F434852

General Info

Members Datasets Scaffolds Average Seq Length
401 193 401 157

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10561507|Ga0157369_105615072
Length 151
Sequence MNQFDFVSTTDKPALLAFSTPEWLETARSALSELGYKVHTAATHGDFQIRYQVVIIEERFAANDITENLTLQVMQRMSMGQRRHSTVILIGDNFQTFTPMQAFQQSVHAVINSSELFLLKQLIEKTIADNELFLQTYKETQTRVLTAGRAD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 1.25
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10054090 3300003320 Bacteria 5928
2 Ga0070658_10056106 3300005327 Bacteria 3201
3 Ga0070690_100007018 3300005330 Bacteria 6422
4 Ga0068869_100278578 3300005334 Unclassified 1344
5 Ga0070666_10028244 3300005335 Bacteria 3680
6 Ga0068868_100096426 3300005338 Unclassified 2389
7 Ga0070689_100017564 3300005340 Bacteria 5258
8 Ga0070689_100144589 3300005340 Bacteria 1914
9 Ga0070689_100345112 3300005340 Bacteria 1248
10 Ga0070689_100466856 3300005340 Unclassified 1076
11 Ga0070689_101084175 3300005340 Bacteria 715
12 Ga0070691_10226693 3300005341 Bacteria 993
13 Ga0070692_10088341 3300005345 Bacteria 1681
14 Ga0070675_100332417 3300005354 Bacteria 1344
15 Ga0070671_101639737 3300005355 Unclassified 570
16 Ga0070688_100160568 3300005365 Bacteria 1544
17 Ga0070688_100165528 3300005365 Bacteria 1522
18 Ga0070667_100312220 3300005367 Unclassified 1417
19 Ga0070714_100015285 3300005435 Bacteria 6175
20 Ga0070714_101253019 3300005435 Unclassified 724
21 Ga0070713_101038031 3300005436 Unclassified 791
22 Ga0070713_101287144 3300005436 Unclassified 708
23 Ga0070705_100515414 3300005440 Bacteria 910
24 Ga0070681_10074824 3300005458 Bacteria 3347
25 Ga0070681_10426024 3300005458 Bacteria 1239
26 Ga0070681_10449788 3300005458 Bacteria 1200
27 Ga0070681_10665485 3300005458 Bacteria 956
28 Ga0068867_101052845 3300005459 Unclassified 740
29 Ga0070685_10014015 3300005466 Bacteria 4242
30 Ga0070679_100132479 3300005530 Bacteria 2474
31 Ga0070679_100806016 3300005530 Bacteria 882
32 Ga0070684_100181824 3300005535 Unclassified 1912
33 Ga0070684_100296475 3300005535 Unclassified 1483
34 Ga0070684_101425656 3300005535 Unclassified 652
35 Ga0070697_100117784 3300005536 Bacteria 2219
36 Ga0068853_100024060 3300005539 Bacteria 5105
37 Ga0070686_100065343 3300005544 Unclassified 2363
38 Ga0070686_100124689 3300005544 Bacteria 1773
39 Ga0070686_100186577 3300005544 Bacteria 1477
40 Ga0070686_100301557 3300005544 Unclassified 1188
41 Ga0070695_101174837 3300005545 Unclassified 630
42 Ga0070693_100198914 3300005547 Bacteria 1300
43 Ga0070704_100854292 3300005549 Unclassified 816
44 Ga0068855_100125625 3300005563 Bacteria 2933
45 Ga0068855_100133062 3300005563 Bacteria 2839
46 Ga0068855_100529953 3300005563 Unclassified 1277
47 Ga0068857_100098997 3300005577 Bacteria 2615
48 Ga0068857_100597569 3300005577 Bacteria 1043
49 Ga0068856_100029138 3300005614 Bacteria 5392
50 Ga0068856_100041360 3300005614 Bacteria 4529
51 Ga0068856_101842325 3300005614 Unclassified 616
52 Ga0070702_100111274 3300005615 Viruses 1698
53 Ga0068859_100033101 3300005617 Bacteria 5192
54 Ga0068859_100296545 3300005617 Bacteria 1710
55 Ga0068859_100652474 3300005617 Bacteria 1144
56 Ga0068859_101643559 3300005617 Unclassified 709
57 Ga0068859_102037134 3300005617 Unclassified 634
58 Ga0068859_102341226 3300005617 Viruses 589
59 Ga0068864_100015488 3300005618 Bacteria 6339
60 Ga0068866_10443232 3300005718 Unclassified 847
61 Ga0068861_101997603 3300005719 Unclassified 578
62 Ga0068863_100339277 3300005841 Bacteria 1462
63 Ga0068863_100964817 3300005841 Bacteria 854
64 Ga0068858_100075457 3300005842 Bacteria 3132
65 Ga0068858_101646338 3300005842 Unclassified 634
66 Ga0068862_100307116 3300005844 Unclassified 1461
67 Ga0068862_100340318 3300005844 Bacteria 1389
68 Ga0070717_10625085 3300006028 Bacteria 977
69 Ga0070712_100324328 3300006175 Bacteria 1253
70 Ga0070712_100381727 3300006175 Unclassified 1160
71 Ga0097621_100139447 3300006237 Unclassified 2071
72 Ga0097621_100388862 3300006237 Bacteria 1247
73 Ga0097621_101398773 3300006237 Unclassified 662
74 Ga0097621_101803421 3300006237 Bacteria 583
75 Ga0068871_100014149 3300006358 Bacteria 5937
76 Ga0068871_100474049 3300006358 Unclassified 1125
77 Ga0068871_101400341 3300006358 Unclassified 659
78 Ga0068865_100115160 3300006881 Bacteria 1989
79 Ga0075436_100578462 3300006914 Unclassified 826
80 Ga0075436_100851756 3300006914 Unclassified 680
81 Ga0097620_100033101 3300006931 Bacteria 5192
82 Ga0097620_100296547 3300006931 Bacteria 1710
83 Ga0097620_100652428 3300006931 Bacteria 1144
84 Ga0097620_101643541 3300006931 Unclassified 709
85 Ga0097620_102340892 3300006931 Viruses 589
86 Ga0075435_100129022 3300007076 Bacteria 2115
87 Ga0075435_100726991 3300007076 Unclassified 863
88 Ga0075435_100804733 3300007076 Unclassified 818
89 Ga0099794_10243831 3300007265 Bacteria 926
90 Ga0099795_10193139 3300007788 Bacteria 856
91 Ga0105240_10003594 3300009093 Bacteria 24026
92 Ga0105240_10076034 3300009093 Bacteria 4141
93 Ga0105240_10295247 3300009093 Unclassified 1856
94 Ga0105240_10669466 3300009093 Bacteria 1136
95 Ga0105240_10674776 3300009093 Unclassified 1130
96 Ga0105240_10715003 3300009093 Bacteria 1092
97 Ga0105240_11502780 3300009093 Bacteria 706
98 Ga0111539_10809455 3300009094 Unclassified 1090
99 Ga0111539_11541392 3300009094 Bacteria 771
100 Ga0105245_10335077 3300009098 Bacteria 1494
101 Ga0105241_10149676 3300009174 Bacteria 1908
102 Ga0105241_10979190 3300009174 Unclassified 790
103 Ga0105242_10686484 3300009176 Unclassified 1000
104 Ga0105248_10194861 3300009177 Bacteria 2283
105 Ga0105238_10002928 3300009551 Bacteria 17040
106 Ga0105238_10027806 3300009551 Bacteria 5763
107 Ga0105238_10562978 3300009551 Unclassified 1145
108 Ga0099796_10081491 3300010159 Unclassified 1187
109 Ga0157371_10661233 3300013102 Bacteria 780
110 Ga0157370_10087563 3300013104 Bacteria 2925
111 Ga0157370_10340613 3300013104 Unclassified 1382
112 Ga0157369_10561507 3300013105 Unclassified 1179
113 Ga0157374_10351742 3300013296 Bacteria 1464
114 Ga0157374_10917534 3300013296 Unclassified 894
115 Ga0157374_11029903 3300013296 Bacteria 843
116 Ga0157374_11120370 3300013296 Unclassified 808
117 Ga0157374_11327138 3300013296 Unclassified 742
118 Ga0157374_11375247 3300013296 Unclassified 728
119 Ga0157374_11464012 3300013296 Bacteria 706
120 Ga0157374_11648516 3300013296 Unclassified 666
121 Ga0157378_10782342 3300013297 Unclassified 979
122 Ga0163162_11089773 3300013306 Bacteria 905
123 Ga0163162_11221420 3300013306 Bacteria 853
124 Ga0157372_10180286 3300013307 Bacteria 2445
125 Ga0157372_10241781 3300013307 Unclassified 2095
126 Ga0157375_10000006 3300013308 Bacteria 384086
127 Ga0157375_10778573 3300013308 Bacteria 1106
128 Ga0163163_10000124 3300014325 Bacteria 81990
129 Ga0163163_10116373 3300014325 Bacteria 2704
130 Ga0163163_11273562 3300014325 Unclassified 797
131 Ga0157377_11498168 3300014745 Unclassified 536
132 Ga0157376_10081255 3300014969 Bacteria 2782
133 Ga0157376_10462835 3300014969 Unclassified 1239
134 Ga0157376_10778951 3300014969 Unclassified 968
135 Ga0157376_11811220 3300014969 Unclassified 647
136 Ga0207680_10024576 3300025903 Unclassified 3309
137 Ga0207705_10235087 3300025909 Bacteria 1395
138 Ga0207695_10049797 3300025913 Bacteria 4412
139 Ga0207695_10069197 3300025913 Unclassified 3612
140 Ga0207695_10100345 3300025913 Bacteria 2891
141 Ga0207695_10462674 3300025913 Bacteria 1151
142 Ga0207695_10552515 3300025913 Bacteria 1033
143 Ga0207660_10854494 3300025917 Unclassified 743
144 Ga0207694_10060915 3300025924 Bacteria 2937
145 Ga0207694_10176179 3300025924 Unclassified 1733
146 Ga0207694_10181323 3300025924 Bacteria 1708
147 Ga0207659_10415805 3300025926 Unclassified 1127
148 Ga0207687_10222552 3300025927 Bacteria 1487
149 Ga0207700_10569643 3300025928 Bacteria 1006
150 Ga0207700_10885261 3300025928 Unclassified 799
151 Ga0207664_10024852 3300025929 Bacteria 4504
152 Ga0207686_10231943 3300025934 Bacteria 1339
153 Ga0207686_10288587 3300025934 Bacteria 1214
154 Ga0207670_10016447 3300025936 Bacteria 4445
155 Ga0207670_10303615 3300025936 Unclassified 1251
156 Ga0207670_10458604 3300025936 Bacteria 1029
157 Ga0207670_10805388 3300025936 Unclassified 783
158 Ga0207689_10251948 3300025942 Unclassified 1460
159 Ga0207667_10230420 3300025949 Unclassified 1897
160 Ga0207667_10480585 3300025949 Unclassified 1261
161 Ga0207667_11316503 3300025949 Bacteria 698
162 Ga0207677_10333119 3300026023 Unclassified 1265
163 Ga0207639_10362799 3300026041 Bacteria 1297
164 Ga0207702_10000808 3300026078 Bacteria 33196
165 Ga0207702_10020731 3300026078 Bacteria 5435
166 Ga0207702_10020867 3300026078 Bacteria 5420
167 Ga0207641_10435933 3300026088 Unclassified 1264
168 Ga0207641_11045609 3300026088 Unclassified 814
169 Ga0207648_11202485 3300026089 Unclassified 712
170 Ga0207676_11062445 3300026095 Unclassified 799
171 Ga0207674_10096275 3300026116 Bacteria 2945
172 Ga0207674_10131333 3300026116 Bacteria 2467
173 Ga0207698_10461120 3300026142 Unclassified 1229
174 Ga0268265_10573712 3300028380 Unclassified 1074
175 Ga0268265_11755641 3300028380 Unclassified 627
176 Ga0265337_1044031 3300028556 Bacteria 1274
177 Ga0265326_10010559 3300028558 Bacteria 2737
178 Ga0265326_10015765 3300028558 Bacteria 2189
179 Ga0265326_10026945 3300028558 Bacteria 1638
180 Ga0265319_1000016 3300028563 Bacteria 176245
181 Ga0265319_1054778 3300028563 Bacteria 1307
182 Ga0265334_10035360 3300028573 Bacteria 1978
183 Ga0265334_10036479 3300028573 Bacteria 1941
184 Ga0265318_10181978 3300028577 Unclassified 769
185 Ga0265318_10271937 3300028577 Unclassified 618
186 Ga0265323_10043416 3300028653 Bacteria 1623
187 Ga0265322_10152290 3300028654 Unclassified 661
188 Ga0265336_10121625 3300028666 Unclassified 777
189 Ga0265336_10157091 3300028666 Unclassified 676
190 Ga0265336_10185351 3300028666 Bacteria 619
191 Ga0265338_10000032 3300028800 Bacteria 257580
192 Ga0265338_10000487 3300028800 Bacteria 70806
193 Ga0265338_10000605 3300028800 Bacteria 62898
194 Ga0265338_10000808 3300028800 Bacteria 52850
195 Ga0265338_10003037 3300028800 Bacteria 24157
196 Ga0265338_10004439 3300028800 Bacteria 18945
197 Ga0265338_10006411 3300028800 Bacteria 14999
198 Ga0265338_10006466 3300028800 Bacteria 14930
199 Ga0265338_10017598 3300028800 Bacteria 7694
200 Ga0265338_10021100 3300028800 Bacteria 6809
201 Ga0265338_10025641 3300028800 Bacteria 5976
202 Ga0265338_10032281 3300028800 Bacteria 5112
203 Ga0265338_10036354 3300028800 Bacteria 4715
204 Ga0265338_10052764 3300028800 Bacteria 3644
205 Ga0265338_10081261 3300028800 Bacteria 2719
206 Ga0265338_10194091 3300028800 Bacteria 1536
207 Ga0265338_10265699 3300028800 Bacteria 1259
208 Ga0265338_10798695 3300028800 Unclassified 647
209 Ga0265338_11026978 3300028800 Unclassified 557
210 Ga0265338_11076035 3300028800 Unclassified 542
211 Ga0265324_10000275 3300029957 Bacteria 38013
212 Ga0265324_10000434 3300029957 Bacteria 29709
213 Ga0265324_10013737 3300029957 Bacteria 3013
214 Ga0265324_10086271 3300029957 Bacteria 1067
215 Ga0265320_10001118 3300031240 Bacteria 19763
216 Ga0265320_10015186 3300031240 Bacteria 4359
217 Ga0265320_10090798 3300031240 Bacteria 1415
218 Ga0265320_10100847 3300031240 Unclassified 1330
219 Ga0265320_10186352 3300031240 Unclassified 929
220 Ga0265320_10512329 3300031240 Unclassified 530
221 Ga0265325_10010574 3300031241 Bacteria 5339
222 Ga0265325_10250743 3300031241 Bacteria 802
223 Ga0265340_10000208 3300031247 Bacteria 29683
224 Ga0265339_10075341 3300031249 Bacteria 1791
225 Ga0265339_10106588 3300031249 Unclassified 1454
226 Ga0265327_10001424 3300031251 Bacteria 30421
227 Ga0265327_10048177 3300031251 Bacteria 2243
228 Ga0265327_10277127 3300031251 Unclassified 742
229 Ga0265316_10440738 3300031344 Unclassified 935
230 Ga0265313_10026169 3300031595 Bacteria 3078
231 Ga0265314_10029742 3300031711 Bacteria 4056
232 Ga0265314_10328695 3300031711 Unclassified 848
233 Ga0265314_10496370 3300031711 Unclassified 643
234 Ga0265342_10345588 3300031712 Bacteria 776
235 Ga0316578_10260700 3300031728 Bacteria 1039
236 Ga0307516_10304137 3300031730 Unclassified 1270
237 Ga0316577_10408216 3300031733 Bacteria 772
238 Ga0373926_0319801 3300035083 Unclassified 607
239 Ga0373928_0006300 3300035084 Bacteria 2281
240 Ga0373944_0002365 3300035089 Bacteria 4803
241 Ga0373949_0001197 3300035090 Bacteria 7696
242 Ga0373932_0000003 3300035112 Bacteria 459351
243 Ga0373939_0008858 3300035114 Bacteria 2479
244 Ga0373953_0091247 3300035117 Bacteria 1275
245 Ga0373954_0019754 3300035118 Bacteria 3041
246 Ga0373954_0052119 3300035118 Bacteria 1922
247 Ga0373956_0132088 3300035119 Bacteria 1169
248 Ga0373957_0071932 3300035120 Bacteria 1354
249 Ga0373943_0083080 3300035170 Bacteria 1646
250 Ga0373955_0675937 3300035172 Bacteria 633
251 Ga0373942_0091305 3300035207 Bacteria 918
252 Ga0373962_0000106 3300035242 Bacteria 18384
253 Ga0373924_0282904 3300035410 Bacteria 736
254 Ga0373931_0000017 3300035691 Bacteria 207733
255 Ga0373931_0682849 3300035691 Unclassified 677
256 Ga0373935_0018453 3300035692 Bacteria 4243
257 Ga0373935_0247232 3300035692 Bacteria 1247
258 Ga0373927_0009723 3300035695 Bacteria 6446
259 Ga0373927_0057013 3300035695 Bacteria 2526
260 Ga0373927_0322657 3300035695 Unclassified 1017
261 Ga0373927_0660894 3300035695 Unclassified 691
262 Ga0373933_0081746 3300035724 Bacteria 1982
263 Ga0373933_0277286 3300035724 Unclassified 1083
264 Ga0373933_0375953 3300035724 Unclassified 925
265 Ga0373947_0018292 3300035725 Bacteria 4033
266 Ga0373947_0023833 3300035725 Bacteria 3563
267 Ga0373947_0510227 3300035725 Bacteria 817
268 Ga0373947_0785781 3300035725 Unclassified 650
269 Ga0373937_0041151 3300036401 Bacteria 4216
270 Ga0373937_0413763 3300036401 Bacteria 1279
271 Ga0373937_0639770 3300036401 Bacteria 1009
272 Ga0373937_2013903 3300036401 Unclassified 523
273 Ga0316584_0692393 3300036712 Bacteria 699
274 Ga0373925_0001370 3300037068 Bacteria 21253
275 Ga0373925_0004833 3300037068 Bacteria 10144
276 Ga0373925_0009024 3300037068 Bacteria 7262
277 Ga0373925_0065716 3300037068 Bacteria 2733
278 Ga0373925_0337671 3300037068 Unclassified 1222
279 Ga0436363_1175420 3300039450 Bacteria 654
280 Ga0451807_1625061 3300041486 Bacteria 1120
281 Ga0451577_0003436 3300042876 Bacteria 17641
282 Ga0451577_0015600 3300042876 Bacteria 7060
283 Ga0451577_0326402 3300042876 Bacteria 1392
284 Ga0453683_0433601 3300044673 Unclassified 849
285 Ga0453683_0584459 3300044673 Bacteria 728
286 Ga0453684_0004628 3300044712 Bacteria 28595
287 Ga0453684_0013527 3300044712 Bacteria 13239
288 Ga0453684_0257863 3300044712 Bacteria 1999
289 Ga0453684_0304608 3300044712 Bacteria 1810
290 Ga0451576_0015861 3300045051 Bacteria 8334
291 Ga0451576_0070874 3300045051 Bacteria 3628
292 Ga0451576_0101374 3300045051 Bacteria 2994
293 Ga0451576_0119407 3300045051 Bacteria 2745
294 Ga0451576_0277401 3300045051 Bacteria 1753
295 Ga0451576_0285316 3300045051 Bacteria 1726
296 Ga0451576_0327736 3300045051 Bacteria 1603
297 Ga0451576_0559374 3300045051 Bacteria 1202
298 Ga0451576_0911256 3300045051 Bacteria 922
299 Ga0451576_0921262 3300045051 Bacteria 917
300 Ga0451576_1388397 3300045051 Bacteria 731
301 Ga0495592_0000012 3300046454 Bacteria 154054
302 Ga0495592_0008014 3300046454 Bacteria 7929
303 Ga0495641_0020043 3300046461 Bacteria 3403
304 Ga0495651_0820379 3300046462 Unclassified 573
305 Ga0495653_0269626 3300046463 Bacteria 1122
306 Ga0495582_0008132 3300046473 Bacteria 5791
307 Ga0495582_0042644 3300046473 Bacteria 2499
308 Ga0495639_0193063 3300046475 Bacteria 995
309 Ga0495662_0024801 3300046476 Bacteria 2894
310 Ga0495664_0116525 3300046477 Bacteria 1615
311 Ga0495664_0183556 3300046477 Bacteria 1268
312 Ga0495618_0003395 3300046514 Bacteria 9912
313 Ga0495618_0152470 3300046514 Bacteria 1476
314 Ga0495628_0000320 3300046516 Bacteria 43366
315 Ga0495628_0101979 3300046516 Bacteria 2214
316 Ga0495628_0112984 3300046516 Bacteria 2088
317 Ga0495628_0546532 3300046516 Unclassified 832
318 Ga0495630_0000010 3300046517 Bacteria 265324
319 Ga0495630_0015375 3300046517 Bacteria 5589
320 Ga0495630_0085523 3300046517 Bacteria 2381
321 Ga0495630_0349178 3300046517 Bacteria 1132
322 Ga0495630_0866189 3300046517 Unclassified 689
323 Ga0495666_0001932 3300046526 Bacteria 10222
324 Ga0495666_0215491 3300046526 Unclassified 880
325 Ga0495652_0213841 3300046529 Bacteria 1453
326 Ga0495640_0114169 3300046533 Bacteria 1761
327 Ga0495640_0145786 3300046533 Bacteria 1523
328 Ga0495640_0164527 3300046533 Bacteria 1420
329 Ga0495586_0000048 3300046535 Bacteria 71629
330 Ga0495586_0000867 3300046535 Bacteria 17339
331 Ga0495586_0001538 3300046535 Bacteria 12729
332 Ga0495586_0010259 3300046535 Bacteria 4982
333 Ga0495586_0105757 3300046535 Bacteria 1565
334 Ga0495586_0619264 3300046535 Bacteria 625
335 Ga0495587_0125912 3300046536 Bacteria 1466
336 Ga0495645_0060630 3300046543 Bacteria 2742
337 Ga0495645_0121318 3300046543 Bacteria 1840
338 Ga0495667_0706338 3300046559 Unclassified 625
339 Ga0495667_0829181 3300046559 Unclassified 569
340 Ga0495634_0018314 3300046642 Bacteria 4987
341 Ga0495634_0018945 3300046642 Bacteria 4894
342 Ga0495634_0067853 3300046642 Bacteria 2358
343 Ga0495635_0010465 3300046663 Bacteria 6488
344 Ga0495657_0275130 3300046675 Bacteria 1009
345 Ga0495599_0022090 3300046678 Bacteria 3971
346 Ga0495599_0091371 3300046678 Bacteria 1899
347 Ga0495599_0326041 3300046678 Unclassified 923
348 Ga0495647_0015866 3300046681 Bacteria 2645
349 Ga0495647_0017659 3300046681 Bacteria 2527
350 Ga0495647_0181821 3300046681 Unclassified 915
351 Ga0495658_0017047 3300046683 Bacteria 3746
352 Ga0495669_0112776 3300046684 Unclassified 1270
353 Ga0495669_0166625 3300046684 Bacteria 1047
354 Ga0495613_0001643 3300046689 Bacteria 17024
355 Ga0495613_0072400 3300046689 Bacteria 2512
356 Ga0495613_0608166 3300046689 Bacteria 727
357 Ga0495624_0032378 3300046690 Bacteria 3391
358 Ga0495624_0076653 3300046690 Bacteria 2075
359 Ga0495624_0251536 3300046690 Unclassified 1069
360 Ga0495581_0243749 3300047315 Unclassified 1051
361 Ga0495636_0298126 3300047318 Unclassified 754
362 Ga0495674_0001886 3300047319 Bacteria 20650
363 Ga0495674_0029720 3300047319 Bacteria 4973
364 Ga0495674_0190824 3300047319 Bacteria 1703
365 Ga0495676_0022222 3300047321 Bacteria 5524
366 Ga0495676_0027623 3300047321 Bacteria 4863
367 Ga0495680_0002831 3300047322 Bacteria 17453
368 Ga0495680_0155991 3300047322 Bacteria 1660
369 Ga0495680_0160512 3300047322 Bacteria 1633
370 Ga0495675_0118648 3300047444 Bacteria 1648
371 Ga0495684_0833832 3300047471 Unclassified 600
372 Ga0495614_0274048 3300048089 Unclassified 776
373 Ga0496105_0809376 3300048908 Unclassified 712
374 Ga0496112_1165561 3300048915 Unclassified 688
375 Ga0496112_1589082 3300048915 Bacteria 567
376 Ga0496115_0011297 3300048918 Bacteria 6691
377 Ga0501031_0000012 3300049568 Bacteria 137943
378 Ga0501032_0007666 3300049569 Bacteria 7870
379 Ga0501032_0020292 3300049569 Bacteria 4631
380 Ga0501032_0282887 3300049569 Bacteria 1074
381 Ga0501033_0001607 3300049570 Bacteria 19842
382 Ga0501033_0012811 3300049570 Bacteria 6395
383 Ga0501033_0039943 3300049570 Bacteria 3504
384 Ga0501034_0250705 3300049571 Bacteria 1715
385 Ga0501034_0472220 3300049571 Bacteria 1170
386 Ga0501036_0265967 3300049572 Bacteria 1436
387 Ga0501037_0042861 3300049573 Bacteria 3326
388 Ga0501037_0096065 3300049573 Bacteria 2142
389 Ga0501043_0321666 3300049579 Unclassified 1179
390 Ga0501046_0356647 3300049580 Bacteria 1061
391 Ga0501047_0132940 3300049581 Bacteria 2368
392 Ga0501047_0283253 3300049581 Bacteria 1502
393 Ga0501080_0031912 3300049742 Bacteria 4909
394 Ga0501035_0003711 3300049822 Bacteria 14559
395 Ga0501035_0078062 3300049822 Bacteria 2926
396 Ga0501044_0000024 3300049823 Bacteria 194302
397 Ga0501044_0040160 3300049823 Bacteria 4878
398 Ga0501044_0411069 3300049823 Bacteria 1264
399 nmdc:mga0rr50_931194_c1 3300050513 Unclassified 741
400 nmdc:mga08x19_538286_c1 3300050514 Unclassified 826
401 Ga0500650_0083328 3300053098 Unclassified 1495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10017598 Ga0265338_100175981 136
2 3300025942 Ga0207689_10251948 Ga0207689_102519482 140
3 3300035172 Ga0373955_0675937 Ga0373955_0675937_189_614 140
4 3300047321 Ga0495676_0027623 Ga0495676_0027623_29_469 140
5 3300046543 Ga0495645_0121318 Ga0495645_0121318_285_722 143
6 3300013105 Ga0157369_10561507 Ga0157369_105615072 150
7 3300005617 Ga0068859_102037134 Ga0068859_1020371341 151
8 3300007076 Ga0075435_100129022 Ga0075435_1001290221 151
9 3300028380 Ga0268265_11755641 Ga0268265_117556411 151
10 3300028666 Ga0265336_10157091 Ga0265336_101570911 152
11 3300031240 Ga0265320_10512329 Ga0265320_105123291 152
12 3300031711 Ga0265314_10029742 Ga0265314_100297424 152
13 3300028800 Ga0265338_10052764 Ga0265338_100527641 153
14 3300035724 Ga0373933_0277286 Ga0373933_0277286_185_646 153
15 3300036401 Ga0373937_0639770 Ga0373937_0639770_213_674 153
16 3300036401 Ga0373937_2013903 Ga0373937_2013903_24_485 153
17 3300046517 Ga0495630_0349178 Ga0495630_0349178_471_932 153
18 3300046535 Ga0495586_0105757 Ga0495586_0105757_902_1363 153
19 3300047322 Ga0495680_0160512 Ga0495680_0160512_344_805 153
20 3300005330 Ga0070690_100007018 Ga0070690_1000070182 154
21 3300005617 Ga0068859_100033101 Ga0068859_1000331012 154
22 3300006931 Ga0097620_100033101 Ga0097620_1000331012 154
23 3300028666 Ga0265336_10121625 Ga0265336_101216252 154
24 3300031712 Ga0265342_10345588 Ga0265342_103455882 154
25 3300005327 Ga0070658_10056106 Ga0070658_100561063 155
26 3300005338 Ga0068868_100096426 Ga0068868_1000964262 155
27 3300005341 Ga0070691_10226693 Ga0070691_102266932 155
28 3300005345 Ga0070692_10088341 Ga0070692_100883412 155
29 3300005355 Ga0070671_101639737 Ga0070671_1016397371 155
30 3300005458 Ga0070681_10074824 Ga0070681_100748244 155
31 3300005459 Ga0068867_101052845 Ga0068867_1010528451 155
32 3300005530 Ga0070679_100132479 Ga0070679_1001324793 155
33 3300005535 Ga0070684_100181824 Ga0070684_1001818244 155
34 3300005544 Ga0070686_100065343 Ga0070686_1000653433 155
35 3300005563 Ga0068855_100125625 Ga0068855_1001256253 155
36 3300005563 Ga0068855_100133062 Ga0068855_1001330621 155
37 3300005615 Ga0070702_100111274 Ga0070702_1001112742 155
38 3300005718 Ga0068866_10443232 Ga0068866_104432322 155
39 3300005841 Ga0068863_100964817 Ga0068863_1009648172 155
40 3300006237 Ga0097621_100139447 Ga0097621_1001394473 155
41 3300006237 Ga0097621_100388862 Ga0097621_1003888622 155
42 3300006358 Ga0068871_100014149 Ga0068871_1000141493 155
43 3300006881 Ga0068865_100115160 Ga0068865_1001151603 155
44 3300007076 Ga0075435_100726991 Ga0075435_1007269912 155
45 3300007265 Ga0099794_10243831 Ga0099794_102438312 155
46 3300007788 Ga0099795_10193139 Ga0099795_101931391 155
47 3300009094 Ga0111539_10809455 Ga0111539_108094552 155
48 3300009174 Ga0105241_10979190 Ga0105241_109791901 155
49 3300009176 Ga0105242_10686484 Ga0105242_106864842 155
50 3300009551 Ga0105238_10027806 Ga0105238_100278063 155
51 3300010159 Ga0099796_10081491 Ga0099796_100814912 155
52 3300014969 Ga0157376_10081255 Ga0157376_100812552 155
53 3300014969 Ga0157376_11811220 Ga0157376_118112201 155
54 3300025909 Ga0207705_10235087 Ga0207705_102350872 155
55 3300025913 Ga0207695_10100345 Ga0207695_101003452 155
56 3300025917 Ga0207660_10854494 Ga0207660_108544942 155
57 3300025924 Ga0207694_10181323 Ga0207694_101813233 155
58 3300025928 Ga0207700_10569643 Ga0207700_105696432 155
59 3300025934 Ga0207686_10288587 Ga0207686_102885871 155
60 3300025949 Ga0207667_10230420 Ga0207667_102304202 155
61 3300025949 Ga0207667_11316503 Ga0207667_113165032 155
62 3300026023 Ga0207677_10333119 Ga0207677_103331192 155
63 3300026088 Ga0207641_11045609 Ga0207641_110456091 155
64 3300026089 Ga0207648_11202485 Ga0207648_112024851 155
65 3300028558 Ga0265326_10010559 Ga0265326_100105592 155
66 3300028800 Ga0265338_10000032 Ga0265338_1000003248 155
67 3300028800 Ga0265338_10004439 Ga0265338_1000443915 155
68 3300028800 Ga0265338_10025641 Ga0265338_100256412 155
69 3300028800 Ga0265338_11026978 Ga0265338_110269781 155
70 3300029957 Ga0265324_10000434 Ga0265324_100004346 155
71 3300031249 Ga0265339_10075341 Ga0265339_100753412 155
72 3300031344 Ga0265316_10440738 Ga0265316_104407382 155
73 3300031711 Ga0265314_10328695 Ga0265314_103286951 155
74 3300035083 Ga0373926_0319801 Ga0373926_0319801_56_526 155
75 3300035725 Ga0373947_0785781 Ga0373947_0785781_55_525 155
76 3300045051 Ga0451576_0015861 Ga0451576_0015861_6553_7023 155
77 3300048915 Ga0496112_1589082 Ga0496112_1589082_36_506 155
78 3300048918 Ga0496115_0011297 Ga0496115_0011297_201_671 155
79 3300050513 nmdc:mga0rr50_931194_c1 nmdc:mga0rr50_931194_c1_13_480 155
80 3300003320 rootH2_10054090 rootH2_100540906 156
81 3300005334 Ga0068869_100278578 Ga0068869_1002785782 156
82 3300005335 Ga0070666_10028244 Ga0070666_100282443 156
83 3300005340 Ga0070689_100017564 Ga0070689_1000175642 156
84 3300005340 Ga0070689_100144589 Ga0070689_1001445893 156
85 3300005340 Ga0070689_100345112 Ga0070689_1003451122 156
86 3300005340 Ga0070689_100466856 Ga0070689_1004668562 156
87 3300005340 Ga0070689_101084175 Ga0070689_1010841751 156
88 3300005354 Ga0070675_100332417 Ga0070675_1003324172 156
89 3300005365 Ga0070688_100160568 Ga0070688_1001605681 156
90 3300005365 Ga0070688_100165528 Ga0070688_1001655282 156
91 3300005367 Ga0070667_100312220 Ga0070667_1003122202 156
92 3300005435 Ga0070714_100015285 Ga0070714_1000152854 156
93 3300005435 Ga0070714_101253019 Ga0070714_1012530192 156
94 3300005436 Ga0070713_101038031 Ga0070713_1010380311 156
95 3300005436 Ga0070713_101287144 Ga0070713_1012871442 156
96 3300005440 Ga0070705_100515414 Ga0070705_1005154142 156
97 3300005458 Ga0070681_10426024 Ga0070681_104260242 156
98 3300005458 Ga0070681_10449788 Ga0070681_104497881 156
99 3300005458 Ga0070681_10665485 Ga0070681_106654851 156
100 3300005466 Ga0070685_10014015 Ga0070685_100140154 156
101 3300005530 Ga0070679_100806016 Ga0070679_1008060162 156
102 3300005535 Ga0070684_100296475 Ga0070684_1002964752 156
103 3300005535 Ga0070684_101425656 Ga0070684_1014256562 156
104 3300005536 Ga0070697_100117784 Ga0070697_1001177842 156
105 3300005539 Ga0068853_100024060 Ga0068853_1000240602 156
106 3300005544 Ga0070686_100124689 Ga0070686_1001246892 156
107 3300005544 Ga0070686_100186577 Ga0070686_1001865772 156
108 3300005544 Ga0070686_100301557 Ga0070686_1003015572 156
109 3300005545 Ga0070695_101174837 Ga0070695_1011748371 156
110 3300005547 Ga0070693_100198914 Ga0070693_1001989142 156
111 3300005549 Ga0070704_100854292 Ga0070704_1008542922 156
112 3300005563 Ga0068855_100529953 Ga0068855_1005299532 156
113 3300005577 Ga0068857_100098997 Ga0068857_1000989972 156
114 3300005577 Ga0068857_100597569 Ga0068857_1005975692 156
115 3300005614 Ga0068856_100029138 Ga0068856_1000291384 156
116 3300005614 Ga0068856_100041360 Ga0068856_1000413602 156
117 3300005614 Ga0068856_101842325 Ga0068856_1018423251 156
118 3300005617 Ga0068859_100296545 Ga0068859_1002965452 156
119 3300005617 Ga0068859_100652474 Ga0068859_1006524742 156
120 3300005617 Ga0068859_101643559 Ga0068859_1016435592 156
121 3300005617 Ga0068859_102341226 Ga0068859_1023412262 156
122 3300005618 Ga0068864_100015488 Ga0068864_1000154884 156
123 3300005719 Ga0068861_101997603 Ga0068861_1019976031 156
124 3300005841 Ga0068863_100339277 Ga0068863_1003392772 156
125 3300005842 Ga0068858_100075457 Ga0068858_1000754573 156
126 3300005842 Ga0068858_101646338 Ga0068858_1016463381 156
127 3300005844 Ga0068862_100307116 Ga0068862_1003071162 156
128 3300005844 Ga0068862_100340318 Ga0068862_1003403182 156
129 3300006028 Ga0070717_10625085 Ga0070717_106250851 156
130 3300006175 Ga0070712_100324328 Ga0070712_1003243282 156
131 3300006175 Ga0070712_100381727 Ga0070712_1003817272 156
132 3300006237 Ga0097621_101398773 Ga0097621_1013987731 156
133 3300006237 Ga0097621_101803421 Ga0097621_1018034211 156
134 3300006358 Ga0068871_100474049 Ga0068871_1004740492 156
135 3300006358 Ga0068871_101400341 Ga0068871_1014003411 156
136 3300006914 Ga0075436_100578462 Ga0075436_1005784622 156
137 3300006914 Ga0075436_100851756 Ga0075436_1008517562 156
138 3300006931 Ga0097620_100296547 Ga0097620_1002965472 156
139 3300006931 Ga0097620_100652428 Ga0097620_1006524282 156
140 3300006931 Ga0097620_101643541 Ga0097620_1016435412 156
141 3300006931 Ga0097620_102340892 Ga0097620_1023408922 156
142 3300007076 Ga0075435_100804733 Ga0075435_1008047332 156
143 3300009093 Ga0105240_10003594 Ga0105240_1000359416 156
144 3300009093 Ga0105240_10076034 Ga0105240_100760343 156
145 3300009093 Ga0105240_10295247 Ga0105240_102952473 156
146 3300009093 Ga0105240_10669466 Ga0105240_106694661 156
147 3300009093 Ga0105240_10674776 Ga0105240_106747762 156
148 3300009093 Ga0105240_10715003 Ga0105240_107150032 156
149 3300009093 Ga0105240_11502780 Ga0105240_115027801 156
150 3300009094 Ga0111539_11541392 Ga0111539_115413921 156
151 3300009098 Ga0105245_10335077 Ga0105245_103350772 156
152 3300009174 Ga0105241_10149676 Ga0105241_101496762 156
153 3300009177 Ga0105248_10194861 Ga0105248_101948613 156
154 3300009551 Ga0105238_10002928 Ga0105238_100029284 156
155 3300009551 Ga0105238_10562978 Ga0105238_105629782 156
156 3300013102 Ga0157371_10661233 Ga0157371_106612331 156
157 3300013104 Ga0157370_10087563 Ga0157370_100875631 156
158 3300013104 Ga0157370_10340613 Ga0157370_103406132 156
159 3300013296 Ga0157374_10351742 Ga0157374_103517422 156
160 3300013296 Ga0157374_10917534 Ga0157374_109175342 156
161 3300013296 Ga0157374_11029903 Ga0157374_110299032 156
162 3300013296 Ga0157374_11120370 Ga0157374_111203701 156
163 3300013296 Ga0157374_11327138 Ga0157374_113271381 156
164 3300013296 Ga0157374_11375247 Ga0157374_113752471 156
165 3300013296 Ga0157374_11464012 Ga0157374_114640121 156
166 3300013296 Ga0157374_11648516 Ga0157374_116485161 156
167 3300013297 Ga0157378_10782342 Ga0157378_107823422 156
168 3300013306 Ga0163162_11089773 Ga0163162_110897731 156
169 3300013306 Ga0163162_11221420 Ga0163162_112214201 156
170 3300013307 Ga0157372_10180286 Ga0157372_101802863 156
171 3300013307 Ga0157372_10241781 Ga0157372_102417812 156
172 3300013308 Ga0157375_10000006 Ga0157375_10000006212 156
173 3300013308 Ga0157375_10778573 Ga0157375_107785732 156
174 3300014325 Ga0163163_10000124 Ga0163163_1000012450 156
175 3300014325 Ga0163163_10116373 Ga0163163_101163733 156
176 3300014325 Ga0163163_11273562 Ga0163163_112735621 156
177 3300014745 Ga0157377_11498168 Ga0157377_114981681 156
178 3300014969 Ga0157376_10462835 Ga0157376_104628353 156
179 3300014969 Ga0157376_10778951 Ga0157376_107789512 156
180 3300025903 Ga0207680_10024576 Ga0207680_100245762 156
181 3300025913 Ga0207695_10049797 Ga0207695_100497973 156
182 3300025913 Ga0207695_10069197 Ga0207695_100691975 156
183 3300025913 Ga0207695_10462674 Ga0207695_104626742 156
184 3300025913 Ga0207695_10552515 Ga0207695_105525152 156
185 3300025924 Ga0207694_10060915 Ga0207694_100609152 156
186 3300025924 Ga0207694_10176179 Ga0207694_101761793 156
187 3300025926 Ga0207659_10415805 Ga0207659_104158052 156
188 3300025927 Ga0207687_10222552 Ga0207687_102225522 156
189 3300025928 Ga0207700_10885261 Ga0207700_108852611 156
190 3300025929 Ga0207664_10024852 Ga0207664_100248524 156
191 3300025934 Ga0207686_10231943 Ga0207686_102319431 156
192 3300025936 Ga0207670_10016447 Ga0207670_100164472 156
193 3300025936 Ga0207670_10303615 Ga0207670_103036152 156
194 3300025936 Ga0207670_10458604 Ga0207670_104586041 156
195 3300025936 Ga0207670_10805388 Ga0207670_108053882 156
196 3300025949 Ga0207667_10480585 Ga0207667_104805852 156
197 3300026041 Ga0207639_10362799 Ga0207639_103627992 156
198 3300026078 Ga0207702_10000808 Ga0207702_100008081 156
199 3300026078 Ga0207702_10020731 Ga0207702_100207312 156
200 3300026078 Ga0207702_10020867 Ga0207702_100208673 156
201 3300026088 Ga0207641_10435933 Ga0207641_104359332 156
202 3300026095 Ga0207676_11062445 Ga0207676_110624451 156
203 3300026116 Ga0207674_10096275 Ga0207674_100962752 156
204 3300026116 Ga0207674_10131333 Ga0207674_101313333 156
205 3300026142 Ga0207698_10461120 Ga0207698_104611202 156
206 3300028380 Ga0268265_10573712 Ga0268265_105737121 156
207 3300028556 Ga0265337_1044031 Ga0265337_10440312 156
208 3300028558 Ga0265326_10015765 Ga0265326_100157652 156
209 3300028558 Ga0265326_10026945 Ga0265326_100269451 156
210 3300028563 Ga0265319_1000016 Ga0265319_1000016169 156
211 3300028563 Ga0265319_1054778 Ga0265319_10547782 156
212 3300028573 Ga0265334_10035360 Ga0265334_100353602 156
213 3300028573 Ga0265334_10036479 Ga0265334_100364792 156
214 3300028577 Ga0265318_10181978 Ga0265318_101819782 156
215 3300028577 Ga0265318_10271937 Ga0265318_102719371 156
216 3300028653 Ga0265323_10043416 Ga0265323_100434161 156
217 3300028654 Ga0265322_10152290 Ga0265322_101522901 156
218 3300028666 Ga0265336_10185351 Ga0265336_101853512 156
219 3300028800 Ga0265338_10000487 Ga0265338_1000048724 156
220 3300028800 Ga0265338_10000605 Ga0265338_100006057 156
221 3300028800 Ga0265338_10000808 Ga0265338_100008085 156
222 3300028800 Ga0265338_10003037 Ga0265338_100030376 156
223 3300028800 Ga0265338_10006411 Ga0265338_100064116 156
224 3300028800 Ga0265338_10006466 Ga0265338_100064665 156
225 3300028800 Ga0265338_10021100 Ga0265338_100211007 156
226 3300028800 Ga0265338_10032281 Ga0265338_100322814 156
227 3300028800 Ga0265338_10036354 Ga0265338_100363545 156
228 3300028800 Ga0265338_10081261 Ga0265338_100812613 156
229 3300028800 Ga0265338_10194091 Ga0265338_101940912 156
230 3300028800 Ga0265338_10265699 Ga0265338_102656992 156
231 3300028800 Ga0265338_10798695 Ga0265338_107986952 156
232 3300028800 Ga0265338_11076035 Ga0265338_110760351 156
233 3300029957 Ga0265324_10000275 Ga0265324_100002754 156
234 3300029957 Ga0265324_10013737 Ga0265324_100137371 156
235 3300029957 Ga0265324_10086271 Ga0265324_100862712 156
236 3300031240 Ga0265320_10001118 Ga0265320_1000111811 156
237 3300031240 Ga0265320_10015186 Ga0265320_100151862 156
238 3300031240 Ga0265320_10090798 Ga0265320_100907982 156
239 3300031240 Ga0265320_10100847 Ga0265320_101008472 156
240 3300031240 Ga0265320_10186352 Ga0265320_101863522 156
241 3300031241 Ga0265325_10010574 Ga0265325_100105742 156
242 3300031241 Ga0265325_10250743 Ga0265325_102507431 156
243 3300031247 Ga0265340_10000208 Ga0265340_1000020812 156
244 3300031249 Ga0265339_10106588 Ga0265339_101065882 156
245 3300031251 Ga0265327_10001424 Ga0265327_1000142419 156
246 3300031251 Ga0265327_10048177 Ga0265327_100481772 156
247 3300031251 Ga0265327_10277127 Ga0265327_102771272 156
248 3300031595 Ga0265313_10026169 Ga0265313_100261692 156
249 3300031711 Ga0265314_10496370 Ga0265314_104963701 156
250 3300031728 Ga0316578_10260700 Ga0316578_102607001 156
251 3300031730 Ga0307516_10304137 Ga0307516_103041372 156
252 3300031733 Ga0316577_10408216 Ga0316577_104082162 156
253 3300035084 Ga0373928_0006300 Ga0373928_0006300_812_1291 156
254 3300035089 Ga0373944_0002365 Ga0373944_0002365_2612_3091 156
255 3300035090 Ga0373949_0001197 Ga0373949_0001197_4336_4815 156
256 3300035112 Ga0373932_0000003 Ga0373932_0000003_95764_96243 156
257 3300035114 Ga0373939_0008858 Ga0373939_0008858_898_1377 156
258 3300035117 Ga0373953_0091247 Ga0373953_0091247_255_728 156
259 3300035118 Ga0373954_0019754 Ga0373954_0019754_1512_1985 156
260 3300035118 Ga0373954_0052119 Ga0373954_0052119_593_1066 156
261 3300035119 Ga0373956_0132088 Ga0373956_0132088_233_706 156
262 3300035120 Ga0373957_0071932 Ga0373957_0071932_332_805 156
263 3300035170 Ga0373943_0083080 Ga0373943_0083080_509_988 156
264 3300035207 Ga0373942_0091305 Ga0373942_0091305_156_635 156
265 3300035242 Ga0373962_0000106 Ga0373962_0000106_12367_12846 156
266 3300035410 Ga0373924_0282904 Ga0373924_0282904_86_559 156
267 3300035691 Ga0373931_0000017 Ga0373931_0000017_95622_96101 156
268 3300035691 Ga0373931_0682849 Ga0373931_0682849_131_604 156
269 3300035692 Ga0373935_0018453 Ga0373935_0018453_1675_2151 156
270 3300035692 Ga0373935_0247232 Ga0373935_0247232_410_889 156
271 3300035695 Ga0373927_0009723 Ga0373927_0009723_4905_5384 156
272 3300035695 Ga0373927_0057013 Ga0373927_0057013_1141_1617 156
273 3300035695 Ga0373927_0322657 Ga0373927_0322657_245_721 156
274 3300035695 Ga0373927_0660894 Ga0373927_0660894_22_498 156
275 3300035724 Ga0373933_0081746 Ga0373933_0081746_896_1369 156
276 3300035724 Ga0373933_0375953 Ga0373933_0375953_374_850 156
277 3300035725 Ga0373947_0018292 Ga0373947_0018292_834_1310 156
278 3300035725 Ga0373947_0023833 Ga0373947_0023833_691_1170 156
279 3300035725 Ga0373947_0510227 Ga0373947_0510227_310_786 156
280 3300036401 Ga0373937_0041151 Ga0373937_0041151_2940_3416 156
281 3300036401 Ga0373937_0413763 Ga0373937_0413763_118_591 156
282 3300036712 Ga0316584_0692393 Ga0316584_0692393_180_656 156
283 3300037068 Ga0373925_0001370 Ga0373925_0001370_10642_11121 156
284 3300037068 Ga0373925_0004833 Ga0373925_0004833_8738_9214 156
285 3300037068 Ga0373925_0009024 Ga0373925_0009024_4054_4533 156
286 3300037068 Ga0373925_0065716 Ga0373925_0065716_582_1058 156
287 3300037068 Ga0373925_0337671 Ga0373925_0337671_55_531 156
288 3300039450 Ga0436363_1175420 Ga0436363_1175420_120_596 156
289 3300041486 Ga0451807_1625061 Ga0451807_1625061_280_750 156
290 3300042876 Ga0451577_0003436 Ga0451577_0003436_12564_13043 156
291 3300042876 Ga0451577_0015600 Ga0451577_0015600_4151_4624 156
292 3300042876 Ga0451577_0326402 Ga0451577_0326402_442_918 156
293 3300044673 Ga0453683_0433601 Ga0453683_0433601_205_678 156
294 3300044673 Ga0453683_0584459 Ga0453683_0584459_150_623 156
295 3300044712 Ga0453684_0004628 Ga0453684_0004628_23582_24061 156
296 3300044712 Ga0453684_0013527 Ga0453684_0013527_2410_2898 156
297 3300044712 Ga0453684_0257863 Ga0453684_0257863_1187_1663 156
298 3300044712 Ga0453684_0304608 Ga0453684_0304608_467_943 156
299 3300045051 Ga0451576_0070874 Ga0451576_0070874_3107_3580 156
300 3300045051 Ga0451576_0101374 Ga0451576_0101374_208_684 156
301 3300045051 Ga0451576_0119407 Ga0451576_0119407_2242_2724 156
302 3300045051 Ga0451576_0277401 Ga0451576_0277401_1206_1682 156
303 3300045051 Ga0451576_0285316 Ga0451576_0285316_274_747 156
304 3300045051 Ga0451576_0327736 Ga0451576_0327736_204_674 156
305 3300045051 Ga0451576_0559374 Ga0451576_0559374_457_933 156
306 3300045051 Ga0451576_0911256 Ga0451576_0911256_172_645 156
307 3300045051 Ga0451576_0921262 Ga0451576_0921262_149_625 156
308 3300045051 Ga0451576_1388397 Ga0451576_1388397_59_535 156
309 3300046454 Ga0495592_0000012 Ga0495592_0000012_135465_135938 156
310 3300046454 Ga0495592_0008014 Ga0495592_0008014_1100_1573 156
311 3300046461 Ga0495641_0020043 Ga0495641_0020043_372_860 156
312 3300046462 Ga0495651_0820379 Ga0495651_0820379_52_528 156
313 3300046463 Ga0495653_0269626 Ga0495653_0269626_496_969 156
314 3300046473 Ga0495582_0008132 Ga0495582_0008132_3554_4030 156
315 3300046473 Ga0495582_0042644 Ga0495582_0042644_703_1191 156
316 3300046475 Ga0495639_0193063 Ga0495639_0193063_348_827 156
317 3300046476 Ga0495662_0024801 Ga0495662_0024801_1350_1823 156
318 3300046477 Ga0495664_0116525 Ga0495664_0116525_550_1023 156
319 3300046477 Ga0495664_0183556 Ga0495664_0183556_531_1004 156
320 3300046514 Ga0495618_0003395 Ga0495618_0003395_8725_9198 156
321 3300046514 Ga0495618_0152470 Ga0495618_0152470_785_1273 156
322 3300046516 Ga0495628_0000320 Ga0495628_0000320_39925_40398 156
323 3300046516 Ga0495628_0101979 Ga0495628_0101979_824_1297 156
324 3300046516 Ga0495628_0112984 Ga0495628_0112984_891_1367 156
325 3300046516 Ga0495628_0546532 Ga0495628_0546532_305_778 156
326 3300046517 Ga0495630_0000010 Ga0495630_0000010_109782_110258 156
327 3300046517 Ga0495630_0015375 Ga0495630_0015375_3418_3891 156
328 3300046517 Ga0495630_0085523 Ga0495630_0085523_760_1233 156
329 3300046517 Ga0495630_0866189 Ga0495630_0866189_117_605 156
330 3300046526 Ga0495666_0001932 Ga0495666_0001932_1175_1651 156
331 3300046526 Ga0495666_0215491 Ga0495666_0215491_298_771 156
332 3300046529 Ga0495652_0213841 Ga0495652_0213841_759_1232 156
333 3300046533 Ga0495640_0114169 Ga0495640_0114169_1203_1676 156
334 3300046533 Ga0495640_0145786 Ga0495640_0145786_939_1412 156
335 3300046533 Ga0495640_0164527 Ga0495640_0164527_732_1205 156
336 3300046535 Ga0495586_0000048 Ga0495586_0000048_55783_56259 156
337 3300046535 Ga0495586_0000867 Ga0495586_0000867_5351_5824 156
338 3300046535 Ga0495586_0001538 Ga0495586_0001538_8249_8722 156
339 3300046535 Ga0495586_0010259 Ga0495586_0010259_1426_1914 156
340 3300046535 Ga0495586_0619264 Ga0495586_0619264_54_533 156
341 3300046536 Ga0495587_0125912 Ga0495587_0125912_416_889 156
342 3300046543 Ga0495645_0060630 Ga0495645_0060630_2074_2547 156
343 3300046559 Ga0495667_0706338 Ga0495667_0706338_40_516 156
344 3300046559 Ga0495667_0829181 Ga0495667_0829181_10_483 156
345 3300046642 Ga0495634_0018314 Ga0495634_0018314_2602_3078 156
346 3300046642 Ga0495634_0018945 Ga0495634_0018945_930_1403 156
347 3300046642 Ga0495634_0067853 Ga0495634_0067853_1761_2249 156
348 3300046663 Ga0495635_0010465 Ga0495635_0010465_5923_6396 156
349 3300046675 Ga0495657_0275130 Ga0495657_0275130_524_997 156
350 3300046678 Ga0495599_0022090 Ga0495599_0022090_1882_2358 156
351 3300046678 Ga0495599_0091371 Ga0495599_0091371_166_639 156
352 3300046678 Ga0495599_0326041 Ga0495599_0326041_293_766 156
353 3300046681 Ga0495647_0015866 Ga0495647_0015866_1261_1749 156
354 3300046681 Ga0495647_0017659 Ga0495647_0017659_1439_1912 156
355 3300046681 Ga0495647_0181821 Ga0495647_0181821_253_729 156
356 3300046683 Ga0495658_0017047 Ga0495658_0017047_100_588 156
357 3300046684 Ga0495669_0112776 Ga0495669_0112776_337_810 156
358 3300046684 Ga0495669_0166625 Ga0495669_0166625_18_494 156
359 3300046689 Ga0495613_0001643 Ga0495613_0001643_4375_4848 156
360 3300046689 Ga0495613_0072400 Ga0495613_0072400_1559_2047 156
361 3300046689 Ga0495613_0608166 Ga0495613_0608166_124_597 156
362 3300046690 Ga0495624_0032378 Ga0495624_0032378_282_758 156
363 3300046690 Ga0495624_0076653 Ga0495624_0076653_1281_1754 156
364 3300046690 Ga0495624_0251536 Ga0495624_0251536_470_958 156
365 3300047315 Ga0495581_0243749 Ga0495581_0243749_244_717 156
366 3300047318 Ga0495636_0298126 Ga0495636_0298126_172_642 156
367 3300047319 Ga0495674_0001886 Ga0495674_0001886_8306_8782 156
368 3300047319 Ga0495674_0029720 Ga0495674_0029720_234_707 156
369 3300047319 Ga0495674_0190824 Ga0495674_0190824_387_860 156
370 3300047321 Ga0495676_0022222 Ga0495676_0022222_727_1203 156
371 3300047322 Ga0495680_0002831 Ga0495680_0002831_4526_4999 156
372 3300047322 Ga0495680_0155991 Ga0495680_0155991_577_1050 156
373 3300047444 Ga0495675_0118648 Ga0495675_0118648_525_1001 156
374 3300047471 Ga0495684_0833832 Ga0495684_0833832_114_590 156
375 3300048089 Ga0495614_0274048 Ga0495614_0274048_148_636 156
376 3300048908 Ga0496105_0809376 Ga0496105_0809376_167_646 156
377 3300048915 Ga0496112_1165561 Ga0496112_1165561_87_563 156
378 3300049568 Ga0501031_0000012 Ga0501031_0000012_18066_18539 156
379 3300049569 Ga0501032_0007666 Ga0501032_0007666_729_1202 156
380 3300049569 Ga0501032_0020292 Ga0501032_0020292_2641_3114 156
381 3300049569 Ga0501032_0282887 Ga0501032_0282887_224_697 156
382 3300049570 Ga0501033_0001607 Ga0501033_0001607_2972_3445 156
383 3300049570 Ga0501033_0012811 Ga0501033_0012811_3678_4151 156
384 3300049570 Ga0501033_0039943 Ga0501033_0039943_2950_3423 156
385 3300049571 Ga0501034_0250705 Ga0501034_0250705_1138_1611 156
386 3300049571 Ga0501034_0472220 Ga0501034_0472220_55_528 156
387 3300049572 Ga0501036_0265967 Ga0501036_0265967_927_1400 156
388 3300049573 Ga0501037_0042861 Ga0501037_0042861_2841_3314 156
389 3300049573 Ga0501037_0096065 Ga0501037_0096065_637_1110 156
390 3300049579 Ga0501043_0321666 Ga0501043_0321666_487_960 156
391 3300049580 Ga0501046_0356647 Ga0501046_0356647_35_508 156
392 3300049581 Ga0501047_0132940 Ga0501047_0132940_1860_2333 156
393 3300049581 Ga0501047_0283253 Ga0501047_0283253_122_595 156
394 3300049742 Ga0501080_0031912 Ga0501080_0031912_1659_2132 156
395 3300049822 Ga0501035_0003711 Ga0501035_0003711_9804_10277 156
396 3300049822 Ga0501035_0078062 Ga0501035_0078062_865_1338 156
397 3300049823 Ga0501044_0000024 Ga0501044_0000024_14927_15400 156
398 3300049823 Ga0501044_0040160 Ga0501044_0040160_3461_3934 156
399 3300049823 Ga0501044_0411069 Ga0501044_0411069_464_940 156
400 3300050514 nmdc:mga08x19_538286_c1 nmdc:mga08x19_538286_c1_171_647 156
401 3300053098 Ga0500650_0083328 Ga0500650_0083328_513_995 156

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.8317 13 133
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.8272 13 133
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.8253 13 133
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.8121 13 133
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.8068 13 133
ID Description Score Start End Superfamily
3c97A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9034 14 62 3.40.50.2300
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8253 13 133 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8128 14 97 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.797 12 97 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7963 13 135 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A832DBV9-F1-model_v4 Response regulatory domain-containing protein 0.97 1 132
AF-A0A2V8I6I8-F1-model_v4 Response regulatory domain-containing protein 0.968 25 137
AF-A0A832DBV9-F1-model_v4 Response regulatory domain-containing protein 0.9489 1 132
AF-A0A2V8I6I8-F1-model_v4 Response regulatory domain-containing protein 0.9436 25 137
AF-A0A2N2LP17-F1-model_v4 Response regulatory domain-containing protein 0.943 5 122

Feature Viewer

pLDDT pTM Quality
88.16 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map