F434857

General Info

Members Datasets Scaffolds Average Seq Length
401 181 390 314

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10194412|Ga0157380_101944121
Length 372
Sequence MSRLKCSFQYEDQTLESMPTHSSHVYLTTKILKGIVVSPTTTSSKYTEESDVRTITSFIALIAIASVFVRGGDTPHAQSWQPPTDSQRCPSKWGADDQRGSGNHMKPETVLRAVRLIKSGEVIELGHVLNSSMPFFGTRRFDVHTKRTFMNPESNRRGSNEELVVGEIGQVGTQFDGFAHQTIGDSMYNCFKVGDVSTRNGFEKLGIENVGALITRGVLIDIAGLKGVEILPDTYEITVKDIEQALARQNLKLQSGDAIILHTGWGKLWGKDNARYAKNCPGIGLAAAEWLARQDPMLVGADNVGVEVSPNPDLKLSLPIHQVMLVVNGIHLLENMKLDQLVAKRVQEFALIVQPLKIQGGTGSTVAPVAVH

Samples

Sample ID Description Type Environment
1 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
2 2791355199
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
7 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
8 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
181 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 1.5
Rhizoplane 1
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001698 3300005290 Bacteria 6374
2 Ga0065707_10088284 3300005295 Bacteria 4707
3 Ga0070676_10056067 3300005328 Bacteria 2327
4 Ga0070690_100028794 3300005330 Bacteria 3442
5 Ga0070677_10018160 3300005333 Bacteria 2530
6 Ga0070677_10027116 3300005333 Bacteria 2154
7 Ga0070677_10144226 3300005333 Bacteria 1102
8 Ga0068869_100078654 3300005334 Bacteria 2456
9 Ga0070666_10006686 3300005335 Bacteria 7095
10 Ga0068868_100030049 3300005338 Bacteria 4165
11 Ga0070687_100062494 3300005343 Bacteria 1972
12 Ga0070661_100174431 3300005344 Unclassified 1634
13 Ga0070669_100058758 3300005353 Bacteria 2822
14 Ga0070669_100059141 3300005353 Unclassified 2814
15 Ga0070669_100081197 3300005353 Bacteria 2415
16 Ga0070669_100419858 3300005353 Unclassified 1098
17 Ga0070675_100019282 3300005354 Bacteria 5434
18 Ga0070675_100035140 3300005354 Bacteria 4071
19 Ga0070675_100039002 3300005354 Bacteria 3874
20 Ga0070675_100080910 3300005354 Unclassified 2708
21 Ga0070675_100148866 3300005354 Bacteria 2006
22 Ga0070675_100164171 3300005354 Unclassified 1912
23 Ga0070671_100011808 3300005355 Bacteria 7026
24 Ga0070671_100182098 3300005355 Unclassified 1779
25 Ga0070674_100004995 3300005356 Bacteria 7607
26 Ga0070674_100102999 3300005356 Bacteria 2083
27 Ga0070673_100024094 3300005364 Bacteria 4456
28 Ga0070673_100028564 3300005364 Bacteria 4149
29 Ga0070673_100062297 3300005364 Bacteria 2963
30 Ga0070673_100124722 3300005364 Bacteria 2153
31 Ga0070688_100006467 3300005365 Bacteria 6268
32 Ga0070667_100012378 3300005367 Bacteria 7058
33 Ga0070667_100085404 3300005367 Bacteria 2707
34 Ga0070703_10030423 3300005406 Unclassified 1626
35 Ga0070701_10072306 3300005438 Unclassified 1847
36 Ga0070701_10139015 3300005438 Unclassified 1387
37 Ga0070700_100070629 3300005441 Bacteria 2227
38 Ga0070700_100264026 3300005441 Unclassified 1241
39 Ga0070694_100011456 3300005444 Bacteria 5492
40 Ga0070694_100077287 3300005444 Bacteria 2306
41 Ga0070708_100190469 3300005445 Bacteria 1918
42 Ga0070663_100163408 3300005455 Unclassified 1715
43 Ga0070678_100005056 3300005456 Bacteria 7563
44 Ga0070678_100105975 3300005456 Unclassified 2189
45 Ga0070678_100169315 3300005456 Bacteria 1777
46 Ga0070662_100021186 3300005457 Unclassified 4436
47 Ga0070662_100297814 3300005457 Bacteria 1309
48 Ga0068867_100009348 3300005459 Bacteria 6919
49 Ga0068867_100173143 3300005459 Bacteria 1711
50 Ga0070685_10006112 3300005466 Bacteria 6133
51 Ga0070706_100026020 3300005467 Bacteria 5384
52 Ga0070706_100050443 3300005467 Bacteria 3841
53 Ga0070707_100011132 3300005468 Bacteria 8382
54 Ga0070707_100113910 3300005468 Bacteria 2624
55 Ga0070679_100323470 3300005530 Unclassified 1491
56 Ga0070672_100011810 3300005543 Bacteria 6102
57 Ga0070672_100026095 3300005543 Bacteria 4342
58 Ga0070672_100067417 3300005543 Bacteria 2836
59 Ga0070672_100075057 3300005543 Bacteria 2698
60 Ga0070672_100077482 3300005543 Bacteria 2659
61 Ga0070672_100095406 3300005543 Bacteria 2405
62 Ga0070672_100127717 3300005543 Bacteria 2087
63 Ga0070686_100006985 3300005544 Bacteria 6293
64 Ga0070695_100004017 3300005545 Bacteria 8604
65 Ga0070696_100032928 3300005546 Bacteria 3558
66 Ga0070696_100286200 3300005546 Unclassified 1258
67 Ga0070665_100010796 3300005548 Bacteria 9237
68 Ga0070704_100061282 3300005549 Bacteria 2692
69 Ga0070704_100510027 3300005549 Bacteria 1045
70 Ga0070664_100227917 3300005564 Unclassified 1669
71 Ga0068859_100049784 3300005617 Bacteria 4209
72 Ga0068859_100145806 3300005617 Bacteria 2442
73 Ga0068859_100225269 3300005617 Bacteria 1963
74 Ga0068859_100313730 3300005617 Unclassified 1662
75 Ga0068864_100213984 3300005618 Bacteria 1776
76 Ga0068864_100242108 3300005618 Unclassified 1672
77 Ga0068864_100248132 3300005618 Unclassified 1652
78 Ga0068864_100523036 3300005618 Unclassified 1144
79 Ga0068861_100009277 3300005719 Bacteria 6788
80 Ga0068861_100009390 3300005719 Bacteria 6752
81 Ga0068861_100141064 3300005719 Bacteria 1967
82 Ga0068870_10089524 3300005840 Bacteria 1718
83 Ga0068870_10228104 3300005840 Bacteria 1144
84 Ga0068863_100031129 3300005841 Bacteria 5094
85 Ga0068858_100084333 3300005842 Bacteria 2956
86 Ga0068858_100188381 3300005842 Bacteria 1949
87 Ga0068860_100018794 3300005843 Bacteria 6713
88 Ga0068860_100028799 3300005843 Bacteria 5345
89 Ga0068860_100361360 3300005843 Bacteria 1430
90 Ga0068862_100073006 3300005844 Unclassified 2965
91 Ga0081455_10004424 3300005937 Bacteria 15772
92 Ga0081455_10006850 3300005937 Bacteria 12142
93 Ga0081455_10009107 3300005937 Bacteria 10243
94 Ga0081455_10021309 3300005937 Bacteria 6082
95 Ga0081455_10070911 3300005937 Plasmid 2891
96 Ga0081455_10268725 3300005937 Bacteria 1238
97 Ga0081538_10014501 3300005981 Bacteria 6167
98 Ga0081540_1002637 3300005983 Bacteria 14577
99 Ga0081540_1010611 3300005983 Bacteria 6220
100 Ga0081539_10002522 3300005985 Bacteria 25579
101 Ga0081539_10044206 3300005985 Bacteria 2573
102 Ga0075368_10048835 3300006042 Bacteria 1678
103 Ga0070715_10010215 3300006163 Plasmid 3339
104 Ga0075367_10046532 3300006178 Bacteria 2549
105 Ga0075367_10068010 3300006178 Bacteria 2136
106 Ga0075366_10005565 3300006195 Bacteria 6828
107 Ga0075366_10041946 3300006195 Bacteria 2709
108 Ga0097621_100008461 3300006237 Bacteria 7414
109 Ga0097621_100204411 3300006237 Bacteria 1716
110 Ga0097621_100320356 3300006237 Unclassified 1373
111 Ga0068871_100006622 3300006358 Bacteria 8216
112 Ga0068871_100007857 3300006358 Bacteria 7642
113 Ga0075428_100067169 3300006844 Bacteria 3926
114 Ga0075428_100302216 3300006844 Bacteria 1720
115 Ga0075428_100472842 3300006844 Unclassified 1342
116 Ga0075430_100077810 3300006846 Bacteria 2780
117 Ga0075430_100204181 3300006846 Bacteria 1640
118 Ga0075431_100004922 3300006847 Bacteria 13157
119 Ga0075431_100010605 3300006847 Bacteria 9268
120 Ga0075431_100170764 3300006847 Bacteria 2234
121 Ga0075431_100206397 3300006847 Bacteria 2009
122 Ga0075431_100277749 3300006847 Unclassified 1696
123 Ga0075431_100372418 3300006847 Unclassified 1433
124 Ga0075431_100423084 3300006847 Unclassified 1331
125 Ga0075433_10004705 3300006852 Bacteria 10635
126 Ga0075433_10015200 3300006852 Bacteria 6308
127 Ga0075433_10021511 3300006852 Bacteria 5409
128 Ga0075433_10208595 3300006852 Bacteria 1736
129 Ga0075433_10441119 3300006852 Unclassified 1148
130 Ga0075433_10491637 3300006852 Bacteria 1080
131 Ga0075434_100008263 3300006871 Bacteria 9667
132 Ga0075434_100026518 3300006871 Bacteria 5678
133 Ga0075434_100075075 3300006871 Unclassified 3374
134 Ga0075434_100128422 3300006871 Bacteria 2552
135 Ga0075434_100154030 3300006871 Bacteria 2318
136 Ga0075434_100358429 3300006871 Bacteria 1479
137 Ga0075429_100005496 3300006880 Bacteria 10910
138 Ga0075429_100007105 3300006880 Bacteria 9722
139 Ga0075429_100015469 3300006880 Bacteria 6610
140 Ga0075429_100046264 3300006880 Bacteria 3786
141 Ga0075429_100061622 3300006880 Bacteria 3268
142 Ga0075429_100309512 3300006880 Unclassified 1383
143 Ga0075436_100117491 3300006914 Bacteria 1859
144 Ga0097620_100049783 3300006931 Bacteria 4209
145 Ga0097620_100145804 3300006931 Bacteria 2442
146 Ga0097620_100225268 3300006931 Bacteria 1963
147 Ga0097620_100313699 3300006931 Unclassified 1662
148 Ga0075435_100049531 3300007076 Bacteria 3379
149 Ga0075435_100077337 3300007076 Bacteria 2728
150 Ga0111539_10001818 3300009094 Bacteria 28402
151 Ga0111539_10025082 3300009094 Bacteria 7308
152 Ga0111539_10111252 3300009094 Unclassified 3214
153 Ga0111539_10306586 3300009094 Bacteria 1848
154 Ga0111539_10619588 3300009094 Bacteria 1260
155 Ga0114129_10000839 3300009147 Bacteria 39797
156 Ga0114129_10005328 3300009147 Bacteria 18157
157 Ga0114129_10014091 3300009147 Bacteria 11389
158 Ga0114129_10021903 3300009147 Bacteria 9071
159 Ga0114129_10030816 3300009147 Bacteria 7585
160 Ga0114129_10038630 3300009147 Bacteria 6731
161 Ga0114129_10042155 3300009147 Bacteria 6427
162 Ga0114129_10055143 3300009147 Bacteria 5571
163 Ga0114129_10058489 3300009147 Bacteria 5392
164 Ga0114129_10061974 3300009147 Bacteria 5226
165 Ga0114129_10141086 3300009147 Bacteria 3303
166 Ga0114129_10257605 3300009147 Bacteria 2340
167 Ga0114129_10362680 3300009147 Unclassified 1917
168 Ga0114129_10452673 3300009147 Bacteria 1683
169 Ga0114129_10568523 3300009147 Unclassified 1472
170 Ga0105243_10007315 3300009148 Bacteria 8491
171 Ga0105242_10018182 3300009176 Bacteria 5492
172 Ga0105248_10300398 3300009177 Unclassified 1808
173 Ga0105249_10013887 3300009553 Bacteria 7119
174 Ga0105246_10187690 3300011119 Unclassified 1597
175 Ga0163162_10006792 3300013306 Bacteria 11100
176 Ga0163162_10812577 3300013306 Bacteria 1052
177 Ga0157375_10046749 3300013308 Bacteria 4223
178 Ga0157375_10199628 3300013308 Bacteria 2156
179 Ga0163163_10041102 3300014325 Bacteria 4520
180 Ga0157380_10040390 3300014326 Bacteria 3633
181 Ga0157380_10158172 3300014326 Unclassified 1966
182 Ga0157380_10194412 3300014326 Unclassified 1794
183 Ga0157380_10316935 3300014326 Unclassified 1444
184 Ga0157377_10014855 3300014745 Unclassified 3972
185 Ga0157377_10098166 3300014745 Bacteria 1741
186 Ga0157377_10237367 3300014745 Bacteria 1175
187 Ga0157379_10007641 3300014968 Bacteria 9355
188 Ga0157379_10316612 3300014968 Bacteria 1424
189 Ga0163161_10005795 3300017792 Bacteria 8567
190 Ga0207697_10003037 3300025315 Bacteria 8426
191 Ga0207682_10000612 3300025893 Bacteria 16611
192 Ga0207682_10006330 3300025893 Bacteria 4777
193 Ga0207682_10016048 3300025893 Bacteria 2919
194 Ga0207688_10000544 3300025901 Bacteria 18348
195 Ga0207688_10195928 3300025901 Bacteria 1210
196 Ga0207680_10013087 3300025903 Bacteria 4249
197 Ga0207680_10206142 3300025903 Bacteria 1342
198 Ga0207685_10026313 3300025905 Unclassified 2021
199 Ga0207645_10002837 3300025907 Bacteria 13445
200 Ga0207645_10003997 3300025907 Bacteria 10995
201 Ga0207645_10062312 3300025907 Bacteria 2382
202 Ga0207645_10249962 3300025907 Bacteria 1173
203 Ga0207643_10000450 3300025908 Bacteria 26721
204 Ga0207643_10247167 3300025908 Bacteria 1098
205 Ga0207684_10036843 3300025910 Bacteria 4151
206 Ga0207684_10037393 3300025910 Unclassified 4119
207 Ga0207684_10183584 3300025910 Bacteria 1804
208 Ga0207660_10155557 3300025917 Bacteria 1760
209 Ga0207662_10035680 3300025918 Bacteria 2905
210 Ga0207646_10106337 3300025922 Bacteria 2517
211 Ga0207681_10099314 3300025923 Bacteria 2096
212 Ga0207681_10209372 3300025923 Bacteria 1502
213 Ga0207681_10280197 3300025923 Bacteria 1312
214 Ga0207650_10009997 3300025925 Bacteria 6495
215 Ga0207650_10023376 3300025925 Bacteria 4382
216 Ga0207659_10023166 3300025926 Bacteria 4141
217 Ga0207659_10035803 3300025926 Bacteria 3434
218 Ga0207659_10052796 3300025926 Unclassified 2897
219 Ga0207644_10012060 3300025931 Bacteria 5732
220 Ga0207644_10015612 3300025931 Bacteria 5101
221 Ga0207706_10071116 3300025933 Unclassified 3060
222 Ga0207706_10202312 3300025933 Bacteria 1742
223 Ga0207706_10502204 3300025933 Bacteria 1047
224 Ga0207686_10002750 3300025934 Bacteria 9533
225 Ga0207709_10027700 3300025935 Bacteria 3268
226 Ga0207704_10082604 3300025938 Bacteria 2082
227 Ga0207704_10188632 3300025938 Bacteria 1497
228 Ga0207704_10245259 3300025938 Bacteria 1341
229 Ga0207691_10004632 3300025940 Bacteria 13310
230 Ga0207691_10032203 3300025940 Bacteria 4889
231 Ga0207691_10056898 3300025940 Bacteria 3561
232 Ga0207711_10209103 3300025941 Unclassified 1782
233 Ga0207711_10299579 3300025941 Bacteria 1483
234 Ga0207689_10001850 3300025942 Bacteria 20023
235 Ga0207651_10030860 3300025960 Bacteria 3418
236 Ga0207651_10033173 3300025960 Bacteria 3327
237 Ga0207651_10058129 3300025960 Bacteria 2671
238 Ga0207651_10285493 3300025960 Bacteria 1366
239 Ga0207712_10080250 3300025961 Bacteria 2373
240 Ga0207677_10163206 3300026023 Bacteria 1733
241 Ga0207703_10074102 3300026035 Bacteria 2818
242 Ga0207708_10283760 3300026075 Unclassified 1342
243 Ga0207641_10017522 3300026088 Bacteria 5864
244 Ga0207648_10005451 3300026089 Bacteria 12816
245 Ga0207648_10079666 3300026089 Bacteria 2858
246 Ga0207648_10233897 3300026089 Bacteria 1635
247 Ga0207648_10268555 3300026089 Bacteria 1523
248 Ga0207676_10439310 3300026095 Bacteria 1228
249 Ga0207674_10412220 3300026116 Bacteria 1306
250 Ga0207674_10422193 3300026116 Unclassified 1289
251 Ga0207675_100005152 3300026118 Bacteria 12589
252 Ga0207675_100154379 3300026118 Bacteria 2187
253 Ga0207675_100227048 3300026118 Bacteria 1800
254 Ga0207683_10012404 3300026121 Bacteria 7272
255 Ga0207683_10014951 3300026121 Bacteria 6607
256 Ga0207683_10042719 3300026121 Bacteria 3960
257 Ga0207683_10093875 3300026121 Bacteria 2674
258 Ga0209982_1016577 3300027552 Bacteria 1120
259 Ga0209971_1024768 3300027682 Bacteria 1433
260 Ga0209813_10001308 3300027866 Bacteria 5563
261 Ga0207428_10000013 3300027907 Bacteria 346742
262 Ga0207428_10000145 3300027907 Bacteria 96603
263 Ga0207428_10005192 3300027907 Bacteria 12179
264 Ga0207428_10020970 3300027907 Bacteria 5539
265 Ga0207428_10028285 3300027907 Bacteria 4658
266 Ga0207428_10082617 3300027907 Unclassified 2507
267 Ga0268265_10057641 3300028380 Bacteria 2962
268 Ga0268265_10106849 3300028380 Bacteria 2274
269 Ga0268264_10076231 3300028381 Bacteria 2852
270 Ga0307509_10166244 3300031507 Bacteria 2094
271 Ga0307405_10255270 3300031731 Bacteria 1307
272 Ga0373940_0039343 3300035088 Bacteria 1294
273 Ga0373949_0029585 3300035090 Bacteria 1299
274 Ga0373932_0008426 3300035112 Bacteria 2465
275 Ga0373942_0019034 3300035207 Bacteria 1710
276 Ga0373962_0033819 3300035242 Bacteria 1413
277 Ga0373931_0015772 3300035691 Bacteria 3708
278 Ga0439462_0017235 3300042015 Unclassified 1871
279 Ga0439444_0030455 3300042437 Bacteria 1011
280 Ga0495617_003956 3300046452 Bacteria 5457
281 Ga0495638_0006587 3300046460 Bacteria 8442
282 Ga0495580_0006259 3300046472 Bacteria 9733
283 Ga0495584_0021350 3300046491 Bacteria 3290
284 Ga0495584_0184593 3300046491 Unclassified 1060
285 Ga0495585_0025581 3300046492 Bacteria 3379
286 Ga0495610_0083202 3300046512 Bacteria 1465
287 Ga0495631_0026733 3300046518 Bacteria 2646
288 Ga0495632_0067019 3300046519 Bacteria 1731
289 Ga0495644_0070729 3300046523 Bacteria 1311
290 Ga0495598_0015388 3300046537 Bacteria 1931
291 Ga0495598_0063823 3300046537 Bacteria 1143
292 Ga0495656_0026369 3300046615 Bacteria 2313
293 Ga0495656_0093281 3300046615 Bacteria 1380
294 Ga0495668_0013031 3300046616 Bacteria 4920
295 Ga0495625_0105249 3300046660 Bacteria 1933
296 Ga0496102_0077014 3300048905 Bacteria 3069
297 Ga0496109_0491583 3300048912 Unclassified 1158
298 Ga0496112_0000051 3300048915 Bacteria 82351
299 Ga0496112_0086479 3300048915 Bacteria 3102
300 Ga0501299_009368 3300049522 Unclassified 1613
301 Ga0501040_0072059 3300049576 Bacteria 2386
302 Ga0501040_0102483 3300049576 Bacteria 1997
303 Ga0501040_0264297 3300049576 Unclassified 1228
304 Ga0501046_0093154 3300049580 Bacteria 2316
305 Ga0501048_0028089 3300049582 Bacteria 4085
306 Ga0501048_0182549 3300049582 Unclassified 1487
307 Ga0501048_0292765 3300049582 Unclassified 1158
308 Ga0501071_0016614 3300049587 Bacteria 5063
309 Ga0501071_0075744 3300049587 Unclassified 2457
310 Ga0501072_0073364 3300049588 Bacteria 2706
311 Ga0501072_0078940 3300049588 Bacteria 2606
312 Ga0501075_0029113 3300049591 Bacteria 4083
313 Ga0501075_0054032 3300049591 Bacteria 3021
314 Ga0501075_0075116 3300049591 Bacteria 2556
315 Ga0501076_0069998 3300049592 Bacteria 2804
316 Ga0501076_0125135 3300049592 Bacteria 2083
317 Ga0501236_009889 3300049670 Unclassified 1238
318 Ga0501249_007241 3300049679 Unclassified 2291
319 Ga0501079_0041842 3300049741 Bacteria 3538
320 Ga0501080_0107580 3300049742 Bacteria 2585
321 Ga0501081_0010292 3300049743 Bacteria 6106
322 Ga0501081_0028954 3300049743 Bacteria 3740
323 Ga0501081_0265912 3300049743 Bacteria 1254
324 Ga0501045_0190104 3300049824 Unclassified 1530
325 Ga0501045_0195529 3300049824 Bacteria 1507
326 nmdc:mga06z11_16506_c1 3300050494 Bacteria 3328
327 nmdc:mga06z11_43719_c1 3300050494 Bacteria 2256
328 nmdc:mga06z11_9025_c1 3300050494 Unclassified 4188
329 nmdc:mga04h51_5050_c1 3300050495 Bacteria 3337
330 nmdc:mga05p37_164641_c1 3300050507 Bacteria 2707
331 nmdc:mga05p37_17372_c1 3300050507 Bacteria 8680
332 nmdc:mga05p37_19401_c1 3300050507 Bacteria 8227
333 nmdc:mga05p37_200377_c1 3300050507 Bacteria 2418
334 nmdc:mga05p37_20197_c1 3300050507 Bacteria 8062
335 nmdc:mga05p37_21004_c1 3300050507 Bacteria 7903
336 nmdc:mga05p37_214052_c1 3300050507 Unclassified 2328
337 nmdc:mga05p37_217525_c1 3300050507 Bacteria 2307
338 nmdc:mga05p37_279646_c1 3300050507 Bacteria 1991
339 nmdc:mga05p37_380518_c1 3300050507 Bacteria 1654
340 nmdc:mga05p37_381536_c1 3300050507 Bacteria 1651
341 nmdc:mga05p37_416398_c1 3300050507 Bacteria 1565
342 nmdc:mga05p37_417049_c1 3300050507 Bacteria 1563
343 nmdc:mga05p37_683_c1 3300050507 Bacteria 37611
344 nmdc:mga05p37_6995_c1 3300050507 Bacteria 13296
345 nmdc:mga05p37_98945_c1 3300050507 Bacteria 3593
346 nmdc:mga09592_16704_c1 3300050508 Bacteria 6007
347 nmdc:mga09592_34047_c1 3300050508 Bacteria 4258
348 nmdc:mga09592_34279_c1 3300050508 Bacteria 4244
349 nmdc:mga09592_35704_c1 3300050508 Bacteria 4162
350 nmdc:mga09592_3995_c1 3300050508 Bacteria 11889
351 nmdc:mga09592_4618_c1 3300050508 Bacteria 11154
352 nmdc:mga0qj67_105367_c1 3300050509 Bacteria 2275
353 nmdc:mga0qj67_201139_c1 3300050509 Bacteria 1619
354 nmdc:mga0qj67_43338_c1 3300050509 Bacteria 3544
355 nmdc:mga0qj67_68166_c1 3300050509 Bacteria 2835
356 nmdc:mga06r32_151254_c1 3300050510 Unclassified 2300
357 nmdc:mga06r32_25014_c1 3300050510 Bacteria 5548
358 nmdc:mga06r32_252887_c1 3300050510 Bacteria 1750
359 nmdc:mga06r32_283300_c1 3300050510 Bacteria 1644
360 nmdc:mga06r32_32526_c1 3300050510 Bacteria 4908
361 nmdc:mga06r32_328438_c1 3300050510 Bacteria 1515
362 nmdc:mga06r32_489796_c1 3300050510 Unclassified 1207
363 nmdc:mga06r32_502418_c1 3300050510 Unclassified 1189
364 nmdc:mga06r32_7855_c1 3300050510 Bacteria 9585
365 nmdc:mga06r32_8446_c1 3300050510 Bacteria 9280
366 nmdc:mga06r32_90343_c1 3300050510 Bacteria 2992
367 nmdc:mga08y16_14552_c1 3300050511 Bacteria 8274
368 nmdc:mga08y16_17348_c1 3300050511 Bacteria 7580
369 nmdc:mga08y16_44258_c1 3300050511 Bacteria 4664
370 nmdc:mga08y16_47403_c1 3300050511 Unclassified 4498
371 nmdc:mga08y16_606333_c1 3300050511 Bacteria 1103
372 nmdc:mga08y16_80301_c1 3300050511 Bacteria 3400
373 nmdc:mga08y16_8724_c1 3300050511 Bacteria 10633
374 nmdc:mga0n895_117040_c1 3300050512 Unclassified 2684
375 nmdc:mga0n895_24473_c1 3300050512 Bacteria 5690
376 nmdc:mga0n895_34507_c1 3300050512 Bacteria 4871
377 nmdc:mga0n895_34815_c1 3300050512 Bacteria 4851
378 nmdc:mga0n895_7309_c1 3300050512 Bacteria 9468
379 nmdc:mga0rr50_25262_c1 3300050513 Bacteria 4128
380 nmdc:mga08x19_4556_c1 3300050514 Bacteria 8224
381 nmdc:mga0a205_14685_c1 3300050515 Bacteria 7307
382 nmdc:mga0a205_308997_c1 3300050515 Unclassified 1453
383 nmdc:mga0a205_459_c1 3300050515 Bacteria 31641
384 nmdc:mga0a205_49013_c1 3300050515 Bacteria 4077
385 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
386 nmdc:mga0a205_90042_c1 3300050515 Bacteria 2965
387 Ga0501084_0089075 3300054114 Bacteria 2590
388 Ga0501084_0302448 3300054114 Bacteria 1351
389 Ga0590077_001063 3300059426 Bacteria 6817
390 Ga0530510_0079320 3300061734 Unclassified 2388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0102483 Ga0501040_0102483_1214_1987 257
2 3300009147 Ga0114129_10042155 Ga0114129_100421553 268
3 3300009147 Ga0114129_10452673 Ga0114129_104526733 268
4 3300013306 Ga0163162_10812577 Ga0163162_108125771 268
5 3300025908 Ga0207643_10247167 Ga0207643_102471671 268
6 3300042437 Ga0439444_0030455 Ga0439444_0030455_109_915 268
7 3300050507 nmdc:mga05p37_6995_c1 nmdc:mga05p37_6995_c1_3176_3982 268
8 3300005353 Ga0070669_100419858 Ga0070669_1004198581 287
9 3300005438 Ga0070701_10139015 Ga0070701_101390152 287
10 3300025923 Ga0207681_10099314 Ga0207681_100993141 287
11 3300005444 Ga0070694_100011456 Ga0070694_1000114566 297
12 3300005468 Ga0070707_100113910 Ga0070707_1001139102 297
13 3300005545 Ga0070695_100004017 Ga0070695_1000040176 297
14 3300005546 Ga0070696_100032928 Ga0070696_1000329284 297
15 3300009147 Ga0114129_10141086 Ga0114129_101410862 297
16 3300025922 Ga0207646_10106337 Ga0207646_101063372 297
17 3300006852 Ga0075433_10004705 Ga0075433_1000470510 298
18 3300006871 Ga0075434_100154030 Ga0075434_1001540302 298
19 3300006880 Ga0075429_100005496 Ga0075429_10000549611 298
20 3300007076 Ga0075435_100049531 Ga0075435_1000495313 298
21 3300009147 Ga0114129_10005328 Ga0114129_100053286 298
22 3300046491 Ga0495584_0184593 Ga0495584_0184593_141_1040 298
23 3300050507 nmdc:mga05p37_19401_c1 nmdc:mga05p37_19401_c1_421_1377 298
24 3300050507 nmdc:mga05p37_381536_c1 nmdc:mga05p37_381536_c1_517_1470 298
25 3300050508 nmdc:mga09592_3995_c1 nmdc:mga09592_3995_c1_379_1335 298
26 3300050510 nmdc:mga06r32_32526_c1 nmdc:mga06r32_32526_c1_3272_4228 298
27 3300050512 nmdc:mga0n895_34507_c1 nmdc:mga0n895_34507_c1_2657_3613 298
28 3300050515 nmdc:mga0a205_459_c1 nmdc:mga0a205_459_c1_24198_25154 298
29 3300049576 Ga0501040_0072059 Ga0501040_0072059_873_1817 299
30 3300049580 Ga0501046_0093154 Ga0501046_0093154_1249_2193 299
31 3300049582 Ga0501048_0182549 Ga0501048_0182549_184_1128 299
32 3300049587 Ga0501071_0075744 Ga0501071_0075744_1174_2118 299
33 3300049588 Ga0501072_0073364 Ga0501072_0073364_834_1778 299
34 3300049591 Ga0501075_0029113 Ga0501075_0029113_1068_2012 299
35 3300049592 Ga0501076_0069998 Ga0501076_0069998_204_1148 299
36 3300049824 Ga0501045_0190104 Ga0501045_0190104_256_1200 299
37 3300054114 Ga0501084_0089075 Ga0501084_0089075_1390_2334 299
38 3300005354 Ga0070675_100148866 Ga0070675_1001488662 301
39 3300005364 Ga0070673_100062297 Ga0070673_1000622972 301
40 3300005543 Ga0070672_100077482 Ga0070672_1000774824 301
41 3300005985 Ga0081539_10002522 Ga0081539_1000252213 301
42 3300006163 Ga0070715_10010215 Ga0070715_100102154 301
43 3300006847 Ga0075431_100010605 Ga0075431_1000106056 301
44 3300025905 Ga0207685_10026313 Ga0207685_100263131 301
45 3300025940 Ga0207691_10056898 Ga0207691_100568983 301
46 3300026089 Ga0207648_10268555 Ga0207648_102685552 301
47 3300027552 Ga0209982_1016577 Ga0209982_10165771 302
48 3300027682 Ga0209971_1024768 Ga0209971_10247681 302
49 3300025917 Ga0207660_10155557 Ga0207660_101555572 303
50 3300005354 Ga0070675_100080910 Ga0070675_1000809102 304
51 3300005364 Ga0070673_100024094 Ga0070673_1000240944 304
52 3300005543 Ga0070672_100075057 Ga0070672_1000750573 304
53 3300005618 Ga0068864_100523036 Ga0068864_1005230362 304
54 3300005840 Ga0068870_10089524 Ga0068870_100895241 304
55 3300005937 Ga0081455_10268725 Ga0081455_102687251 304
56 3300006880 Ga0075429_100015469 Ga0075429_1000154696 304
57 3300025926 Ga0207659_10052796 Ga0207659_100527961 304
58 3300025933 Ga0207706_10202312 Ga0207706_102023122 304
59 3300027907 Ga0207428_10028285 Ga0207428_100282854 304
60 3300046615 Ga0495656_0026369 Ga0495656_0026369_612_1562 304
61 3300050494 nmdc:mga06z11_9025_c1 nmdc:mga06z11_9025_c1_982_1947 304
62 3300050508 nmdc:mga09592_16704_c1 nmdc:mga09592_16704_c1_356_1312 304
63 3300050510 nmdc:mga06r32_252887_c1 nmdc:mga06r32_252887_c1_518_1471 304
64 3300050511 nmdc:mga08y16_8724_c1 nmdc:mga08y16_8724_c1_6568_7524 304
65 3300005543 Ga0070672_100067417 Ga0070672_1000674172 305
66 3300005618 Ga0068864_100213984 Ga0068864_1002139842 305
67 3300005719 Ga0068861_100141064 Ga0068861_1001410642 305
68 3300014745 Ga0157377_10237367 Ga0157377_102373671 305
69 3300025938 Ga0207704_10245259 Ga0207704_102452592 305
70 3300025940 Ga0207691_10032203 Ga0207691_100322034 305
71 3300026095 Ga0207676_10439310 Ga0207676_104393101 305
72 3300026118 Ga0207675_100227048 Ga0207675_1002270482 305
73 3300048915 Ga0496112_0000051 Ga0496112_0000051_76419_77372 305
74 3300005548 Ga0070665_100010796 Ga0070665_1000107969 306
75 3300006195 Ga0075366_10005565 Ga0075366_100055655 306
76 3300006847 Ga0075431_100206397 Ga0075431_1002063973 306
77 3300025925 Ga0207650_10023376 Ga0207650_100233764 306
78 3300025941 Ga0207711_10299579 Ga0207711_102995792 306
79 3300048912 Ga0496109_0491583 Ga0496109_0491583_11_931 306
80 3300049522 Ga0501299_009368 Ga0501299_009368_170_1105 306
81 3300050512 nmdc:mga0n895_24473_c1 nmdc:mga0n895_24473_c1_3052_3972 306
82 3300005549 Ga0070704_100510027 Ga0070704_1005100271 307
83 3300006852 Ga0075433_10208595 Ga0075433_102085952 307
84 3300025901 Ga0207688_10195928 Ga0207688_101959282 307
85 3300005937 Ga0081455_10004424 Ga0081455_100044242 309
86 3300005937 Ga0081455_10070911 Ga0081455_100709112 309
87 3300006847 Ga0075431_100170764 Ga0075431_1001707642 309
88 3300009094 Ga0111539_10111252 Ga0111539_101112523 309
89 3300027907 Ga0207428_10082617 Ga0207428_100826171 309
90 3300050507 nmdc:mga05p37_380518_c1 nmdc:mga05p37_380518_c1_642_1631 309
91 3300050509 nmdc:mga0qj67_68166_c1 nmdc:mga0qj67_68166_c1_1833_2822 309
92 3300050510 nmdc:mga06r32_90343_c1 nmdc:mga06r32_90343_c1_1034_2023 309
93 3300050511 nmdc:mga08y16_47403_c1 nmdc:mga08y16_47403_c1_2458_3447 309
94 3300050514 nmdc:mga08x19_4556_c1 nmdc:mga08x19_4556_c1_2205_3158 309
95 3300005445 Ga0070708_100190469 Ga0070708_1001904692 310
96 3300005467 Ga0070706_100050443 Ga0070706_1000504432 310
97 3300005468 Ga0070707_100011132 Ga0070707_1000111323 310
98 3300025910 Ga0207684_10183584 Ga0207684_101835842 310
99 3300046472 Ga0495580_0006259 Ga0495580_0006259_7530_8486 310
100 iso_pu_bacteria 2721755755 2723846373 311
101 iso_pu_bacteria 2791355199 2793081142 311
102 iso_pu_bacteria 2874604998 2874610663 311
103 iso_pu_bacteria 2876808645 2876811865 311
104 iso_pu_bacteria 2879110137 2879118731 311
105 iso_pu_bacteria 2889033259 2889039126 311
106 iso_pu_bacteria 2922361189 2922362188 311
107 iso_pu_bacteria 2922386360 2922388065 311
108 iso_pu_bacteria 8006984368 8006991854 311
109 iso_pu_bacteria 8006994254 8006995488 311
110 3300009094 Ga0111539_10306586 Ga0111539_103065863 312
111 3300035088 Ga0373940_0039343 Ga0373940_0039343_323_1267 312
112 3300035090 Ga0373949_0029585 Ga0373949_0029585_234_1178 312
113 3300035207 Ga0373942_0019034 Ga0373942_0019034_562_1506 312
114 3300035691 Ga0373931_0015772 Ga0373931_0015772_2580_3524 312
115 3300049591 Ga0501075_0075116 Ga0501075_0075116_1350_2294 312
116 3300049741 Ga0501079_0041842 Ga0501079_0041842_51_995 312
117 3300009147 Ga0114129_10014091 Ga0114129_100140912 313
118 3300050507 nmdc:mga05p37_98945_c1 nmdc:mga05p37_98945_c1_2456_3400 313
119 3300050510 nmdc:mga06r32_8446_c1 nmdc:mga06r32_8446_c1_6139_7089 313
120 3300005295 Ga0065707_10088284 Ga0065707_100882842 314
121 3300005328 Ga0070676_10056067 Ga0070676_100560672 314
122 3300005330 Ga0070690_100028794 Ga0070690_1000287943 314
123 3300005333 Ga0070677_10018160 Ga0070677_100181603 314
124 3300005354 Ga0070675_100019282 Ga0070675_1000192827 314
125 3300005354 Ga0070675_100164171 Ga0070675_1001641712 314
126 3300005364 Ga0070673_100028564 Ga0070673_1000285643 314
127 3300005367 Ga0070667_100085404 Ga0070667_1000854043 314
128 3300005441 Ga0070700_100070629 Ga0070700_1000706293 314
129 3300005441 Ga0070700_100264026 Ga0070700_1002640262 314
130 3300005457 Ga0070662_100297814 Ga0070662_1002978142 314
131 3300005459 Ga0068867_100009348 Ga0068867_1000093484 314
132 3300005543 Ga0070672_100011810 Ga0070672_1000118108 314
133 3300005617 Ga0068859_100313730 Ga0068859_1003137303 314
134 3300005618 Ga0068864_100248132 Ga0068864_1002481322 314
135 3300005719 Ga0068861_100009390 Ga0068861_1000093908 314
136 3300005842 Ga0068858_100084333 Ga0068858_1000843331 314
137 3300005843 Ga0068860_100018794 Ga0068860_1000187948 314
138 3300005843 Ga0068860_100028799 Ga0068860_1000287992 314
139 3300005985 Ga0081539_10044206 Ga0081539_100442062 314
140 3300006846 Ga0075430_100204181 Ga0075430_1002041812 314
141 3300006852 Ga0075433_10015200 Ga0075433_100152005 314
142 3300006871 Ga0075434_100008263 Ga0075434_1000082636 314
143 3300006931 Ga0097620_100313699 Ga0097620_1003136991 314
144 3300009094 Ga0111539_10619588 Ga0111539_106195881 314
145 3300009148 Ga0105243_10007315 Ga0105243_100073153 314
146 3300009176 Ga0105242_10018182 Ga0105242_100181825 314
147 3300009177 Ga0105248_10300398 Ga0105248_103003982 314
148 3300014325 Ga0163163_10041102 Ga0163163_100411023 314
149 3300014326 Ga0157380_10158172 Ga0157380_101581722 314
150 3300025893 Ga0207682_10016048 Ga0207682_100160485 314
151 3300025903 Ga0207680_10013087 Ga0207680_100130872 314
152 3300025907 Ga0207645_10003997 Ga0207645_1000399710 314
153 3300025907 Ga0207645_10062312 Ga0207645_100623122 314
154 3300025918 Ga0207662_10035680 Ga0207662_100356803 314
155 3300025923 Ga0207681_10280197 Ga0207681_102801972 314
156 3300025934 Ga0207686_10002750 Ga0207686_100027508 314
157 3300025935 Ga0207709_10027700 Ga0207709_100277003 314
158 3300025938 Ga0207704_10082604 Ga0207704_100826042 314
159 3300025941 Ga0207711_10209103 Ga0207711_102091032 314
160 3300025960 Ga0207651_10058129 Ga0207651_100581293 314
161 3300026035 Ga0207703_10074102 Ga0207703_100741022 314
162 3300026075 Ga0207708_10283760 Ga0207708_102837602 314
163 3300026089 Ga0207648_10005451 Ga0207648_100054519 314
164 3300026118 Ga0207675_100154379 Ga0207675_1001543793 314
165 3300027907 Ga0207428_10000145 Ga0207428_1000014553 314
166 3300028381 Ga0268264_10076231 Ga0268264_100762312 314
167 3300046537 Ga0495598_0015388 Ga0495598_0015388_832_1776 314
168 3300048915 Ga0496112_0086479 Ga0496112_0086479_198_1145 314
169 3300049582 Ga0501048_0292765 Ga0501048_0292765_97_1041 314
170 3300049670 Ga0501236_009889 Ga0501236_009889_125_1084 314
171 3300049679 Ga0501249_007241 Ga0501249_007241_680_1639 314
172 3300049743 Ga0501081_0010292 Ga0501081_0010292_4516_5460 314
173 3300050507 nmdc:mga05p37_417049_c1 nmdc:mga05p37_417049_c1_158_1117 314
174 3300050508 nmdc:mga09592_35704_c1 nmdc:mga09592_35704_c1_2874_3929 314
175 3300050510 nmdc:mga06r32_283300_c1 nmdc:mga06r32_283300_c1_355_1305 314
176 3300050510 nmdc:mga06r32_328438_c1 nmdc:mga06r32_328438_c1_435_1490 314
177 3300050511 nmdc:mga08y16_14552_c1 nmdc:mga08y16_14552_c1_2352_3407 314
178 3300050515 nmdc:mga0a205_14685_c1 nmdc:mga0a205_14685_c1_5135_6085 314
179 3300050515 nmdc:mga0a205_90042_c1 nmdc:mga0a205_90042_c1_551_1606 314
180 3300005333 Ga0070677_10027116 Ga0070677_100271163 315
181 3300005333 Ga0070677_10144226 Ga0070677_101442261 315
182 3300005334 Ga0068869_100078654 Ga0068869_1000786544 315
183 3300005335 Ga0070666_10006686 Ga0070666_100066863 315
184 3300005338 Ga0068868_100030049 Ga0068868_1000300491 315
185 3300005343 Ga0070687_100062494 Ga0070687_1000624942 315
186 3300005344 Ga0070661_100174431 Ga0070661_1001744312 315
187 3300005353 Ga0070669_100058758 Ga0070669_1000587582 315
188 3300005353 Ga0070669_100059141 Ga0070669_1000591411 315
189 3300005354 Ga0070675_100035140 Ga0070675_1000351403 315
190 3300005355 Ga0070671_100011808 Ga0070671_1000118084 315
191 3300005355 Ga0070671_100182098 Ga0070671_1001820982 315
192 3300005356 Ga0070674_100004995 Ga0070674_1000049955 315
193 3300005364 Ga0070673_100124722 Ga0070673_1001247223 315
194 3300005365 Ga0070688_100006467 Ga0070688_1000064675 315
195 3300005367 Ga0070667_100012378 Ga0070667_1000123784 315
196 3300005406 Ga0070703_10030423 Ga0070703_100304232 315
197 3300005438 Ga0070701_10072306 Ga0070701_100723063 315
198 3300005444 Ga0070694_100077287 Ga0070694_1000772872 315
199 3300005455 Ga0070663_100163408 Ga0070663_1001634082 315
200 3300005456 Ga0070678_100005056 Ga0070678_1000050564 315
201 3300005456 Ga0070678_100105975 Ga0070678_1001059753 315
202 3300005456 Ga0070678_100169315 Ga0070678_1001693151 315
203 3300005457 Ga0070662_100021186 Ga0070662_1000211864 315
204 3300005459 Ga0068867_100173143 Ga0068867_1001731432 315
205 3300005466 Ga0070685_10006112 Ga0070685_100061125 315
206 3300005543 Ga0070672_100026095 Ga0070672_1000260955 315
207 3300005543 Ga0070672_100095406 Ga0070672_1000954061 315
208 3300005543 Ga0070672_100127717 Ga0070672_1001277172 315
209 3300005544 Ga0070686_100006985 Ga0070686_1000069852 315
210 3300005549 Ga0070704_100061282 Ga0070704_1000612823 315
211 3300005564 Ga0070664_100227917 Ga0070664_1002279172 315
212 3300005617 Ga0068859_100049784 Ga0068859_1000497844 315
213 3300005617 Ga0068859_100145806 Ga0068859_1001458062 315
214 3300005618 Ga0068864_100242108 Ga0068864_1002421082 315
215 3300005719 Ga0068861_100009277 Ga0068861_1000092776 315
216 3300005840 Ga0068870_10228104 Ga0068870_102281041 315
217 3300005841 Ga0068863_100031129 Ga0068863_1000311295 315
218 3300005842 Ga0068858_100188381 Ga0068858_1001883813 315
219 3300005843 Ga0068860_100361360 Ga0068860_1003613602 315
220 3300005844 Ga0068862_100073006 Ga0068862_1000730063 315
221 3300005937 Ga0081455_10009107 Ga0081455_100091077 315
222 3300005937 Ga0081455_10021309 Ga0081455_100213092 315
223 3300005981 Ga0081538_10014501 Ga0081538_100145019 315
224 3300005983 Ga0081540_1002637 Ga0081540_100263711 315
225 3300005983 Ga0081540_1010611 Ga0081540_10106117 315
226 3300006237 Ga0097621_100008461 Ga0097621_10000846110 315
227 3300006237 Ga0097621_100204411 Ga0097621_1002044112 315
228 3300006237 Ga0097621_100320356 Ga0097621_1003203562 315
229 3300006358 Ga0068871_100006622 Ga0068871_1000066226 315
230 3300006358 Ga0068871_100007857 Ga0068871_10000785710 315
231 3300006846 Ga0075430_100077810 Ga0075430_1000778103 315
232 3300006847 Ga0075431_100004922 Ga0075431_1000049227 315
233 3300006847 Ga0075431_100372418 Ga0075431_1003724182 315
234 3300006852 Ga0075433_10021511 Ga0075433_100215113 315
235 3300006852 Ga0075433_10491637 Ga0075433_104916371 315
236 3300006871 Ga0075434_100128422 Ga0075434_1001284225 315
237 3300006871 Ga0075434_100358429 Ga0075434_1003584291 315
238 3300006880 Ga0075429_100007105 Ga0075429_1000071055 315
239 3300006914 Ga0075436_100117491 Ga0075436_1001174912 315
240 3300006931 Ga0097620_100049783 Ga0097620_1000497834 315
241 3300006931 Ga0097620_100145804 Ga0097620_1001458042 315
242 3300007076 Ga0075435_100077337 Ga0075435_1000773372 315
243 3300009094 Ga0111539_10001818 Ga0111539_100018181 315
244 3300009147 Ga0114129_10021903 Ga0114129_100219035 315
245 3300009147 Ga0114129_10030816 Ga0114129_100308162 315
246 3300009553 Ga0105249_10013887 Ga0105249_100138878 315
247 3300011119 Ga0105246_10187690 Ga0105246_101876902 315
248 3300013306 Ga0163162_10006792 Ga0163162_100067922 315
249 3300013308 Ga0157375_10046749 Ga0157375_100467493 315
250 3300013308 Ga0157375_10199628 Ga0157375_101996281 315
251 3300014326 Ga0157380_10040390 Ga0157380_100403903 315
252 3300014745 Ga0157377_10098166 Ga0157377_100981662 315
253 3300014968 Ga0157379_10007641 Ga0157379_100076417 315
254 3300014968 Ga0157379_10316612 Ga0157379_103166122 315
255 3300017792 Ga0163161_10005795 Ga0163161_100057953 315
256 3300025315 Ga0207697_10003037 Ga0207697_100030374 315
257 3300025893 Ga0207682_10000612 Ga0207682_1000061211 315
258 3300025893 Ga0207682_10006330 Ga0207682_100063304 315
259 3300025901 Ga0207688_10000544 Ga0207688_1000054412 315
260 3300025903 Ga0207680_10206142 Ga0207680_102061421 315
261 3300025907 Ga0207645_10002837 Ga0207645_100028375 315
262 3300025907 Ga0207645_10249962 Ga0207645_102499622 315
263 3300025908 Ga0207643_10000450 Ga0207643_1000045011 315
264 3300025923 Ga0207681_10209372 Ga0207681_102093722 315
265 3300025925 Ga0207650_10009997 Ga0207650_100099972 315
266 3300025926 Ga0207659_10023166 Ga0207659_100231661 315
267 3300025931 Ga0207644_10012060 Ga0207644_100120602 315
268 3300025931 Ga0207644_10015612 Ga0207644_100156122 315
269 3300025933 Ga0207706_10071116 Ga0207706_100711163 315
270 3300025933 Ga0207706_10502204 Ga0207706_105022041 315
271 3300025938 Ga0207704_10188632 Ga0207704_101886322 315
272 3300025940 Ga0207691_10004632 Ga0207691_100046325 315
273 3300025942 Ga0207689_10001850 Ga0207689_100018505 315
274 3300025960 Ga0207651_10030860 Ga0207651_100308604 315
275 3300025960 Ga0207651_10033173 Ga0207651_100331733 315
276 3300025961 Ga0207712_10080250 Ga0207712_100802501 315
277 3300026023 Ga0207677_10163206 Ga0207677_101632063 315
278 3300026088 Ga0207641_10017522 Ga0207641_100175226 315
279 3300026089 Ga0207648_10079666 Ga0207648_100796663 315
280 3300026089 Ga0207648_10233897 Ga0207648_102338972 315
281 3300026116 Ga0207674_10412220 Ga0207674_104122201 315
282 3300026116 Ga0207674_10422193 Ga0207674_104221932 315
283 3300026118 Ga0207675_100005152 Ga0207675_10000515210 315
284 3300026121 Ga0207683_10012404 Ga0207683_100124049 315
285 3300026121 Ga0207683_10014951 Ga0207683_100149513 315
286 3300026121 Ga0207683_10042719 Ga0207683_100427191 315
287 3300026121 Ga0207683_10093875 Ga0207683_100938752 315
288 3300027907 Ga0207428_10005192 Ga0207428_1000519210 315
289 3300028380 Ga0268265_10057641 Ga0268265_100576414 315
290 3300028380 Ga0268265_10106849 Ga0268265_101068491 315
291 3300031507 Ga0307509_10166244 Ga0307509_101662442 315
292 3300031731 Ga0307405_10255270 Ga0307405_102552701 315
293 3300035112 Ga0373932_0008426 Ga0373932_0008426_1142_2089 315
294 3300046452 Ga0495617_003956 Ga0495617_003956_3566_4519 315
295 3300046460 Ga0495638_0006587 Ga0495638_0006587_3478_4431 315
296 3300046492 Ga0495585_0025581 Ga0495585_0025581_1691_2644 315
297 3300046512 Ga0495610_0083202 Ga0495610_0083202_183_1136 315
298 3300046518 Ga0495631_0026733 Ga0495631_0026733_1406_2359 315
299 3300046519 Ga0495632_0067019 Ga0495632_0067019_372_1325 315
300 3300046523 Ga0495644_0070729 Ga0495644_0070729_121_1074 315
301 3300046616 Ga0495668_0013031 Ga0495668_0013031_477_1430 315
302 3300046660 Ga0495625_0105249 Ga0495625_0105249_667_1620 315
303 3300048905 Ga0496102_0077014 Ga0496102_0077014_1424_2377 315
304 3300049576 Ga0501040_0264297 Ga0501040_0264297_148_1101 315
305 3300050507 nmdc:mga05p37_17372_c1 nmdc:mga05p37_17372_c1_5088_6041 315
306 3300050507 nmdc:mga05p37_683_c1 nmdc:mga05p37_683_c1_31282_32235 315
307 3300050508 nmdc:mga09592_4618_c1 nmdc:mga09592_4618_c1_5982_6935 315
308 3300050510 nmdc:mga06r32_502418_c1 nmdc:mga06r32_502418_c1_225_1172 315
309 3300050510 nmdc:mga06r32_7855_c1 nmdc:mga06r32_7855_c1_3518_4471 315
310 3300050511 nmdc:mga08y16_17348_c1 nmdc:mga08y16_17348_c1_3763_4710 315
311 3300050511 nmdc:mga08y16_80301_c1 nmdc:mga08y16_80301_c1_183_1130 315
312 3300050512 nmdc:mga0n895_34815_c1 nmdc:mga0n895_34815_c1_136_1089 315
313 3300050513 nmdc:mga0rr50_25262_c1 nmdc:mga0rr50_25262_c1_2615_3568 315
314 3300050515 nmdc:mga0a205_49013_c1 nmdc:mga0a205_49013_c1_561_1514 315
315 3300005290 Ga0065712_10001698 Ga0065712_100016985 316
316 3300005353 Ga0070669_100081197 Ga0070669_1000811972 316
317 3300005354 Ga0070675_100039002 Ga0070675_1000390022 316
318 3300005356 Ga0070674_100102999 Ga0070674_1001029993 316
319 3300005467 Ga0070706_100026020 Ga0070706_1000260203 316
320 3300005530 Ga0070679_100323470 Ga0070679_1003234703 316
321 3300005546 Ga0070696_100286200 Ga0070696_1002862002 316
322 3300005617 Ga0068859_100225269 Ga0068859_1002252692 316
323 3300005937 Ga0081455_10006850 Ga0081455_100068505 316
324 3300006042 Ga0075368_10048835 Ga0075368_100488352 316
325 3300006178 Ga0075367_10046532 Ga0075367_100465323 316
326 3300006178 Ga0075367_10068010 Ga0075367_100680103 316
327 3300006195 Ga0075366_10041946 Ga0075366_100419462 316
328 3300006844 Ga0075428_100067169 Ga0075428_1000671693 316
329 3300006844 Ga0075428_100302216 Ga0075428_1003022161 316
330 3300006844 Ga0075428_100472842 Ga0075428_1004728422 316
331 3300006847 Ga0075431_100277749 Ga0075431_1002777492 316
332 3300006847 Ga0075431_100423084 Ga0075431_1004230842 316
333 3300006852 Ga0075433_10441119 Ga0075433_104411192 316
334 3300006871 Ga0075434_100026518 Ga0075434_1000265183 316
335 3300006871 Ga0075434_100075075 Ga0075434_1000750753 316
336 3300006880 Ga0075429_100046264 Ga0075429_1000462643 316
337 3300006880 Ga0075429_100061622 Ga0075429_1000616221 316
338 3300006880 Ga0075429_100309512 Ga0075429_1003095122 316
339 3300006931 Ga0097620_100225268 Ga0097620_1002252682 316
340 3300009094 Ga0111539_10025082 Ga0111539_100250823 316
341 3300009147 Ga0114129_10000839 Ga0114129_1000083916 316
342 3300009147 Ga0114129_10038630 Ga0114129_100386306 316
343 3300009147 Ga0114129_10055143 Ga0114129_100551435 316
344 3300009147 Ga0114129_10058489 Ga0114129_100584895 316
345 3300009147 Ga0114129_10061974 Ga0114129_100619744 316
346 3300009147 Ga0114129_10257605 Ga0114129_102576052 316
347 3300009147 Ga0114129_10362680 Ga0114129_103626802 316
348 3300009147 Ga0114129_10568523 Ga0114129_105685232 316
349 3300014326 Ga0157380_10194412 Ga0157380_101944121 316
350 3300014326 Ga0157380_10316935 Ga0157380_103169351 316
351 3300014745 Ga0157377_10014855 Ga0157377_100148552 316
352 3300025910 Ga0207684_10036843 Ga0207684_100368435 316
353 3300025910 Ga0207684_10037393 Ga0207684_100373933 316
354 3300025926 Ga0207659_10035803 Ga0207659_100358032 316
355 3300025960 Ga0207651_10285493 Ga0207651_102854931 316
356 3300027866 Ga0209813_10001308 Ga0209813_100013084 316
357 3300027866 Ga0209813_10001308 Ga0209813_100013086 316
358 3300027907 Ga0207428_10000013 Ga0207428_10000013266 316
359 3300027907 Ga0207428_10020970 Ga0207428_100209703 316
360 3300035242 Ga0373962_0033819 Ga0373962_0033819_74_1030 316
361 3300042015 Ga0439462_0017235 Ga0439462_0017235_734_1687 316
362 3300046491 Ga0495584_0021350 Ga0495584_0021350_1276_2235 316
363 3300046537 Ga0495598_0063823 Ga0495598_0063823_176_1126 316
364 3300046615 Ga0495656_0093281 Ga0495656_0093281_310_1269 316
365 3300049582 Ga0501048_0028089 Ga0501048_0028089_1878_2837 316
366 3300049587 Ga0501071_0016614 Ga0501071_0016614_2912_3871 316
367 3300049588 Ga0501072_0078940 Ga0501072_0078940_950_1909 316
368 3300049591 Ga0501075_0054032 Ga0501075_0054032_493_1452 316
369 3300049592 Ga0501076_0125135 Ga0501076_0125135_67_1164 316
370 3300049742 Ga0501080_0107580 Ga0501080_0107580_1090_2049 316
371 3300049743 Ga0501081_0028954 Ga0501081_0028954_1988_2947 316
372 3300049743 Ga0501081_0265912 Ga0501081_0265912_269_1225 316
373 3300049824 Ga0501045_0195529 Ga0501045_0195529_340_1299 316
374 3300050494 nmdc:mga06z11_16506_c1 nmdc:mga06z11_16506_c1_1772_2728 316
375 3300050494 nmdc:mga06z11_43719_c1 nmdc:mga06z11_43719_c1_366_1322 316
376 3300050495 nmdc:mga04h51_5050_c1 nmdc:mga04h51_5050_c1_1017_1973 316
377 3300050507 nmdc:mga05p37_164641_c1 nmdc:mga05p37_164641_c1_1079_2029 316
378 3300050507 nmdc:mga05p37_200377_c1 nmdc:mga05p37_200377_c1_440_1393 316
379 3300050507 nmdc:mga05p37_20197_c1 nmdc:mga05p37_20197_c1_6310_7266 316
380 3300050507 nmdc:mga05p37_21004_c1 nmdc:mga05p37_21004_c1_1113_2069 316
381 3300050507 nmdc:mga05p37_214052_c1 nmdc:mga05p37_214052_c1_62_1012 316
382 3300050507 nmdc:mga05p37_217525_c1 nmdc:mga05p37_217525_c1_175_1125 316
383 3300050507 nmdc:mga05p37_279646_c1 nmdc:mga05p37_279646_c1_590_1549 316
384 3300050507 nmdc:mga05p37_416398_c1 nmdc:mga05p37_416398_c1_86_1042 316
385 3300050508 nmdc:mga09592_34047_c1 nmdc:mga09592_34047_c1_2102_3058 316
386 3300050508 nmdc:mga09592_34279_c1 nmdc:mga09592_34279_c1_1482_2438 316
387 3300050509 nmdc:mga0qj67_105367_c1 nmdc:mga0qj67_105367_c1_466_1422 316
388 3300050509 nmdc:mga0qj67_201139_c1 nmdc:mga0qj67_201139_c1_277_1236 316
389 3300050509 nmdc:mga0qj67_43338_c1 nmdc:mga0qj67_43338_c1_623_1579 316
390 3300050510 nmdc:mga06r32_151254_c1 nmdc:mga06r32_151254_c1_665_1621 316
391 3300050510 nmdc:mga06r32_25014_c1 nmdc:mga06r32_25014_c1_3845_4804 316
392 3300050510 nmdc:mga06r32_489796_c1 nmdc:mga06r32_489796_c1_137_1087 316
393 3300050511 nmdc:mga08y16_44258_c1 nmdc:mga08y16_44258_c1_1068_2018 316
394 3300050511 nmdc:mga08y16_606333_c1 nmdc:mga08y16_606333_c1_108_1067 316
395 3300050512 nmdc:mga0n895_117040_c1 nmdc:mga0n895_117040_c1_400_1350 316
396 3300050512 nmdc:mga0n895_7309_c1 nmdc:mga0n895_7309_c1_5471_6430 316
397 3300050515 nmdc:mga0a205_308997_c1 nmdc:mga0a205_308997_c1_63_1013 316
398 3300050515 nmdc:mga0a205_627_c1 nmdc:mga0a205_627_c1_19636_20595 316
399 3300054114 Ga0501084_0302448 Ga0501084_0302448_258_1247 316
400 3300059426 Ga0590077_001063 Ga0590077_001063_2271_3227 316
401 3300061734 Ga0530510_0079320 Ga0530510_0079320_646_1743 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

123

308

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8295 34 316
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.8255 24 316
5ibz-assembly1.cif.gz_C crystal structure of a novel cyclase (pfam04199). 0.8198 36 316
5ibz-assembly1.cif.gz_B crystal structure of a novel cyclase (pfam04199). 0.8151 24 316
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.7899 24 316
ID Description Score Start End Superfamily
af_Q58193_2_186_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7567 65 316 3.50.30.50
af_Q58193_2_186_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.753 65 316 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7184 65 314 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.717 54 315 3.50.30.50
4ehiB02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.7163 229 279 3.40.140.20
ID Description Score Start End GO Terms
AF-A0A536Z1A2-F1-model_v4 Cyclase family protein 0.9884 170 316 GO:0004061
GO:0019441
AF-A0A537C2F8-F1-model_v4 Cyclase family protein 0.9874 176 316 GO:0004061
GO:0019441
AF-A0A1Q8B2X3-F1-model_v4 Cyclase 0.9872 159 215 GO:0004061
GO:0019441
AF-A0A537ACP5-F1-model_v4 Cyclase family protein 0.9812 201 316 GO:0004061
GO:0019441
AF-A0A1Q7MRX9-F1-model_v4 Cyclase 0.9812 159 215 GO:0004061
GO:0019441

Feature Viewer

pLDDT pTM Quality
85.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map