300005335 Unclassified 541
30 Ga0070680_100138564 3300005336 Bacteria 2039
31 Ga0070680_100675754 3300005336 Unclassified 888
32 Ga0070682_101393525 3300005337 Bacteria 599
33 Ga0070660_100009094 3300005339 Bacteria 6973
34 Ga0070660_100265041 3300005339 Bacteria 1403
35 Ga0070660_100562634 3300005339 Bacteria 952
36 Ga0070689_100019558 3300005340 Bacteria 5009
37 Ga0070691_10025318 3300005341 Unclassified 2763
38 Ga0070687_100000568 3300005343 Bacteria 12288
39 Ga0070687_100013340 3300005343 Bacteria 3660
40 Ga0070661_100034966 3300005344 Bacteria 3646
41 Ga0070661_100456422 3300005344 Unclassified 1017
42 Ga0070661_100845068 3300005344 Unclassified 753
43 Ga0070692_10026726 3300005345 Unclassified 2856
44 Ga0070692_10790341 3300005345 Unclassified 647
45 Ga0070669_100007858 3300005353 Bacteria 7624
46 Ga0070675_100000394 3300005354 Bacteria 29614
47 Ga0070675_100396389 3300005354 Unclassified 1231
48 Ga0070675_100949137 3300005354 Bacteria 789
49 Ga0070675_101188460 3300005354 Unclassified 702
50 Ga0070671_100051850 3300005355 Unclassified 3412
51 Ga0070671_100430288 3300005355 Unclassified 1131
52 Ga0070673_100059168 3300005364 Unclassified 3032
53 Ga0070673_100087526 3300005364 Bacteria 2539
54 Ga0070673_100232542 3300005364 Bacteria 1599
55 Ga0070673_100596885 3300005364 Unclassified 1007
56 Ga0070688_100014797 3300005365 Bacteria 4426
57 Ga0070659_100053676 3300005366 Bacteria 3173
58 Ga0070659_100304857 3300005366 Bacteria 1329
59 Ga0070659_100411582 3300005366 Bacteria 1143
60 Ga0070659_101025510 3300005366 Bacteria 725
61 Ga0070703_10110768 3300005406 Bacteria 982
62 Ga0070703_10164764 3300005406 Bacteria 844
63 Ga0070713_100041072 3300005436 Archaea 3766
64 Ga0070701_10003048 3300005438 Bacteria 6566
65 Ga0070701_10260646 3300005438 Bacteria 1051
66 Ga0070701_10333214 3300005438 Unclassified 943
67 Ga0070705_100000117 3300005440 Bacteria 45768
68 Ga0070705_100125737 3300005440 Bacteria 1664
69 Ga0070705_100128469 3300005440 Bacteria 1649
70 Ga0070705_100129367 3300005440 Bacteria 1644
71 Ga0070700_100163893 3300005441 Bacteria 1533
72 Ga0070700_100346312 3300005441 Bacteria 1100
73 Ga0070694_100001927 3300005444 Bacteria 12291
74 Ga0070694_100005957 3300005444 Bacteria 7392
75 Ga0070694_101151124 3300005444 Unclassified 649
76 Ga0070694_101814160 3300005444 Bacteria 520
77 Ga0070708_100218822 3300005445 Bacteria 1786
78 Ga0070663_100029532 3300005455 Bacteria 3748
79 Ga0070663_100462609 3300005455 Bacteria 1047
80 Ga0070678_100874575 3300005456 Unclassified 820
81 Ga0070662_100002177 3300005457 Bacteria 12015
82 Ga0070662_100005531 3300005457 Bacteria 8075
83 Ga0070662_100212545 3300005457 Bacteria 1540
84 Ga0070662_100582185 3300005457 Bacteria 940
85 Ga0070681_10127802 3300005458 Bacteria 2474
86 Ga0068867_100000122 3300005459 Bacteria 49681
87 Ga0068867_101238472 3300005459 Bacteria 687
88 Ga0070685_10402744 3300005466 Bacteria 948
89 Ga0070706_100652233 3300005467 Unclassified 977
90 Ga0070707_100063844 3300005468 Bacteria 3534
91 Ga0070707_100485811 3300005468 Bacteria 1196
92 Ga0070698_100019982 3300005471 Bacteria 7023
93 Ga0070699_100032061 3300005518 Bacteria 4538
94 Ga0070699_100043898 3300005518 Bacteria 3869
95 Ga0070699_100332948 3300005518 Bacteria 1366
96 Ga0070679_100005220 3300005530 Bacteria 12022
97 Ga0070679_100358135 3300005530 Bacteria 1406
98 Ga0070679_100390119 3300005530 Bacteria 1339
99 Ga0070679_100562655 3300005530 Unclassified 1084
100 Ga0070679_101198473 3300005530 Bacteria 704
101 Ga0070679_101998442 3300005530 Unclassified 529
102 Ga0070684_100052357 3300005535 Bacteria 3550
103 Ga0070684_100088936 3300005535 Unclassified 2744
104 Ga0070684_100255513 3300005535 Bacteria 1602
105 Ga0070697_100062270 3300005536 Unclassified 3045
106 Ga0070697_101218566 3300005536 Bacteria 671
107 Ga0070672_100028484 3300005543 Bacteria 4179
108 Ga0070672_100996064 3300005543 Bacteria 742
109 Ga0070686_100012704 3300005544 Bacteria 4805
110 Ga0070686_100420433 3300005544 Bacteria 1021
111 Ga0070686_101604003 3300005544 Bacteria 550
112 Ga0070695_100002001 3300005545 Bacteria 11610
113 Ga0070695_100046344 3300005545 Bacteria 2774
114 Ga0070695_100097373 3300005545 Bacteria 1975
115 Ga0070695_100671327 3300005545 Bacteria 820
116 Ga0070696_100000508 3300005546 Bacteria 24591
117 Ga0070696_100004755 3300005546 Bacteria 9069
118 Ga0070696_100139714 3300005546 Bacteria 1769
119 Ga0070696_100745881 3300005546 Unclassified 802
120 Ga0070693_101163073 3300005547 Unclassified 591
121 Ga0070665_101605621 3300005548 Bacteria 658
122 Ga0070704_100000568 3300005549 Bacteria 17823
123 Ga0070704_100297840 3300005549 Unclassified 1343
124 Ga0068855_100004512 3300005563 Bacteria 17012
125 Ga0068855_101221967 3300005563 Bacteria 781
126 Ga0070664_100018795 3300005564 Bacteria 5682
127 Ga0070664_100021297 3300005564 Bacteria 5342
128 Ga0070664_100031813 3300005564 Bacteria 4411
129 Ga0070664_100148630 3300005564 Bacteria 2067
130 Ga0070664_100659011 3300005564 Unclassified 973
131 Ga0070664_101122966 3300005564 Bacteria 741
132 Ga0068857_100046766 3300005577 Bacteria 3841
133 Ga0068857_100117174 3300005577 Bacteria 2397
134 Ga0068857_100287455 3300005577 Bacteria 1513
135 Ga0068854_100731176 3300005578 Bacteria 857
136 Ga0070702_100017651 3300005615 Unclassified 3686
137 Ga0070702_100038509 3300005615 Unclassified 2663
138 Ga0070702_100302594 3300005615 Bacteria 1107
139 Ga0068852_100555809 3300005616 Bacteria 1148
140 Ga0068859_100002045 3300005617 Bacteria 20605
141 Ga0068859_100044512 3300005617 Bacteria 4459
142 Ga0068859_100136903 3300005617 Bacteria 2522
143 Ga0068859_100148852 3300005617 Bacteria 2417
144 Ga0068864_100213801 3300005618 Bacteria 1777
145 Ga0068861_100214216 3300005719 Bacteria 1624
146 Ga0068861_100454363 3300005719 Unclassified 1149
147 Ga0068870_10000753 3300005840 Bacteria 12457
148 Ga0068870_10027545 3300005840 Bacteria 2844
149 Ga0068863_100040429 3300005841 Unclassified 4434
150 Ga0068863_100959785 3300005841 Bacteria 857
151 Ga0068863_102396163 3300005841 Unclassified 537
152 Ga0068858_100153922 3300005842 Bacteria 2163
153 Ga0068860_100005934 3300005843 Bacteria 12292
154 Ga0068860_100205408 3300005843 Unclassified 1910
155 Ga0068862_100000153 3300005844 Bacteria 78432
156 Ga0068862_100252830 3300005844 Unclassified 1607
157 Ga0070717_10226662 3300006028 Bacteria 1644
158 Ga0070715_10385534 3300006163 Bacteria 775
159 Ga0097621_100108600 3300006237 Unclassified 2342
160 Ga0075370_10464549 3300006353 Bacteria 762
161 Ga0075370_10648400 3300006353 Bacteria 641
162 Ga0068871_100149262 3300006358 Bacteria 1992
163 Ga0068871_100149847 3300006358 Unclassified 1988
164 Ga0075428_100005289 3300006844 Bacteria 14346
165 Ga0075428_100636594 3300006844 Bacteria 1138
166 Ga0075433_10084206 3300006852 Unclassified 2807
167 Ga0075433_10084632 3300006852 Bacteria 2799
168 Ga0075433_11296277 3300006852 Bacteria 631
169 Ga0075434_100026943 3300006871 Bacteria 5639
170 Ga0075434_100161349 3300006871 Unclassified 2262
171 Ga0075434_100497908 3300006871 Bacteria 1239
172 Ga0075434_100877789 3300006871 Bacteria 912
173 Ga0068865_100619203 3300006881 Bacteria 917
174 Ga0068865_100640863 3300006881 Bacteria 902
175 Ga0068865_100948864 3300006881 Bacteria 751
176 Ga0075436_100556527 3300006914 Bacteria 842
177 Ga0097620_100002045 3300006931 Bacteria 20605
178 Ga0097620_100044512 3300006931 Bacteria 4459
179 Ga0097620_100136905 3300006931 Bacteria 2522
180 Ga0097620_100148852 3300006931 Bacteria 2417
181 Ga0075435_100069140 3300007076 Unclassified 2878
182 Ga0075435_100111510 3300007076 Bacteria 2275
183 Ga0075435_100149644 3300007076 Unclassified 1962
184 Ga0075435_100297590 3300007076 Bacteria 1380
185 Ga0111539_10022043 3300009094 Bacteria 7828
186 Ga0111539_10212628 3300009094 Bacteria 2253
187 Ga0111539_11060052 3300009094 Bacteria 942
188 Ga0114129_10010816 3300009147 Bacteria 13001
189 Ga0114129_10031019 3300009147 Bacteria 7560
190 Ga0114129_10054253 3300009147 Bacteria 5620
191 Ga0114129_11179387 3300009147 Bacteria 955
192 Ga0114129_11775100 3300009147 Unclassified 751
193 Ga0105243_10006614 3300009148 Bacteria 8950
194 Ga0105241_12149010 3300009174 Unclassified 553
195 Ga0105242_10076187 3300009176 Unclassified 2795
196 Ga0105248_11414428 3300009177 Bacteria 787
197 Ga0105248_11429598 3300009177 Bacteria 783
198 Ga0105246_10000171 3300011119 Bacteria 31499
199 Ga0105246_10208370 3300011119 Bacteria 1524
200 Ga0157373_10003741 3300013100 Bacteria 11511
201 Ga0157370_10170327 3300013104 Bacteria 2024
202 Ga0157370_10708905 3300013104 Bacteria 918
203 Ga0157370_10924742 3300013104 Bacteria 791
204 Ga0157374_10440333 3300013296 Bacteria 1304
205 Ga0157374_10918766 3300013296 Bacteria 893
206 Ga0163162_10005990 3300013306 Bacteria 11774
207 Ga0157375_10002513 3300013308 Bacteria 15910
208 Ga0157375_10224066 3300013308 Bacteria 2039
209 Ga0157375_10266507 3300013308 Bacteria 1874
210 Ga0157375_10339658 3300013308 Bacteria 1667
211 Ga0157375_12966150 3300013308 Unclassified 567
212 Ga0157380_10128137 3300014326 Bacteria 2161
213 Ga0157377_10060083 3300014745 Bacteria 2169
214 Ga0157377_10241824 3300014745 Bacteria 1165
215 Ga0157377_10390396 3300014745 Bacteria 945
216 Ga0157376_10069173 3300014969 Unclassified 2992
217 Ga0157376_11160050 3300014969 Bacteria 800
218 Ga0157376_11307679 3300014969 Bacteria 755
219 Ga0213875_10007834 3300021388 Bacteria 5487
220 Ga0213875_10292102 3300021388 Unclassified 770
221 Ga0207697_10125423 3300025315 Bacteria 1107
222 Ga0207682_10183634 3300025893 Bacteria 956
223 Ga0207688_10324478 3300025901 Unclassified 945
224 Ga0207680_10243526 3300025903 Bacteria 1240
225 Ga0207647_10417778 3300025904 Bacteria 754
226 Ga0207645_10077527 3300025907 Bacteria 2129
227 Ga0207643_10005482 3300025908 Bacteria 6783
228 Ga0207643_10080584 3300025908 Unclassified 1886
229 Ga0207705_10000948 3300025909 Bacteria 23681
230 Ga0207705_10565197 3300025909 Bacteria 884
231 Ga0207707_10015490 3300025912 Bacteria 6642
232 Ga0207707_11599671 3300025912 Unclassified 513
233 Ga0207660_10523523 3300025917 Bacteria 963
234 Ga0207662_10009853 3300025918 Bacteria 5272
235 Ga0207662_10029616 3300025918 Bacteria 3173
236 Ga0207657_10264356 3300025919 Bacteria 1369
237 Ga0207657_10264357 3300025919 Bacteria 1369
238 Ga0207657_10642278 3300025919 Bacteria 826
239 Ga0207649_10049455 3300025920 Bacteria 2597
240 Ga0207649_10415360 3300025920 Unclassified 1009
241 Ga0207652_10000816 3300025921 Bacteria 29752
242 Ga0207652_10026238 3300025921 Bacteria 4850
243 Ga0207652_10075835 3300025921 Bacteria 2931
244 Ga0207652_10195634 3300025921 Bacteria 1819
245 Ga0207652_10368337 3300025921 Bacteria 1297
246 Ga0207646_10129633 3300025922 Bacteria 2269
247 Ga0207646_10149067 3300025922 Unclassified 2109
248 Ga0207646_10952560 3300025922 Unclassified 760
249 Ga0207681_10005157 3300025923 Bacteria 8023
250 Ga0207650_10015483 3300025925 Bacteria 5312
251 Ga0207659_10000162 3300025926 Bacteria 39794
252 Ga0207659_10125715 3300025926 Unclassified 1971
253 Ga0207687_10181968 3300025927 Bacteria 1629
254 Ga0207700_10244358 3300025928 Bacteria 1531
255 Ga0207644_10058574 3300025931 Unclassified 2784
256 Ga0207644_10235668 3300025931 Bacteria 1456
257 Ga0207690_10152084 3300025932 Bacteria 1716
258 Ga0207690_10529517 3300025932 Bacteria 956
259 Ga0207690_11183032 3300025932 Bacteria 638
260 Ga0207706_10009731 3300025933 Bacteria 8821
261 Ga0207706_10011154 3300025933 Bacteria 8191
262 Ga0207706_10113837 3300025933 Bacteria 2379
263 Ga0207706_11501544 3300025933 Archaea 550
264 Ga0207686_10394486 3300025934 Unclassified 1052
265 Ga0207709_10030663 3300025935 Unclassified 3131
266 Ga0207670_10001956 3300025936 Bacteria 10803
267 Ga0207670_10012613 3300025936 Bacteria 4951
268 Ga0207670_10451081 3300025936 Unclassified 1037
269 Ga0207704_10039124 3300025938 Bacteria 2758
270 Ga0207704_10358052 3300025938 Bacteria 1138
271 Ga0207691_10042673 3300025940 Bacteria 4180
272 Ga0207691_10361652 3300025940 Bacteria 1241
273 Ga0207691_10493926 3300025940 Bacteria 1040
274 Ga0207711_10758861 3300025941 Bacteria 904
275 Ga0207689_10127392 3300025942 Bacteria 2094
276 Ga0207689_10540365 3300025942 Bacteria 978
277 Ga0207661_10084452 3300025944 Bacteria 2630
278 Ga0207661_10093475 3300025944 Bacteria 2510
279 Ga0207679_10061621 3300025945 Bacteria 2793
280 Ga0207679_10114536 3300025945 Bacteria 2135
281 Ga0207679_10198198 3300025945 Bacteria 1675
282 Ga0207679_10543675 3300025945 Unclassified 1041
283 Ga0207679_10709880 3300025945 Bacteria 913
284 Ga0207667_10003940 3300025949 Bacteria 18265
285 Ga0207667_10912881 3300025949 Bacteria 869
286 Ga0207651_10007676 3300025960 Bacteria 5761
287 Ga0207651_10083706 3300025960 Unclassified 2308
288 Ga0207651_10166786 3300025960 Bacteria 1732
289 Ga0207712_10241156 3300025961 Unclassified 1456
290 Ga0207658_10777442 3300025986 Unclassified 868
291 Ga0207677_10576683 3300026023 Unclassified 984
292 Ga0207703_10007015 3300026035 Bacteria 8966
293 Ga0207678_10009978 3300026067 Bacteria 8333
294 Ga0207678_10045639 3300026067 Bacteria 3789
295 Ga0207708_10105344 3300026075 Bacteria 2186
296 Ga0207641_10020612 3300026088 Bacteria 5417
297 Ga0207641_10207824 3300026088 Unclassified 1809
298 Ga0207641_10279925 3300026088 Bacteria 1569
299 Ga0207648_10001478 3300026089 Bacteria 25869
300 Ga0207648_10698092 3300026089 Bacteria 940
301 Ga0207676_10049203 3300026095 Bacteria 3277
302 Ga0207676_10094794 3300026095 Bacteria 2460
303 Ga0207674_10063136 3300026116 Bacteria 3740
304 Ga0207674_10936465 3300026116 Unclassified 835
305 Ga0207675_100003045 3300026118 Bacteria 16444
306 Ga0207675_100040433 3300026118 Unclassified 4355
307 Ga0207675_100455428 3300026118 Bacteria 1268
308 Ga0207683_10876438 3300026121 Unclassified 833
309 Ga0207698_10928986 3300026142 Bacteria 878
310 Ga0207428_10001088 3300027907 Bacteria 29609
311 Ga0268265_10002632 3300028380 Bacteria 13333
312 Ga0268265_11624690 3300028380 Unclassified 651
313 Ga0268264_10027667 3300028381 Bacteria 4634
314 Ga0268264_10236870 3300028381 Unclassified 1689
315 Ga0307412_11034722 3300031911 Bacteria 727
316 Ga0373938_0230592 3300034957 Bacteria 523
317 Ga0373940_0047028 3300035088 Bacteria 1202
318 Ga0373955_0299134 3300035172 Bacteria 970
319 Ga0373962_0057456 3300035242 Bacteria 1135
320 Ga0373937_0010442 3300036401 Bacteria 8109
321 Ga0316584_0270810 3300036712 Bacteria 1236
322 Ga0373925_0177784 3300037068 Bacteria 1683
323 Ga0436364_0169818 3300037853 Unclassified 912
324 Ga0436364_0295060 3300037853 Bacteria 4032
325 Ga0451800_0620451 3300041459 Bacteria 566
326 Ga0450912_018946 3300042116 Bacteria 653
327 Ga0451577_0578940 3300042876 Unclassified 1019
328 Ga0451576_0017796 3300045051 Bacteria 7806
329 Ga0451576_0026005 3300045051 Bacteria 6299
330 Ga0451576_0029457 3300045051 Bacteria 5873
331 Ga0451576_0048282 3300045051 Unclassified 4472
332 Ga0495603_0007677 3300046455 Bacteria 6497
333 Ga0495580_0397399 3300046472 Unclassified 930
334 Ga0495584_0088709 3300046491 Bacteria 1559
335 Ga0495584_0475824 3300046491 Unclassified 636
336 Ga0495594_0057083 3300046499 Unclassified 2156
337 Ga0495606_0001390 3300046507 Bacteria 32713
338 Ga0495642_0024568 3300046528 Unclassified 2384
339 Ga0495665_0347850 3300046531 Unclassified 755
340 Ga0495609_0008288 3300046538 Bacteria 5095
341 Ga0495609_0078679 3300046538 Bacteria 1443
342 Ga0495621_0021486 3300046539 Bacteria 2128
343 Ga0495621_0081274 3300046539 Bacteria 1209
344 Ga0495621_0091721 3300046539 Unclassified 1145
345 Ga0495621_0273649 3300046539 Unclassified 694
346 Ga0495625_0150627 3300046660 Unclassified 1564
347 Ga0495659_0002792 3300046664 Bacteria 5610
348 Ga0495659_0012738 3300046664 Unclassified 2730
349 Ga0495659_0040926 3300046664 Bacteria 1654
350 Ga0495659_0109920 3300046664 Unclassified 1076
351 Ga0495659_0125735 3300046664 Bacteria 1013
352 Ga0495659_0165042 3300046664 Bacteria 896
353 Ga0495659_0282637 3300046664 Bacteria 697
354 Ga0495588_0017146 3300046674 Bacteria 3511
355 Ga0495658_0605648 3300046683 Bacteria 702
356 Ga0495669_0012877 3300046684 Unclassified 3561
357 Ga0495669_0088097 3300046684 Bacteria 1431
358 Ga0495671_0012649 3300046692 Bacteria 4601
359 Ga0495636_0007662 3300047318 Bacteria 4245
360 Ga0495636_0012770 3300047318 Unclassified 3327
361 Ga0495685_120164 3300047447 Bacteria 863
362 Ga0495686_0000756 3300047472 Bacteria 42637
363 Ga0495686_0007003 3300047472 Bacteria 8520
364 Ga0496104_1048349 3300048907 Bacteria 719
365 Ga0496105_1084933 3300048908 Bacteria 595
366 Ga0496106_0332290 3300048909 Bacteria 1220
367 Ga0496114_0298955 3300048917 Bacteria 1421
368 Ga0501033_0139350 3300049570 Bacteria 1754
369 Ga0501034_0249104 3300049571 Bacteria 1721
370 Ga0501038_0748881 3300049574 Bacteria 729
371 Ga0501043_0111016 3300049579 Bacteria 2153
372 Ga0501238_011429 3300049671 Bacteria 1194
373 Ga0501035_0553478 3300049822 Bacteria 942
374 Ga0501044_0027237 3300049823 Bacteria 6043
375 nmdc:mga0k408_197957_c1 3300050493 Bacteria 1199
376 nmdc:mga07m45_26702_c1 3300050496 Bacteria 3175
377 nmdc:mga07m45_876067_c1 3300050496 Bacteria 514
378 nmdc:mga05p37_14126_c1 3300050507 Bacteria 9584
379 nmdc:mga05p37_390157_c1 3300050507 Bacteria 1629
380 nmdc:mga05p37_3906_c1 3300050507 Bacteria 17445
381 nmdc:mga08y16_3684_c1 3300050511 Bacteria 15953
382 nmdc:mga0n895_132748_c1 3300050512 Unclassified 2516
383 nmdc:mga0n895_253692_c1 3300050512 Unclassified 1785
384 nmdc:mga0n895_392124_c1 3300050512 Bacteria 1405
385 nmdc:mga0n895_47661_c1 3300050512 Unclassified 4191
386 nmdc:mga0n895_9053_c1 3300050512 Bacteria 8686
387 nmdc:mga0rr50_169077_c1 3300050513 Unclassified 1780
388 nmdc:mga0rr50_372767_c1 3300050513 Bacteria 1203
389 nmdc:mga0rr50_570049_c1 3300050513 Unclassified 964
390 nmdc:mga0rr50_93241_c1 3300050513 Bacteria 2349
391 nmdc:mga0a205_130908_c1 3300050515 Unclassified 2409
392 nmdc:mga0a205_188930_c1 3300050515 Bacteria 1953
393 nmdc:mga0a205_46931_c1 3300050515 Unclassified 4167
394 Ga0500643_002329 3300053087 Bacteria 9940
395 Ga0500594_0028167 3300053118 Bacteria 1460
396 Ga0500559_0211448 3300053136 Bacteria 915
397 Ga0500568_0145384 3300053139 Bacteria 878
398 Ga0500573_0249315 3300053140 Bacteria 916
399 Ga0500588_0059222 3300053146 Bacteria 1221
400 Ga0500616_0058381 3300053153 Bacteria 2007
401 2896187079 2896184354 Bacteria 3258548
402 Ga0075370_10099210
403 MRS1b_contig_7525407
404 JGI24746J21847_1013603
405 Ga0065704_10181847
406 Ga0065704_10240174
407 Ga0065712_10035346
408 Ga0065712_10203782
409 Ga0065712_10296296
410 Ga0065715_10094100
411 Ga0065715_10117223
412 Ga0065715_10223959
413 Ga0065707_10117977
414 Ga0065707_10118737
415 Ga0070658_10466089
416 Ga0070658_11308106
417 Ga0070658_11721198
418 Ga0070676_10362883
419 Ga0070676_10507759
420 Ga0070676_10645525
421 Ga0070676_11363985
422 Ga0070683_100044463
423 Ga0070683_100321109
424 Ga0070683_102111009
425 Ga0070690_100197174
426 Ga0070670_101127887
427 Ga0070677_10300422
428 Ga0068869_100431326
429 Ga0068869_100624960
430 Ga0070666_11307258
431 Ga0070680_100138564
432 Ga0070680_100675754
433 Ga0070682_101393525
434 Ga0070660_100009094
435 Ga0070660_100265041
436 Ga0070660_100562634
437 Ga0070689_100019558
438 Ga0070691_10025318
439 Ga0070687_100000568
440 Ga0070687_100013340
441 Ga0070661_100034966
442 Ga0070661_100456422
443 Ga0070661_100845068
444 Ga0070692_10026726
445 Ga0070692_10790341
446 Ga0070669_100007858
447 Ga0070675_100000394
448 Ga0070675_100396389
449 Ga0070675_100949137
450 Ga0070675_101188460
451 Ga0070671_100051850
452 Ga0070671_100430288
453 Ga0070673_100059168
454 Ga0070673_100087526
455 Ga0070673_100232542
456 Ga0070673_100596885
457 Ga0070688_100014797
458 Ga0070659_100053676
459 Ga0070659_100304857
460 Ga0070659_100411582
461 Ga0070659_101025510
462 Ga0070703_10110768
463 Ga0070703_10164764
464 Ga0070713_100041072
465 Ga0070701_10003048
466 Ga0070701_10260646
467 Ga0070701_10333214
468 Ga0070705_100000117
469 Ga0070705_100125737
470 Ga0070705_100128469
471 Ga0070705_100129367
472 Ga0070700_100163893
473 Ga0070700_100346312
474 Ga0070694_100001927
475 Ga0070694_100005957
476 Ga0070694_101151124
477 Ga0070694_101814160
478 Ga0070708_100218822
479 Ga0070663_100029532
480 Ga0070663_100462609
481 Ga0070678_100874575
482 Ga0070662_100002177
483 Ga0070662_100005531
484 Ga0070662_100212545
485 Ga0070662_100582185
486 Ga0070681_10127802
487 Ga0068867_100000122
488 Ga0068867_101238472
489 Ga0070685_10402744
490 Ga0070706_100652233
491 Ga0070707_100063844
492 Ga0070707_100485811
493 Ga0070698_100019982
494 Ga0070699_100032061
495 Ga0070699_100043898
496 Ga0070699_100332948
497 Ga0070679_100005220
498 Ga0070679_100358135
499 Ga0070679_100390119
500 Ga0070679_100562655
501 Ga0070679_101198473
502 Ga0070679_101998442
503 Ga0070684_100052357
504 Ga0070684_100088936
505 Ga0070684_100255513
506 Ga0070697_100062270
507 Ga0070697_101218566
508 Ga0070672_100028484
509 Ga0070672_100996064
510 Ga0070686_100012704
511 Ga0070686_100420433
512 Ga0070686_101604003
513 Ga0070695_100002001
514 Ga0070695_100046344
515 Ga0070695_100097373
516 Ga0070695_100671327
517 Ga0070696_100000508
518 Ga0070696_100004755
519 Ga0070696_100139714
520 Ga0070696_100745881
521 Ga0070693_101163073
522 Ga0070665_101605621
523 Ga0070704_100000568
524 Ga0070704_100297840
525 Ga0068855_100004512
526 Ga0068855_101221967
527 Ga0070664_100018795
528 Ga0070664_100021297
529 Ga0070664_100031813
530 Ga0070664_100148630
531 Ga0070664_100659011
532 Ga0070664_101122966
533 Ga0068857_100046766
534 Ga0068857_100117174
535 Ga0068857_100287455
536 Ga0068854_100731176
537 Ga0070702_100017651
538 Ga0070702_100038509
539 Ga0070702_100302594
540 Ga0068852_100555809
541 Ga0068859_100002045
542 Ga0068859_100044512
543 Ga0068859_100136903
544 Ga0068859_100148852
545 Ga0068864_100213801
546 Ga0068861_100214216
547 Ga0068861_100454363
548 Ga0068870_10000753
549 Ga0068870_10027545
550 Ga0068863_100040429
551 Ga0068863_100959785
552 Ga0068863_102396163
553 Ga0068858_100153922
554 Ga0068860_100005934
555 Ga0068860_100205408
556 Ga0068862_100000153
557 Ga0068862_100252830
558 Ga0070717_10226662
559 Ga0070715_10385534
560 Ga0097621_100108600
561 Ga0075370_10464549
562 Ga0075370_10648400
563 Ga0068871_100149262
564 Ga0068871_100149847
565 Ga0075428_100005289
566 Ga0075428_100636594
567 Ga0075433_10084206
568 Ga0075433_10084632
569 Ga0075433_11296277
570 Ga0075434_100026943
571 Ga0075434_100161349
572 Ga0075434_100497908
573 Ga0075434_100877789
574 Ga0068865_100619203
575 Ga0068865_100640863
576 Ga0068865_100948864
577 Ga0075436_100556527
578 Ga0097620_100002045
579 Ga0097620_100044512
580 Ga0097620_100136905
581 Ga0097620_100148852
582 Ga0075435_100069140
583 Ga0075435_100111510
584 Ga0075435_100149644
585 Ga0075435_100297590
586 Ga0111539_10022043
587 Ga0111539_10212628
588 Ga0111539_11060052
589 Ga0114129_10010816
590 Ga0114129_10031019
591 Ga0114129_10054253
592 Ga0114129_11179387
593 Ga0114129_11775100
594 Ga0105243_10006614
595 Ga0105241_12149010
596 Ga0105242_10076187
597 Ga0105248_11414428
598 Ga0105248_11429598
599 Ga0105246_10000171
600 Ga0105246_10208370
601 Ga0157373_10003741
602 Ga0157370_10170327
603 Ga0157370_10708905
604 Ga0157370_10924742
605 Ga0157374_10440333
606 Ga0157374_10918766
607 Ga0163162_10005990
608 Ga0157375_10002513
609 Ga0157375_10224066
610 Ga0157375_10266507
611 Ga0157375_10339658
612 Ga0157375_12966150
613 Ga0157380_10128137
614 Ga0157377_10060083
615 Ga0157377_10241824
616 Ga0157377_10390396
617 Ga0157376_10069173
618 Ga0157376_11160050
619 Ga0157376_11307679
620 Ga0213875_10007834
621 Ga0213875_10292102
622 Ga0207697_10125423
623 Ga0207682_10183634
624 Ga0207688_10324478
625 Ga0207680_10243526
626 Ga0207647_10417778
627 Ga0207645_10077527
628 Ga0207643_10005482
629 Ga0207643_10080584
630 Ga0207705_10000948
631 Ga0207705_10565197
632 Ga0207707_10015490
633 Ga0207707_11599671
634 Ga0207660_10523523
635 Ga0207662_10009853
636 Ga0207662_10029616
637 Ga0207657_10264356
638 Ga0207657_10264357
639 Ga0207657_10642278
640 Ga0207649_10049455
641 Ga0207649_10415360
642 Ga0207652_10000816
643 Ga0207652_10026238
644 Ga0207652_10075835
645 Ga0207652_10195634
646 Ga0207652_10368337
647 Ga0207646_10129633
648 Ga0207646_10149067
649 Ga0207646_10952560
650 Ga0207681_10005157
651 Ga0207650_10015483
652 Ga0207659_10000162
653 Ga0207659_10125715
654 Ga0207687_10181968
655 Ga0207700_10244358
656 Ga0207644_10058574
657 Ga0207644_10235668
658 Ga0207690_10152084
659 Ga0207690_10529517
660 Ga0207690_11183032
661 Ga0207706_10009731
662 Ga0207706_10011154
663 Ga0207706_10113837
664 Ga0207706_11501544
665 Ga0207686_10394486
666 Ga0207709_10030663
667 Ga0207670_10001956
668 Ga0207670_10012613
669 Ga0207670_10451081
670 Ga0207704_10039124
671 Ga0207704_10358052
672 Ga0207691_10042673
673 Ga0207691_10361652
674 Ga0207691_10493926
675 Ga0207711_10758861
676 Ga0207689_10127392
677 Ga0207689_10540365
678 Ga0207661_10084452
679 Ga0207661_10093475
680 Ga0207679_10061621
681 Ga0207679_10114536
682 Ga0207679_10198198
683 Ga0207679_10543675
684 Ga0207679_10709880
685 Ga0207667_10003940
686 Ga0207667_10912881
687 Ga0207651_10007676
688 Ga0207651_10083706
689 Ga0207651_10166786
690 Ga0207712_10241156
691 Ga0207658_10777442
692 Ga0207677_10576683
693 Ga0207703_10007015
694 Ga0207678_10009978
695 Ga0207678_10045639
696 Ga0207708_10105344
697 Ga0207641_10020612
698 Ga0207641_10207824
699 Ga0207641_10279925
700 Ga0207648_10001478
701 Ga0207648_10698092
702 Ga0207676_10049203
703 Ga0207676_10094794
704 Ga0207674_10063136
705 Ga0207674_10936465
706 Ga0207675_100003045
707 Ga0207675_100040433
708 Ga0207675_100455428
709 Ga0207683_10876438
710 Ga0207698_10928986
711 Ga0207428_10001088
712 Ga0268265_10002632
713 Ga0268265_11624690
714 Ga0268264_10027667
715 Ga0268264_10236870
716 Ga0307412_11034722
717 Ga0373938_0230592
718 Ga0373940_0047028
719 Ga0373955_0299134
720 Ga0373962_0057456
721 Ga0373937_0010442
722 Ga0316584_0270810
723 Ga0373925_0177784
724 Ga0436364_0169818
725 Ga0436364_0295060
726 Ga0451800_0620451
727 Ga0450912_018946
728 Ga0451577_0578940
729 Ga0451576_0017796
730 Ga0451576_0026005
731 Ga0451576_0029457
732 Ga0451576_0048282
733 Ga0495603_0007677
734 Ga0495580_0397399
735 Ga0495584_0088709
736 Ga0495584_0475824
737 Ga0495594_0057083
738 Ga0495606_0001390
739 Ga0495642_0024568
740 Ga0495665_0347850
741 Ga0495609_0008288
742 Ga0495609_0078679
743 Ga0495621_0021486
744 Ga0495621_0081274
745 Ga0495621_0091721
746 Ga0495621_0273649
747 Ga0495625_0150627
748 Ga0495659_0002792
749 Ga0495659_0012738
750 Ga0495659_0040926
751 Ga0495659_0109920
752 Ga0495659_0125735
753 Ga0495659_0165042
754 Ga0495659_0282637
755 Ga0495588_0017146
756 Ga0495658_0605648
757 Ga0495669_0012877
758 Ga0495669_0088097
759 Ga0495671_0012649
760 Ga0495636_0007662
761 Ga0495636_0012770
762 Ga0495685_120164
763 Ga0495686_0000756
764 Ga0495686_0007003
765 Ga0496104_1048349
766 Ga0496105_1084933
767 Ga0496106_0332290
768 Ga0496114_0298955
769 Ga0501033_0139350
770 Ga0501034_0249104
771 Ga0501038_0748881
772 Ga0501043_0111016
773 Ga0501238_011429
774 Ga0501035_0553478
775 Ga0501044_0027237
776 nmdc:mga0k408_197957_c1
777 nmdc:mga07m45_26702_c1
778 nmdc:mga07m45_876067_c1
779 nmdc:mga05p37_14126_c1
780 nmdc:mga05p37_390157_c1
781 nmdc:mga05p37_3906_c1
782 nmdc:mga08y16_3684_c1
783 nmdc:mga0n895_132748_c1
784 nmdc:mga0n895_253692_c1
785 nmdc:mga0n895_392124_c1
786 nmdc:mga0n895_47661_c1
787 nmdc:mga0n895_9053_c1
788 nmdc:mga0rr50_169077_c1
789 nmdc:mga0rr50_372767_c1
790 nmdc:mga0rr50_570049_c1
791 nmdc:mga0rr50_93241_c1
792 nmdc:mga0a205_130908_c1
793 nmdc:mga0a205_188930_c1
794 nmdc:mga0a205_46931_c1
795 Ga0500643_002329
796 Ga0500594_0028167
797 Ga0500559_0211448
798 Ga0500568_0145384
799 Ga0500573_0249315
800 Ga0500588_0059222
801 Ga0500616_0058381
802 2896187079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

17

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7993 32 115
7uy7-assembly1.cif.gz_E tetrahymena cst with polymerase alpha-primase 0.7848 35 72
3sr9-assembly1.cif.gz_A crystal structure of mouse ptpsigma 0.7764 37 74
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7746 36 70
8d0k-assembly1.cif.gz_F human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic 0.7639 35 70
ID Description Score Start End Superfamily
af_A0A0H2UKT5_1625_1914_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8104 40 74 3.90.190.10
af_Q9W0G1_13_309_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7874 36 70 3.90.190.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7869 34 94 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7804 34 95 2.40.50.140
af_Q9UT87_39_174_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7772 38 68 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9676 29 121
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9578 28 122
AF-A0A7X3TZQ2-F1-model_v4 Uncharacterized protein 0.9539 14 123
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.95 28 122
AF-A0A2V8L1N7-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9495 14 123

Map