F434872

General Info

Members Datasets Scaffolds Average Seq Length
401 230 400 239

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10041636|Ga0265323_100416362
Length 263
Sequence VSAPLDIPIAILAGGLATRLRPITEKIPKSLLPVAGKPFLAHQLELLQSRGIRRAVLCLGYLGEMIQREFGDGAAFGIKLDYSFDSSHRLVAPKSDEGGSAAKADGPKLLGTGGAIKRALPLLGDEFFVLYGDSYLPVAYRPIAEFFRRSGKLGCMTVYRNEGRYDTSNVVFHDGEITVYDKKNRSPEMRHIDYGLSLFKASVFESYSAGQPFDLAEVMGKLVREKQLAGYEVRERFYEIGSPAGLSELETLLNPGKAGMTKP

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0.25
Rhizoplane 5.24
Rhizosphere 90.77
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001683 3300000546 Bacteria 2990
2 JGI24035J26624_1003973 3300002126 Unclassified 1401
3 rootH2_10000721 3300003320 Bacteria 45836
4 rootH2_10202343 3300003320 Bacteria 5203
5 rootH1_10323300 3300003323 Bacteria 1551
6 Ga0065703_1018758 3300005272 Bacteria 13579
7 Ga0065704_10141266 3300005289 Unclassified 1515
8 Ga0065712_10079435 3300005290 Bacteria 3218
9 Ga0065715_10001501 3300005293 Bacteria 16194
10 Ga0065715_10063523 3300005293 Unclassified 948
11 Ga0070658_10235765 3300005327 Bacteria 1550
12 Ga0070658_10317683 3300005327 Bacteria 1330
13 Ga0070676_10002838 3300005328 Bacteria 8949
14 Ga0070683_100007518 3300005329 Bacteria 9210
15 Ga0070683_100017443 3300005329 Bacteria 6346
16 Ga0070690_100024762 3300005330 Unclassified 3693
17 Ga0070690_100254956 3300005330 Bacteria 1242
18 Ga0070670_100013239 3300005331 Bacteria 7067
19 Ga0070670_100079178 3300005331 Bacteria 2824
20 Ga0070677_10015314 3300005333 Unclassified 2715
21 Ga0068869_100764754 3300005334 Unclassified 828
22 Ga0070666_10001983 3300005335 Bacteria 12444
23 Ga0070666_10057181 3300005335 Bacteria 2635
24 Ga0068868_100017371 3300005338 Bacteria 5359
25 Ga0068868_100075612 3300005338 Bacteria 2692
26 Ga0070689_100182442 3300005340 Unclassified 1705
27 Ga0070689_100606670 3300005340 Unclassified 948
28 Ga0070661_100032261 3300005344 Bacteria 3791
29 Ga0070661_100477718 3300005344 Unclassified 995
30 Ga0070668_100017734 3300005347 Bacteria 5338
31 Ga0070669_100001783 3300005353 Bacteria 15484
32 Ga0070675_100023006 3300005354 Unclassified 4980
33 Ga0070675_100433385 3300005354 Bacteria 1177
34 Ga0070671_100022544 3300005355 Bacteria 5143
35 Ga0070671_100024893 3300005355 Unclassified 4904
36 Ga0070674_100002849 3300005356 Bacteria 9559
37 Ga0070673_100004536 3300005364 Bacteria 8795
38 Ga0070659_100017614 3300005366 Bacteria 5381
39 Ga0070659_100060871 3300005366 Unclassified 2983
40 Ga0070667_100009201 3300005367 Bacteria 8178
41 Ga0070667_100687268 3300005367 Unclassified 946
42 Ga0070709_10001454 3300005434 Bacteria 12751
43 Ga0070714_100000912 3300005435 Bacteria 20923
44 Ga0070714_100004773 3300005435 Bacteria 10267
45 Ga0070714_100161672 3300005435 Unclassified 2026
46 Ga0070713_100002612 3300005436 Bacteria 11768
47 Ga0070713_100016144 3300005436 Bacteria 5610
48 Ga0070710_10001045 3300005437 Bacteria 13169
49 Ga0070710_10048381 3300005437 Bacteria 2375
50 Ga0070711_100001411 3300005439 Bacteria 13175
51 Ga0070708_100134808 3300005445 Unclassified 2287
52 Ga0070663_100006399 3300005455 Bacteria 7081
53 Ga0070678_100006171 3300005456 Bacteria 7006
54 Ga0070662_100168732 3300005457 Unclassified 1717
55 Ga0070662_100231552 3300005457 Bacteria 1478
56 Ga0070681_10015726 3300005458 Bacteria 7542
57 Ga0070706_100056223 3300005467 Bacteria 3632
58 Ga0070706_100309108 3300005467 Bacteria 1474
59 Ga0070707_100540145 3300005468 Unclassified 1128
60 Ga0070707_100632694 3300005468 Bacteria 1032
61 Ga0070698_100636688 3300005471 Unclassified 1007
62 Ga0070679_100010465 3300005530 Bacteria 8799
63 Ga0070679_100293539 3300005530 Bacteria 1577
64 Ga0070684_100001324 3300005535 Bacteria 17753
65 Ga0070684_100278164 3300005535 Bacteria 1533
66 Ga0070672_100009486 3300005543 Bacteria 6711
67 Ga0070672_100081395 3300005543 Bacteria 2596
68 Ga0070695_100330974 3300005545 Unclassified 1135
69 Ga0070696_100016484 3300005546 Unclassified 4977
70 Ga0070696_100441330 3300005546 Unclassified 1025
71 Ga0070665_100135328 3300005548 Unclassified 2466
72 Ga0070704_100055904 3300005549 Unclassified 2800
73 Ga0068855_100003998 3300005563 Bacteria 18007
74 Ga0068855_100008639 3300005563 Bacteria 12308
75 Ga0068855_100036842 3300005563 Bacteria 5819
76 Ga0068855_100089759 3300005563 Bacteria 3548
77 Ga0068855_100281154 3300005563 Bacteria 1848
78 Ga0068855_100301476 3300005563 Bacteria 1774
79 Ga0068855_100666876 3300005563 Bacteria 1116
80 Ga0070664_100001423 3300005564 Bacteria 19088
81 Ga0070664_100214058 3300005564 Bacteria 1722
82 Ga0068857_100143145 3300005577 Bacteria 2162
83 Ga0068857_100322389 3300005577 Bacteria 1427
84 Ga0068856_100000067 3300005614 Bacteria 98357
85 Ga0068856_100005808 3300005614 Bacteria 12159
86 Ga0068856_100005939 3300005614 Bacteria 12018
87 Ga0068856_100302033 3300005614 Bacteria 1618
88 Ga0068852_100000429 3300005616 Bacteria 27941
89 Ga0068864_100233975 3300005618 Unclassified 1700
90 Ga0068866_10010578 3300005718 Unclassified 3961
91 Ga0068851_10106219 3300005834 Unclassified 1495
92 Ga0068863_100092384 3300005841 Bacteria 2871
93 Ga0068863_100409505 3300005841 Unclassified 1327
94 Ga0068863_100753431 3300005841 Archaea 970
95 Ga0068858_100225391 3300005842 Bacteria 1776
96 Ga0068860_101070101 3300005843 Unclassified 825
97 Ga0081455_10004454 3300005937 Bacteria 15701
98 Ga0081540_1020185 3300005983 Bacteria 4018
99 Ga0070717_10013982 3300006028 Bacteria 6165
100 Ga0070717_10017239 3300006028 Bacteria 5615
101 Ga0070715_10011561 3300006163 Unclassified 3183
102 Ga0070716_100000376 3300006173 Bacteria 18255
103 Ga0075367_10139208 3300006178 Bacteria 1503
104 Ga0097621_100821062 3300006237 Bacteria 862
105 Ga0068871_100038546 3300006358 Unclassified 3818
106 Ga0068871_100360076 3300006358 Bacteria 1288
107 Ga0068865_100116173 3300006881 Unclassified 1982
108 Ga0099794_10097969 3300007265 Unclassified 1461
109 Ga0099795_10028274 3300007788 Unclassified 1905
110 Ga0099795_10081309 3300007788 Unclassified 1240
111 Ga0099795_10108420 3300007788 Bacteria 1098
112 Ga0105240_10000416 3300009093 Bacteria 78700
113 Ga0105240_10002293 3300009093 Bacteria 30974
114 Ga0105240_10049940 3300009093 Bacteria 5276
115 Ga0105240_10162907 3300009093 Bacteria 2647
116 Ga0105240_10225226 3300009093 Bacteria 2182
117 Ga0105240_10381700 3300009093 Bacteria 1591
118 Ga0105240_10573224 3300009093 Bacteria 1246
119 Ga0111539_10897867 3300009094 Unclassified 1031
120 Ga0105245_10044477 3300009098 Bacteria 3963
121 Ga0105245_10157519 3300009098 Unclassified 2152
122 Ga0105248_10135646 3300009177 Unclassified 2776
123 Ga0105248_10765351 3300009177 Unclassified 1090
124 Ga0105237_10222973 3300009545 Bacteria 1885
125 Ga0105238_10009123 3300009551 Bacteria 9928
126 Ga0105238_10012168 3300009551 Bacteria 8672
127 Ga0105238_10184555 3300009551 Bacteria 2062
128 Ga0105238_10564519 3300009551 Unclassified 1143
129 Ga0105249_10000024 3300009553 Bacteria 232947
130 Ga0105239_10016794 3300010375 Bacteria 8089
131 Ga0105246_10277108 3300011119 Bacteria 1344
132 Ga0157373_10256265 3300013100 Bacteria 1238
133 Ga0157373_10395640 3300013100 Unclassified 990
134 Ga0157371_10012511 3300013102 Bacteria 6485
135 Ga0157371_10343342 3300013102 Unclassified 1086
136 Ga0157370_10083804 3300013104 Bacteria 2997
137 Ga0157370_10087855 3300013104 Bacteria 2920
138 Ga0157370_10155345 3300013104 Bacteria 2129
139 Ga0157370_10295949 3300013104 Bacteria 1495
140 Ga0157369_10000445 3300013105 Bacteria 54768
141 Ga0157369_10021479 3300013105 Bacteria 7221
142 Ga0157369_10080497 3300013105 Unclassified 3487
143 Ga0157374_10000983 3300013296 Bacteria 24718
144 Ga0157374_10009326 3300013296 Bacteria 8418
145 Ga0157374_10011103 3300013296 Bacteria 7785
146 Ga0157374_10236643 3300013296 Bacteria 1795
147 Ga0157378_10023178 3300013297 Bacteria 5464
148 Ga0157378_10418121 3300013297 Bacteria 1324
149 Ga0157372_10079461 3300013307 Bacteria 3709
150 Ga0157372_10209367 3300013307 Unclassified 2259
151 Ga0157372_11043353 3300013307 Bacteria 946
152 Ga0157375_10001237 3300013308 Bacteria 22079
153 Ga0163163_10188142 3300014325 Unclassified 2113
154 Ga0163163_10970120 3300014325 Bacteria 913
155 Ga0157379_10110484 3300014968 Bacteria 2469
156 Ga0157376_10001717 3300014969 Bacteria 14564
157 Ga0157376_10017574 3300014969 Bacteria 5461
158 Ga0157376_10034421 3300014969 Unclassified 4090
159 Ga0163161_10001138 3300017792 Bacteria 20005
160 Ga0207666_1007695 3300025271 Unclassified 1425
161 Ga0207697_10000196 3300025315 Bacteria 32121
162 Ga0207692_10003760 3300025898 Bacteria 5962
163 Ga0207692_10085890 3300025898 Bacteria 1694
164 Ga0207688_10003064 3300025901 Bacteria 9117
165 Ga0207680_10027488 3300025903 Unclassified 3169
166 Ga0207680_10185182 3300025903 Unclassified 1410
167 Ga0207685_10000729 3300025905 Bacteria 5977
168 Ga0207699_10004442 3300025906 Bacteria 6708
169 Ga0207645_10000461 3300025907 Bacteria 33685
170 Ga0207705_10084789 3300025909 Bacteria 2314
171 Ga0207684_10047619 3300025910 Bacteria 3636
172 Ga0207707_10030407 3300025912 Bacteria 4725
173 Ga0207707_10324831 3300025912 Bacteria 1328
174 Ga0207695_10003898 3300025913 Bacteria 20640
175 Ga0207695_10004991 3300025913 Bacteria 17843
176 Ga0207695_10098821 3300025913 Bacteria 2917
177 Ga0207695_10273483 3300025913 Bacteria 1584
178 Ga0207695_10289779 3300025913 Bacteria 1529
179 Ga0207693_10002016 3300025915 Bacteria 17828
180 Ga0207663_10006384 3300025916 Bacteria 6030
181 Ga0207663_10615016 3300025916 Bacteria 855
182 Ga0207649_10036209 3300025920 Bacteria 2971
183 Ga0207649_10073011 3300025920 Unclassified 2197
184 Ga0207652_10044426 3300025921 Bacteria 3785
185 Ga0207652_10279833 3300025921 Bacteria 1505
186 Ga0207652_10348923 3300025921 Bacteria 1336
187 Ga0207646_10144316 3300025922 Unclassified 2145
188 Ga0207646_10459597 3300025922 Unclassified 1148
189 Ga0207681_10047432 3300025923 Unclassified 2894
190 Ga0207694_10004858 3300025924 Bacteria 10435
191 Ga0207694_10006225 3300025924 Bacteria 9115
192 Ga0207694_10026308 3300025924 Bacteria 4425
193 Ga0207694_10043118 3300025924 Unclassified 3482
194 Ga0207650_10085746 3300025925 Bacteria 2396
195 Ga0207687_10031171 3300025927 Bacteria 3602
196 Ga0207700_10079743 3300025928 Unclassified 2550
197 Ga0207700_10369769 3300025928 Bacteria 1252
198 Ga0207664_10002101 3300025929 Bacteria 13100
199 Ga0207664_10015518 3300025929 Bacteria 5532
200 Ga0207664_10092333 3300025929 Bacteria 2484
201 Ga0207644_10004188 3300025931 Bacteria 9359
202 Ga0207690_10046548 3300025932 Unclassified 2874
203 Ga0207690_10140549 3300025932 Bacteria 1779
204 Ga0207706_10009687 3300025933 Bacteria 8843
205 Ga0207706_10348781 3300025933 Bacteria 1287
206 Ga0207670_10124651 3300025936 Bacteria 1878
207 Ga0207669_10007281 3300025937 Bacteria 5104
208 Ga0207704_10580322 3300025938 Unclassified 915
209 Ga0207665_10004560 3300025939 Bacteria 9194
210 Ga0207691_10011706 3300025940 Bacteria 8424
211 Ga0207691_10045784 3300025940 Bacteria 4021
212 Ga0207711_10078517 3300025941 Unclassified 2880
213 Ga0207661_10009912 3300025944 Bacteria 6841
214 Ga0207661_10062439 3300025944 Bacteria 3014
215 Ga0207679_10097760 3300025945 Bacteria 2287
216 Ga0207679_10180280 3300025945 Bacteria 1747
217 Ga0207667_10151842 3300025949 Bacteria 2384
218 Ga0207667_10192515 3300025949 Bacteria 2092
219 Ga0207667_10237372 3300025949 Bacteria 1866
220 Ga0207667_10785257 3300025949 Unclassified 950
221 Ga0207651_10021559 3300025960 Unclassified 3919
222 Ga0207712_10000034 3300025961 Bacteria 202320
223 Ga0207668_10006523 3300025972 Bacteria 6895
224 Ga0207658_10012039 3300025986 Bacteria 5901
225 Ga0207678_10041390 3300026067 Bacteria 3995
226 Ga0207702_10021328 3300026078 Bacteria 5362
227 Ga0207702_10025029 3300026078 Unclassified 4951
228 Ga0207702_10059940 3300026078 Bacteria 3243
229 Ga0207702_10068399 3300026078 Bacteria 3051
230 Ga0207702_10121251 3300026078 Archaea 2340
231 Ga0207641_10424797 3300026088 Unclassified 1280
232 Ga0207641_10817937 3300026088 Archaea 922
233 Ga0207674_10077575 3300026116 Bacteria 3328
234 Ga0207674_10520318 3300026116 Bacteria 1149
235 Ga0207683_10040917 3300026121 Unclassified 4046
236 Ga0207698_10024860 3300026142 Bacteria 4210
237 Ga0268266_10597867 3300028379 Unclassified 1060
238 Ga0265337_1000211 3300028556 Bacteria 31300
239 Ga0265337_1001860 3300028556 Bacteria 10075
240 Ga0265337_1015226 3300028556 Unclassified 2523
241 Ga0265337_1058151 3300028556 Bacteria 1075
242 Ga0265326_10004275 3300028558 Unclassified 4587
243 Ga0265319_1011278 3300028563 Bacteria 3670
244 Ga0265319_1060993 3300028563 Unclassified 1224
245 Ga0265334_10099339 3300028573 Unclassified 1055
246 Ga0265318_10044628 3300028577 Bacteria 1677
247 Ga0265323_10000106 3300028653 Bacteria 48787
248 Ga0265323_10002568 3300028653 Bacteria 8255
249 Ga0265323_10002890 3300028653 Bacteria 7710
250 Ga0265323_10021560 3300028653 Unclassified 2467
251 Ga0265323_10041636 3300028653 Unclassified 1666
252 Ga0265323_10052418 3300028653 Unclassified 1443
253 Ga0265336_10000730 3300028666 Bacteria 17423
254 Ga0265338_10000101 3300028800 Bacteria 159323
255 Ga0265338_10000200 3300028800 Bacteria 113123
256 Ga0265338_10000263 3300028800 Bacteria 95638
257 Ga0265338_10000528 3300028800 Bacteria 67191
258 Ga0265338_10001238 3300028800 Bacteria 42063
259 Ga0265338_10002137 3300028800 Bacteria 30371
260 Ga0265338_10015153 3300028800 Bacteria 8504
261 Ga0265338_10029891 3300028800 Bacteria 5389
262 Ga0265338_10102066 3300028800 Bacteria 2334
263 Ga0265338_10233857 3300028800 Bacteria 1365
264 Ga0265338_10472405 3300028800 Unclassified 886
265 Ga0265324_10001354 3300029957 Bacteria 14300
266 Ga0265324_10009955 3300029957 Bacteria 3692
267 Ga0265324_10028385 3300029957 Bacteria 1974
268 Ga0265324_10033529 3300029957 Bacteria 1791
269 Ga0265762_1002513 3300030760 Bacteria 3313
270 Ga0265330_10010268 3300031235 Bacteria 4420
271 Ga0265330_10025760 3300031235 Unclassified 2664
272 Ga0265320_10000259 3300031240 Bacteria 43696
273 Ga0265320_10009735 3300031240 Bacteria 5767
274 Ga0265320_10013000 3300031240 Bacteria 4807
275 Ga0265320_10068653 3300031240 Bacteria 1674
276 Ga0265325_10036297 3300031241 Unclassified 2612
277 Ga0265325_10049213 3300031241 Unclassified 2176
278 Ga0265325_10239139 3300031241 Unclassified 825
279 Ga0265340_10035584 3300031247 Bacteria 2472
280 Ga0265339_10081430 3300031249 Bacteria 1711
281 Ga0265327_10000074 3300031251 Bacteria 214435
282 Ga0265327_10001388 3300031251 Bacteria 30912
283 Ga0265327_10001510 3300031251 Bacteria 28791
284 Ga0265316_10000457 3300031344 Bacteria 46314
285 Ga0265316_10003170 3300031344 Bacteria 16723
286 Ga0265316_10020791 3300031344 Bacteria 5576
287 Ga0265316_10053968 3300031344 Unclassified 3147
288 Ga0265316_10056126 3300031344 Unclassified 3078
289 Ga0265316_10132785 3300031344 Bacteria 1874
290 Ga0265316_10497863 3300031344 Unclassified 871
291 Ga0265314_10232299 3300031711 Bacteria 1069
292 Ga0265342_10072693 3300031712 Unclassified 2002
293 Ga0373928_0000902 3300035084 Bacteria 5814
294 Ga0373929_0001807 3300035085 Bacteria 4008
295 Ga0373944_0000030 3300035089 Bacteria 23893
296 Ga0373949_0005282 3300035090 Bacteria 2887
297 Ga0373951_0005702 3300035091 Bacteria 2882
298 Ga0373932_0000008 3300035112 Bacteria 167879
299 Ga0373945_0069941 3300035116 Bacteria 1327
300 Ga0373954_0180658 3300035118 Unclassified 1035
301 Ga0373960_0017576 3300035121 Unclassified 1855
302 Ga0373943_0115083 3300035170 Bacteria 1423
303 Ga0373955_0324237 3300035172 Bacteria 931
304 Ga0373962_0000016 3300035242 Bacteria 48133
305 Ga0373931_0000011 3300035691 Bacteria 304643
306 Ga0373931_0205376 3300035691 Unclassified 1179
307 Ga0373935_0016478 3300035692 Unclassified 4472
308 Ga0373927_0010937 3300035695 Bacteria 6040
309 Ga0373927_0090967 3300035695 Bacteria 1982
310 Ga0373933_0175499 3300035724 Bacteria 1365
311 Ga0373947_0016509 3300035725 Bacteria 4243
312 Ga0373947_0233222 3300035725 Unclassified 1213
313 Ga0373937_0002281 3300036401 Bacteria 16020
314 Ga0373937_0091934 3300036401 Bacteria 2812
315 Ga0373937_0446791 3300036401 Bacteria 1228
316 Ga0373925_0003657 3300037068 Bacteria 11837
317 Ga0436364_1552432 3300037853 Bacteria 10823
318 Ga0400489_06392 3300039093 Unclassified 2406
319 Ga0436365_0181741 3300039437 Bacteria 58736
320 Ga0436365_0638001 3300039437 Bacteria 2368
321 Ga0436365_0818575 3300039437 Bacteria 1020
322 Ga0436361_0250643 3300039447 Bacteria 1963
323 Ga0436361_0544514 3300039447 Bacteria 18652
324 Ga0436363_0391774 3300039450 Bacteria 929
325 Ga0451577_0028656 3300042876 Bacteria 5034
326 Ga0451577_0110352 3300042876 Unclassified 2460
327 Ga0453683_0026196 3300044673 Bacteria 3703
328 Ga0453683_0030661 3300044673 Bacteria 3399
329 Ga0453684_0033964 3300044712 Bacteria 7093
330 Ga0466959_0124216 3300045049 Bacteria 1833
331 Ga0451576_0024920 3300045051 Bacteria 6455
332 Ga0451576_0072501 3300045051 Bacteria 3584
333 Ga0451576_0220082 3300045051 Bacteria 1982
334 Ga0451576_0256877 3300045051 Bacteria 1826
335 Ga0495592_0014483 3300046454 Bacteria 5985
336 Ga0495638_0000512 3300046460 Bacteria 45543
337 Ga0495651_0041669 3300046462 Bacteria 3566
338 Ga0495662_0078885 3300046476 Unclassified 1600
339 Ga0495618_0000825 3300046514 Bacteria 21567
340 Ga0495628_0171201 3300046516 Bacteria 1646
341 Ga0495630_0023348 3300046517 Bacteria 4573
342 Ga0495630_0110186 3300046517 Unclassified 2085
343 Ga0495630_0130919 3300046517 Bacteria 1905
344 Ga0495586_0000437 3300046535 Bacteria 25052
345 Ga0495587_0155889 3300046536 Bacteria 1301
346 Ga0495645_0035990 3300046543 Bacteria 3610
347 Ga0495645_0090187 3300046543 Bacteria 2191
348 Ga0495645_0227579 3300046543 Bacteria 1251
349 Ga0495667_0014553 3300046559 Bacteria 5315
350 Ga0495667_0067892 3300046559 Bacteria 2329
351 Ga0495634_0002760 3300046642 Bacteria 14418
352 Ga0495635_0161718 3300046663 Bacteria 1524
353 Ga0495657_0121364 3300046675 Unclassified 1646
354 Ga0495613_0000360 3300046689 Bacteria 40275
355 Ga0495600_0096150 3300046809 Bacteria 1931
356 Ga0495604_0009211 3300047317 Bacteria 7815
357 Ga0495604_0015664 3300047317 Bacteria 6052
358 Ga0495674_0002309 3300047319 Bacteria 18707
359 Ga0495674_0090056 3300047319 Unclassified 2622
360 Ga0495676_0293461 3300047321 Bacteria 1098
361 Ga0495680_0001748 3300047322 Bacteria 23055
362 Ga0495680_0081059 3300047322 Bacteria 2451
363 Ga0495680_0100577 3300047322 Unclassified 2154
364 Ga0495675_0056431 3300047444 Bacteria 2490
365 Ga0495684_0017563 3300047471 Bacteria 5507
366 Ga0495684_0044494 3300047471 Unclassified 3399
367 Ga0495602_0501514 3300048088 Bacteria 848
368 Ga0496101_0014371 3300048904 Bacteria 5318
369 Ga0496101_0106904 3300048904 Bacteria 2102
370 Ga0496103_0007560 3300048906 Bacteria 6476
371 Ga0496104_0032731 3300048907 Unclassified 4840
372 Ga0496104_0085572 3300048907 Bacteria 3009
373 Ga0496104_0567610 3300048907 Bacteria 1045
374 Ga0496105_0022381 3300048908 Bacteria 5119
375 Ga0496105_0072780 3300048908 Unclassified 2840
376 Ga0496105_0211019 3300048908 Bacteria 1583
377 Ga0496106_0006147 3300048909 Bacteria 8880
378 Ga0496106_0225218 3300048909 Unclassified 1496
379 Ga0496107_0008031 3300048910 Bacteria 7286
380 Ga0496109_0002574 3300048912 Bacteria 15193
381 Ga0496110_0026021 3300048913 Bacteria 5003
382 Ga0496111_0005431 3300048914 Bacteria 8167
383 Ga0496112_0028736 3300048915 Bacteria 5371
384 Ga0496112_0048743 3300048915 Unclassified 4152
385 Ga0496112_0064044 3300048915 Bacteria 3627
386 Ga0496114_0192929 3300048917 Unclassified 1783
387 Ga0496115_0006150 3300048918 Bacteria 8781
388 Ga0496115_0007361 3300048918 Bacteria 8100
389 Ga0496123_0006651 3300048926 Bacteria 11147
390 Ga0496126_0000548 3300048929 Bacteria 72393
391 Ga0496126_0397825 3300048929 Bacteria 1118
392 Ga0501033_0029874 3300049570 Unclassified 4097
393 Ga0501043_0251970 3300049579 Unclassified 1360
394 Ga0501072_0012138 3300049588 Bacteria 6583
395 Ga0501080_0357728 3300049742 Unclassified 1317
396 Ga0501044_0009413 3300049823 Bacteria 10643
397 Ga0501044_0240131 3300049823 Bacteria 1756
398 Ga0495601_0081660 3300053077 Unclassified 2075
399 Ga0500643_105981 3300053087 Unclassified 761
400 Ga0500552_001591 3300053733 Bacteria 2165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10573224 Ga0105240_105732242 199
2 3300025913 Ga0207695_10289779 Ga0207695_102897792 199
3 3300049742 Ga0501080_0357728 Ga0501080_0357728_509_1237 208
4 3300031241 Ga0265325_10036297 Ga0265325_100362972 210
5 3300029957 Ga0265324_10028385 Ga0265324_100283852 211
6 3300039093 Ga0400489_06392 Ga0400489_06392_69_773 211
7 3300039450 Ga0436363_0391774 Ga0436363_0391774_231_869 211
8 3300031247 Ga0265340_10035584 Ga0265340_100355842 212
9 3300035695 Ga0373927_0090967 Ga0373927_0090967_890_1579 212
10 3300048918 Ga0496115_0006150 Ga0496115_0006150_250_954 212
11 3300005334 Ga0068869_100764754 Ga0068869_1007647541 213
12 3300005471 Ga0070698_100636688 Ga0070698_1006366881 213
13 3300005577 Ga0068857_100143145 Ga0068857_1001431453 213
14 3300009093 Ga0105240_10000416 Ga0105240_1000041629 213
15 3300009093 Ga0105240_10225226 Ga0105240_102252263 213
16 3300025913 Ga0207695_10003898 Ga0207695_100038985 213
17 3300025924 Ga0207694_10043118 Ga0207694_100431182 213
18 3300025928 Ga0207700_10369769 Ga0207700_103697692 213
19 3300026116 Ga0207674_10520318 Ga0207674_105203182 213
20 3300028379 Ga0268266_10597867 Ga0268266_105978672 213
21 3300028556 Ga0265337_1058151 Ga0265337_10581512 213
22 3300028800 Ga0265338_10015153 Ga0265338_100151537 213
23 3300028800 Ga0265338_10102066 Ga0265338_101020662 213
24 3300029957 Ga0265324_10001354 Ga0265324_100013541 213
25 3300029957 Ga0265324_10033529 Ga0265324_100335293 213
26 3300031241 Ga0265325_10049213 Ga0265325_100492132 213
27 3300035691 Ga0373931_0205376 Ga0373931_0205376_441_1133 213
28 3300046454 Ga0495592_0014483 Ga0495592_0014483_3776_4468 213
29 3300046462 Ga0495651_0041669 Ga0495651_0041669_2535_3227 213
30 3300046476 Ga0495662_0078885 Ga0495662_0078885_797_1489 213
31 3300046516 Ga0495628_0171201 Ga0495628_0171201_217_909 213
32 3300046517 Ga0495630_0110186 Ga0495630_0110186_288_980 213
33 3300046543 Ga0495645_0035990 Ga0495645_0035990_682_1374 213
34 3300046543 Ga0495645_0090187 Ga0495645_0090187_1044_1736 213
35 3300046543 Ga0495645_0227579 Ga0495645_0227579_395_1087 213
36 3300046559 Ga0495667_0014553 Ga0495667_0014553_3534_4226 213
37 3300046559 Ga0495667_0067892 Ga0495667_0067892_1370_2062 213
38 3300046663 Ga0495635_0161718 Ga0495635_0161718_88_780 213
39 3300046675 Ga0495657_0121364 Ga0495657_0121364_933_1625 213
40 3300046809 Ga0495600_0096150 Ga0495600_0096150_861_1553 213
41 3300047317 Ga0495604_0009211 Ga0495604_0009211_3219_3911 213
42 3300047317 Ga0495604_0015664 Ga0495604_0015664_1976_2668 213
43 3300047319 Ga0495674_0002309 Ga0495674_0002309_2655_3347 213
44 3300047319 Ga0495674_0090056 Ga0495674_0090056_729_1421 213
45 3300047322 Ga0495680_0100577 Ga0495680_0100577_1013_1705 213
46 3300047471 Ga0495684_0017563 Ga0495684_0017563_3443_4135 213
47 3300047471 Ga0495684_0044494 Ga0495684_0044494_993_1685 213
48 3300048088 Ga0495602_0501514 Ga0495602_0501514_51_743 213
49 3300049823 Ga0501044_0240131 Ga0501044_0240131_639_1349 213
50 3300053077 Ga0495601_0081660 Ga0495601_0081660_145_837 213
51 3300003323 rootH1_10323300 rootH1_103233002 214
52 3300005289 Ga0065704_10141266 Ga0065704_101412661 214
53 3300005340 Ga0070689_100182442 Ga0070689_1001824422 214
54 3300005435 Ga0070714_100004773 Ga0070714_1000047738 214
55 3300005458 Ga0070681_10015726 Ga0070681_100157262 214
56 3300005530 Ga0070679_100010465 Ga0070679_1000104656 214
57 3300005563 Ga0068855_100089759 Ga0068855_1000897594 214
58 3300009093 Ga0105240_10049940 Ga0105240_100499403 214
59 3300009093 Ga0105240_10162907 Ga0105240_101629072 214
60 3300009553 Ga0105249_10000024 Ga0105249_10000024136 214
61 3300013100 Ga0157373_10395640 Ga0157373_103956401 214
62 3300013104 Ga0157370_10087855 Ga0157370_100878553 214
63 3300013104 Ga0157370_10295949 Ga0157370_102959492 214
64 3300014968 Ga0157379_10110484 Ga0157379_101104842 214
65 3300014969 Ga0157376_10001717 Ga0157376_100017177 214
66 3300025912 Ga0207707_10030407 Ga0207707_100304072 214
67 3300025913 Ga0207695_10098821 Ga0207695_100988212 214
68 3300025913 Ga0207695_10273483 Ga0207695_102734832 214
69 3300025921 Ga0207652_10044426 Ga0207652_100444261 214
70 3300025921 Ga0207652_10279833 Ga0207652_102798331 214
71 3300025921 Ga0207652_10348923 Ga0207652_103489232 214
72 3300025929 Ga0207664_10015518 Ga0207664_100155186 214
73 3300025936 Ga0207670_10124651 Ga0207670_101246512 214
74 3300025949 Ga0207667_10785257 Ga0207667_107852572 214
75 3300025961 Ga0207712_10000034 Ga0207712_10000034136 214
76 3300035084 Ga0373928_0000902 Ga0373928_0000902_2529_3242 214
77 3300035085 Ga0373929_0001807 Ga0373929_0001807_2470_3183 214
78 3300035089 Ga0373944_0000030 Ga0373944_0000030_21389_22102 214
79 3300035090 Ga0373949_0005282 Ga0373949_0005282_817_1530 214
80 3300035091 Ga0373951_0005702 Ga0373951_0005702_16_729 214
81 3300035112 Ga0373932_0000008 Ga0373932_0000008_152896_153609 214
82 3300035116 Ga0373945_0069941 Ga0373945_0069941_275_988 214
83 3300035121 Ga0373960_0017576 Ga0373960_0017576_357_1070 214
84 3300035170 Ga0373943_0115083 Ga0373943_0115083_197_910 214
85 3300035242 Ga0373962_0000016 Ga0373962_0000016_41662_42375 214
86 3300035691 Ga0373931_0000011 Ga0373931_0000011_288115_288828 214
87 3300035692 Ga0373935_0016478 Ga0373935_0016478_416_1129 214
88 3300035695 Ga0373927_0010937 Ga0373927_0010937_684_1397 214
89 3300035725 Ga0373947_0016509 Ga0373947_0016509_2231_2944 214
90 3300037068 Ga0373925_0003657 Ga0373925_0003657_14_727 214
91 3300039437 Ga0436365_0638001 Ga0436365_0638001_928_1620 214
92 3300049570 Ga0501033_0029874 Ga0501033_0029874_942_1655 214
93 3300049579 Ga0501043_0251970 Ga0501043_0251970_580_1293 214
94 3300049588 Ga0501072_0012138 Ga0501072_0012138_263_961 214
95 3300049823 Ga0501044_0009413 Ga0501044_0009413_3346_4059 214
96 3300002126 JGI24035J26624_1003973 JGI24035J26624_10039732 215
97 3300003320 rootH2_10202343 rootH2_102023434 215
98 3300005293 Ga0065715_10001501 Ga0065715_100015017 215
99 3300005328 Ga0070676_10002838 Ga0070676_100028386 215
100 3300005330 Ga0070690_100024762 Ga0070690_1000247624 215
101 3300005333 Ga0070677_10015314 Ga0070677_100153142 215
102 3300005335 Ga0070666_10001983 Ga0070666_100019838 215
103 3300005338 Ga0068868_100017371 Ga0068868_1000173714 215
104 3300005340 Ga0070689_100606670 Ga0070689_1006066702 215
105 3300005347 Ga0070668_100017734 Ga0070668_1000177343 215
106 3300005353 Ga0070669_100001783 Ga0070669_1000017839 215
107 3300005354 Ga0070675_100023006 Ga0070675_1000230063 215
108 3300005355 Ga0070671_100024893 Ga0070671_1000248934 215
109 3300005356 Ga0070674_100002849 Ga0070674_1000028498 215
110 3300005364 Ga0070673_100004536 Ga0070673_1000045365 215
111 3300005367 Ga0070667_100009201 Ga0070667_1000092014 215
112 3300005434 Ga0070709_10001454 Ga0070709_1000145410 215
113 3300005435 Ga0070714_100161672 Ga0070714_1001616722 215
114 3300005436 Ga0070713_100002612 Ga0070713_1000026129 215
115 3300005437 Ga0070710_10001045 Ga0070710_100010455 215
116 3300005439 Ga0070711_100001411 Ga0070711_10000141110 215
117 3300005456 Ga0070678_100006171 Ga0070678_1000061714 215
118 3300005543 Ga0070672_100009486 Ga0070672_1000094863 215
119 3300005546 Ga0070696_100016484 Ga0070696_1000164847 215
120 3300005548 Ga0070665_100135328 Ga0070665_1001353282 215
121 3300005549 Ga0070704_100055904 Ga0070704_1000559042 215
122 3300005563 Ga0068855_100036842 Ga0068855_1000368424 215
123 3300005614 Ga0068856_100000067 Ga0068856_10000006747 215
124 3300005718 Ga0068866_10010578 Ga0068866_100105784 215
125 3300006028 Ga0070717_10013982 Ga0070717_100139825 215
126 3300006163 Ga0070715_10011561 Ga0070715_100115613 215
127 3300006173 Ga0070716_100000376 Ga0070716_10000037610 215
128 3300006358 Ga0068871_100360076 Ga0068871_1003600762 215
129 3300006881 Ga0068865_100116173 Ga0068865_1001161732 215
130 3300009093 Ga0105240_10002293 Ga0105240_1000229321 215
131 3300009098 Ga0105245_10157519 Ga0105245_101575192 215
132 3300010375 Ga0105239_10016794 Ga0105239_100167947 215
133 3300013102 Ga0157371_10343342 Ga0157371_103433421 215
134 3300013296 Ga0157374_10011103 Ga0157374_100111035 215
135 3300013297 Ga0157378_10023178 Ga0157378_100231782 215
136 3300013307 Ga0157372_10209367 Ga0157372_102093672 215
137 3300013308 Ga0157375_10001237 Ga0157375_100012379 215
138 3300014969 Ga0157376_10017574 Ga0157376_100175745 215
139 3300017792 Ga0163161_10001138 Ga0163161_1000113812 215
140 3300025271 Ga0207666_1007695 Ga0207666_10076952 215
141 3300025315 Ga0207697_10000196 Ga0207697_100001968 215
142 3300025898 Ga0207692_10003760 Ga0207692_100037602 215
143 3300025901 Ga0207688_10003064 Ga0207688_100030648 215
144 3300025903 Ga0207680_10027488 Ga0207680_100274882 215
145 3300025905 Ga0207685_10000729 Ga0207685_100007297 215
146 3300025906 Ga0207699_10004442 Ga0207699_100044426 215
147 3300025907 Ga0207645_10000461 Ga0207645_1000046126 215
148 3300025913 Ga0207695_10004991 Ga0207695_1000499116 215
149 3300025915 Ga0207693_10002016 Ga0207693_100020169 215
150 3300025916 Ga0207663_10006384 Ga0207663_100063842 215
151 3300025923 Ga0207681_10047432 Ga0207681_100474322 215
152 3300025924 Ga0207694_10004858 Ga0207694_100048587 215
153 3300025928 Ga0207700_10079743 Ga0207700_100797433 215
154 3300025929 Ga0207664_10092333 Ga0207664_100923332 215
155 3300025931 Ga0207644_10004188 Ga0207644_100041888 215
156 3300025937 Ga0207669_10007281 Ga0207669_100072814 215
157 3300025938 Ga0207704_10580322 Ga0207704_105803222 215
158 3300025939 Ga0207665_10004560 Ga0207665_100045604 215
159 3300025940 Ga0207691_10011706 Ga0207691_100117066 215
160 3300025960 Ga0207651_10021559 Ga0207651_100215593 215
161 3300025972 Ga0207668_10006523 Ga0207668_100065234 215
162 3300025986 Ga0207658_10012039 Ga0207658_100120394 215
163 3300026078 Ga0207702_10025029 Ga0207702_100250296 215
164 3300026078 Ga0207702_10068399 Ga0207702_100683992 215
165 3300026116 Ga0207674_10077575 Ga0207674_100775753 215
166 3300026121 Ga0207683_10040917 Ga0207683_100409172 215
167 3300028563 Ga0265319_1060993 Ga0265319_10609932 215
168 3300028577 Ga0265318_10044628 Ga0265318_100446281 215
169 3300028800 Ga0265338_10000200 Ga0265338_1000020056 215
170 3300029957 Ga0265324_10009955 Ga0265324_100099555 215
171 3300036401 Ga0373937_0091934 Ga0373937_0091934_582_1298 215
172 3300039447 Ga0436361_0250643 Ga0436361_0250643_1071_1775 215
173 3300045051 Ga0451576_0220082 Ga0451576_0220082_281_1036 215
174 3300046517 Ga0495630_0130919 Ga0495630_0130919_399_1115 215
175 3300047322 Ga0495680_0081059 Ga0495680_0081059_374_1090 215
176 3300047444 Ga0495675_0056431 Ga0495675_0056431_152_940 215
177 3300048904 Ga0496101_0014371 Ga0496101_0014371_3263_4006 215
178 3300048906 Ga0496103_0007560 Ga0496103_0007560_1984_2727 215
179 3300048907 Ga0496104_0032731 Ga0496104_0032731_1991_2734 215
180 3300048908 Ga0496105_0072780 Ga0496105_0072780_807_1550 215
181 3300048909 Ga0496106_0006147 Ga0496106_0006147_3743_4486 215
182 3300048910 Ga0496107_0008031 Ga0496107_0008031_1310_2053 215
183 3300048915 Ga0496112_0028736 Ga0496112_0028736_966_1709 215
184 3300048917 Ga0496114_0192929 Ga0496114_0192929_291_1034 215
185 3300048918 Ga0496115_0007361 Ga0496115_0007361_3898_4641 215
186 iso_pu_bacteria 2513237102 2513703886 215
187 3300005327 Ga0070658_10235765 Ga0070658_102357652 216
188 3300005366 Ga0070659_100017614 Ga0070659_1000176143 216
189 3300005435 Ga0070714_100000912 Ga0070714_1000009126 216
190 3300005457 Ga0070662_100231552 Ga0070662_1002315522 216
191 3300005530 Ga0070679_100293539 Ga0070679_1002935392 216
192 3300005563 Ga0068855_100003998 Ga0068855_10000399812 216
193 3300005563 Ga0068855_100281154 Ga0068855_1002811542 216
194 3300005563 Ga0068855_100301476 Ga0068855_1003014763 216
195 3300005563 Ga0068855_100666876 Ga0068855_1006668761 216
196 3300005564 Ga0070664_100214058 Ga0070664_1002140582 216
197 3300005577 Ga0068857_100322389 Ga0068857_1003223892 216
198 3300005614 Ga0068856_100005808 Ga0068856_1000058089 216
199 3300005614 Ga0068856_100005939 Ga0068856_1000059399 216
200 3300005614 Ga0068856_100302033 Ga0068856_1003020332 216
201 3300005937 Ga0081455_10004454 Ga0081455_1000445410 216
202 3300006178 Ga0075367_10139208 Ga0075367_101392082 216
203 3300006237 Ga0097621_100821062 Ga0097621_1008210622 216
204 3300006358 Ga0068871_100038546 Ga0068871_1000385463 216
205 3300007265 Ga0099794_10097969 Ga0099794_100979692 216
206 3300007788 Ga0099795_10081309 Ga0099795_100813092 216
207 3300007788 Ga0099795_10108420 Ga0099795_101084202 216
208 3300009093 Ga0105240_10381700 Ga0105240_103817002 216
209 3300009177 Ga0105248_10765351 Ga0105248_107653512 216
210 3300009545 Ga0105237_10222973 Ga0105237_102229732 216
211 3300009551 Ga0105238_10012168 Ga0105238_100121683 216
212 3300013102 Ga0157371_10012511 Ga0157371_100125115 216
213 3300013104 Ga0157370_10083804 Ga0157370_100838043 216
214 3300013105 Ga0157369_10000445 Ga0157369_1000044513 216
215 3300013105 Ga0157369_10080497 Ga0157369_100804974 216
216 3300013296 Ga0157374_10000983 Ga0157374_100009839 216
217 3300013296 Ga0157374_10009326 Ga0157374_100093263 216
218 3300014325 Ga0163163_10970120 Ga0163163_109701202 216
219 3300025920 Ga0207649_10073011 Ga0207649_100730112 216
220 3300025924 Ga0207694_10006225 Ga0207694_100062259 216
221 3300025929 Ga0207664_10002101 Ga0207664_100021016 216
222 3300025932 Ga0207690_10140549 Ga0207690_101405492 216
223 3300025933 Ga0207706_10348781 Ga0207706_103487812 216
224 3300025945 Ga0207679_10180280 Ga0207679_101802803 216
225 3300025949 Ga0207667_10151842 Ga0207667_101518422 216
226 3300025949 Ga0207667_10192515 Ga0207667_101925152 216
227 3300025949 Ga0207667_10237372 Ga0207667_102373722 216
228 3300026078 Ga0207702_10021328 Ga0207702_100213283 216
229 3300026078 Ga0207702_10121251 Ga0207702_101212512 216
230 3300028556 Ga0265337_1000211 Ga0265337_100021122 216
231 3300028556 Ga0265337_1001860 Ga0265337_10018608 216
232 3300028556 Ga0265337_1015226 Ga0265337_10152262 216
233 3300028563 Ga0265319_1011278 Ga0265319_10112784 216
234 3300028573 Ga0265334_10099339 Ga0265334_100993392 216
235 3300028653 Ga0265323_10000106 Ga0265323_1000010630 216
236 3300028653 Ga0265323_10002890 Ga0265323_100028907 216
237 3300028666 Ga0265336_10000730 Ga0265336_100007304 216
238 3300028800 Ga0265338_10000263 Ga0265338_1000026348 216
239 3300028800 Ga0265338_10000528 Ga0265338_1000052816 216
240 3300028800 Ga0265338_10001238 Ga0265338_1000123817 216
241 3300028800 Ga0265338_10002137 Ga0265338_1000213717 216
242 3300028800 Ga0265338_10233857 Ga0265338_102338572 216
243 3300028800 Ga0265338_10472405 Ga0265338_104724052 216
244 3300031240 Ga0265320_10000259 Ga0265320_1000025929 216
245 3300031240 Ga0265320_10009735 Ga0265320_100097355 216
246 3300031240 Ga0265320_10013000 Ga0265320_100130006 216
247 3300031240 Ga0265320_10068653 Ga0265320_100686532 216
248 3300031241 Ga0265325_10239139 Ga0265325_102391392 216
249 3300031249 Ga0265339_10081430 Ga0265339_100814303 216
250 3300031344 Ga0265316_10003170 Ga0265316_1000317014 216
251 3300031344 Ga0265316_10053968 Ga0265316_100539682 216
252 3300031344 Ga0265316_10497863 Ga0265316_104978632 216
253 3300035118 Ga0373954_0180658 Ga0373954_0180658_13_738 216
254 3300035724 Ga0373933_0175499 Ga0373933_0175499_64_783 216
255 3300036401 Ga0373937_0002281 Ga0373937_0002281_3324_4043 216
256 3300046514 Ga0495618_0000825 Ga0495618_0000825_13726_14445 216
257 3300046517 Ga0495630_0023348 Ga0495630_0023348_457_1176 216
258 3300046535 Ga0495586_0000437 Ga0495586_0000437_13687_14406 216
259 3300046536 Ga0495587_0155889 Ga0495587_0155889_356_1075 216
260 3300046642 Ga0495634_0002760 Ga0495634_0002760_5460_6179 216
261 3300046689 Ga0495613_0000360 Ga0495613_0000360_24174_24893 216
262 3300047321 Ga0495676_0293461 Ga0495676_0293461_213_932 216
263 3300047322 Ga0495680_0001748 Ga0495680_0001748_13069_13788 216
264 3300048907 Ga0496104_0567610 Ga0496104_0567610_114_818 216
265 3300048908 Ga0496105_0211019 Ga0496105_0211019_838_1542 216
266 3300048915 Ga0496112_0048743 Ga0496112_0048743_2821_3525 216
267 3300048929 Ga0496126_0000548 Ga0496126_0000548_14511_15215 216
268 3300048929 Ga0496126_0397825 Ga0496126_0397825_24_725 216
269 3300005327 Ga0070658_10317683 Ga0070658_103176832 217
270 3300005344 Ga0070661_100477718 Ga0070661_1004777182 217
271 3300005445 Ga0070708_100134808 Ga0070708_1001348082 217
272 3300005467 Ga0070706_100056223 Ga0070706_1000562234 217
273 3300005467 Ga0070706_100309108 Ga0070706_1003091082 217
274 3300005468 Ga0070707_100540145 Ga0070707_1005401452 217
275 3300005468 Ga0070707_100632694 Ga0070707_1006326942 217
276 3300005563 Ga0068855_100008639 Ga0068855_1000086399 217
277 3300005616 Ga0068852_100000429 Ga0068852_10000042921 217
278 3300005841 Ga0068863_100092384 Ga0068863_1000923844 217
279 3300005841 Ga0068863_100753431 Ga0068863_1007534312 217
280 3300009551 Ga0105238_10184555 Ga0105238_101845552 217
281 3300013104 Ga0157370_10155345 Ga0157370_101553452 217
282 3300013105 Ga0157369_10021479 Ga0157369_100214795 217
283 3300013307 Ga0157372_10079461 Ga0157372_100794612 217
284 3300013307 Ga0157372_11043353 Ga0157372_110433532 217
285 3300025909 Ga0207705_10084789 Ga0207705_100847892 217
286 3300025910 Ga0207684_10047619 Ga0207684_100476194 217
287 3300025922 Ga0207646_10144316 Ga0207646_101443161 217
288 3300025922 Ga0207646_10459597 Ga0207646_104595972 217
289 3300026078 Ga0207702_10059940 Ga0207702_100599402 217
290 3300026088 Ga0207641_10817937 Ga0207641_108179371 217
291 3300026142 Ga0207698_10024860 Ga0207698_100248603 217
292 3300028800 Ga0265338_10000101 Ga0265338_1000010182 217
293 3300035172 Ga0373955_0324237 Ga0373955_0324237_29_733 217
294 3300036401 Ga0373937_0446791 Ga0373937_0446791_305_1012 217
295 3300042876 Ga0451577_0028656 Ga0451577_0028656_1602_2309 217
296 3300046460 Ga0495638_0000512 Ga0495638_0000512_12251_12958 217
297 3300048926 Ga0496123_0006651 Ga0496123_0006651_8204_8911 217
298 3300053087 Ga0500643_105981 Ga0500643_105981_37_744 217
299 3300003320 rootH2_10000721 rootH2_1000072123 218
300 3300005329 Ga0070683_100017443 Ga0070683_1000174432 218
301 3300005338 Ga0068868_100075612 Ga0068868_1000756123 218
302 3300005354 Ga0070675_100433385 Ga0070675_1004333852 218
303 3300005535 Ga0070684_100278164 Ga0070684_1002781642 218
304 3300009177 Ga0105248_10135646 Ga0105248_101356462 218
305 3300025912 Ga0207707_10324831 Ga0207707_103248312 218
306 3300025941 Ga0207711_10078517 Ga0207711_100785173 218
307 3300025944 Ga0207661_10062439 Ga0207661_100624392 218
308 3300028800 Ga0265338_10029891 Ga0265338_100298917 218
309 3300031251 Ga0265327_10001388 Ga0265327_1000138819 218
310 3300031251 Ga0265327_10001510 Ga0265327_100015106 218
311 3300037853 Ga0436364_1552432 Ga0436364_1552432_2160_2885 218
312 3300045051 Ga0451576_0072501 Ga0451576_0072501_122_850 218
313 3300000546 LJNas_1001683 LJNas_10016832 219
314 3300005272 Ga0065703_1018758 Ga0065703_10187585 219
315 3300005290 Ga0065712_10079435 Ga0065712_100794353 219
316 3300005293 Ga0065715_10063523 Ga0065715_100635231 219
317 3300005329 Ga0070683_100007518 Ga0070683_1000075189 219
318 3300005330 Ga0070690_100254956 Ga0070690_1002549562 219
319 3300005331 Ga0070670_100013239 Ga0070670_1000132395 219
320 3300005331 Ga0070670_100079178 Ga0070670_1000791781 219
321 3300005335 Ga0070666_10057181 Ga0070666_100571812 219
322 3300005344 Ga0070661_100032261 Ga0070661_1000322614 219
323 3300005355 Ga0070671_100022544 Ga0070671_1000225444 219
324 3300005366 Ga0070659_100060871 Ga0070659_1000608712 219
325 3300005367 Ga0070667_100687268 Ga0070667_1006872682 219
326 3300005436 Ga0070713_100016144 Ga0070713_1000161442 219
327 3300005437 Ga0070710_10048381 Ga0070710_100483812 219
328 3300005455 Ga0070663_100006399 Ga0070663_1000063995 219
329 3300005457 Ga0070662_100168732 Ga0070662_1001687322 219
330 3300005535 Ga0070684_100001324 Ga0070684_10000132411 219
331 3300005543 Ga0070672_100081395 Ga0070672_1000813953 219
332 3300005545 Ga0070695_100330974 Ga0070695_1003309742 219
333 3300005546 Ga0070696_100441330 Ga0070696_1004413301 219
334 3300005564 Ga0070664_100001423 Ga0070664_10000142311 219
335 3300005618 Ga0068864_100233975 Ga0068864_1002339752 219
336 3300005834 Ga0068851_10106219 Ga0068851_101062192 219
337 3300005841 Ga0068863_100409505 Ga0068863_1004095052 219
338 3300005842 Ga0068858_100225391 Ga0068858_1002253912 219
339 3300005843 Ga0068860_101070101 Ga0068860_1010701012 219
340 3300005983 Ga0081540_1020185 Ga0081540_10201854 219
341 3300006028 Ga0070717_10017239 Ga0070717_100172392 219
342 3300007788 Ga0099795_10028274 Ga0099795_100282742 219
343 3300009094 Ga0111539_10897867 Ga0111539_108978672 219
344 3300009098 Ga0105245_10044477 Ga0105245_100444776 219
345 3300009551 Ga0105238_10009123 Ga0105238_100091238 219
346 3300009551 Ga0105238_10564519 Ga0105238_105645191 219
347 3300011119 Ga0105246_10277108 Ga0105246_102771082 219
348 3300013100 Ga0157373_10256265 Ga0157373_102562652 219
349 3300013296 Ga0157374_10236643 Ga0157374_102366432 219
350 3300013297 Ga0157378_10418121 Ga0157378_104181211 219
351 3300014325 Ga0163163_10188142 Ga0163163_101881423 219
352 3300014969 Ga0157376_10034421 Ga0157376_100344212 219
353 3300025898 Ga0207692_10085890 Ga0207692_100858902 219
354 3300025903 Ga0207680_10185182 Ga0207680_101851822 219
355 3300025916 Ga0207663_10615016 Ga0207663_106150161 219
356 3300025920 Ga0207649_10036209 Ga0207649_100362094 219
357 3300025924 Ga0207694_10026308 Ga0207694_100263085 219
358 3300025925 Ga0207650_10085746 Ga0207650_100857462 219
359 3300025927 Ga0207687_10031171 Ga0207687_100311715 219
360 3300025932 Ga0207690_10046548 Ga0207690_100465483 219
361 3300025933 Ga0207706_10009687 Ga0207706_100096872 219
362 3300025940 Ga0207691_10045784 Ga0207691_100457842 219
363 3300025944 Ga0207661_10009912 Ga0207661_100099129 219
364 3300025945 Ga0207679_10097760 Ga0207679_100977602 219
365 3300026067 Ga0207678_10041390 Ga0207678_100413906 219
366 3300026088 Ga0207641_10424797 Ga0207641_104247971 219
367 3300028558 Ga0265326_10004275 Ga0265326_100042754 219
368 3300028653 Ga0265323_10002568 Ga0265323_100025687 219
369 3300028653 Ga0265323_10021560 Ga0265323_100215603 219
370 3300028653 Ga0265323_10041636 Ga0265323_100416362 219
371 3300028653 Ga0265323_10052418 Ga0265323_100524182 219
372 3300030760 Ga0265762_1002513 Ga0265762_10025133 219
373 3300031235 Ga0265330_10010268 Ga0265330_100102683 219
374 3300031235 Ga0265330_10025760 Ga0265330_100257603 219
375 3300031251 Ga0265327_10000074 Ga0265327_10000074110 219
376 3300031344 Ga0265316_10000457 Ga0265316_1000045729 219
377 3300031344 Ga0265316_10020791 Ga0265316_100207913 219
378 3300031344 Ga0265316_10056126 Ga0265316_100561263 219
379 3300031344 Ga0265316_10132785 Ga0265316_101327852 219
380 3300031711 Ga0265314_10232299 Ga0265314_102322992 219
381 3300031712 Ga0265342_10072693 Ga0265342_100726933 219
382 3300035725 Ga0373947_0233222 Ga0373947_0233222_75_815 219
383 3300039437 Ga0436365_0181741 Ga0436365_0181741_57971_58711 219
384 3300039437 Ga0436365_0818575 Ga0436365_0818575_245_964 219
385 3300039447 Ga0436361_0544514 Ga0436361_0544514_1715_2455 219
386 3300042876 Ga0451577_0110352 Ga0451577_0110352_1298_2023 219
387 3300044673 Ga0453683_0026196 Ga0453683_0026196_2078_2803 219
388 3300044673 Ga0453683_0030661 Ga0453683_0030661_788_1519 219
389 3300044712 Ga0453684_0033964 Ga0453684_0033964_619_1344 219
390 3300045049 Ga0466959_0124216 Ga0466959_0124216_409_1155 219
391 3300045051 Ga0451576_0024920 Ga0451576_0024920_5357_6088 219
392 3300045051 Ga0451576_0256877 Ga0451576_0256877_699_1424 219
393 3300048904 Ga0496101_0106904 Ga0496101_0106904_435_1157 219
394 3300048907 Ga0496104_0085572 Ga0496104_0085572_834_1556 219
395 3300048908 Ga0496105_0022381 Ga0496105_0022381_1017_1739 219
396 3300048909 Ga0496106_0225218 Ga0496106_0225218_694_1416 219
397 3300048912 Ga0496109_0002574 Ga0496109_0002574_5210_5932 219
398 3300048913 Ga0496110_0026021 Ga0496110_0026021_1465_2187 219
399 3300048914 Ga0496111_0005431 Ga0496111_0005431_4059_4781 219
400 3300048915 Ga0496112_0064044 Ga0496112_0064044_1662_2402 219
401 3300053733 Ga0500552_001591 Ga0500552_001591_1385_2107 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

9

254

0.83

PF12804

NTP_transf_3

MobA-like NTP transferase domain

9

195

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y7t-assembly1.cif.gz_A structural analysis of muru 0.917 5 215
4y7v-assembly1.cif.gz_A structural analysis of muru 0.8993 5 212
4y7u-assembly1.cif.gz_A structural analysis of muru 0.8897 5 215
8hhd-assembly1.cif.gz_B crystal structure of pamuru 0.8848 1 211
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.8716 2 210
ID Description Score Start End Superfamily
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9172 3 214 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8993 5 212 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8853 3 214 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8627 4 214 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.857 2 210 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C2EAN1-F1-model_v4 Nucleotidyl transferase 0.9905 3 210 GO:0005525
GO:0009058
GO:0016740
AF-A0A317J8D1-F1-model_v4 Nucleotidyl transferase 0.9878 3 181 GO:0009058
GO:0016779
AF-A0A7V9MVH7-F1-model_v4 NTP transferase domain-containing protein 0.9865 4 214 GO:0005525
GO:0009058
GO:0016740
AF-A0A3S0F0X9-F1-model_v4 Nucleotidyl transferase 0.9841 3 219 GO:0005525
GO:0009058
GO:0016740
AF-Q7X336-F1-model_v4 Putative nucleotidyl transferase 0.9836 3 216 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
93.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map