F434877

General Info

Members Datasets Scaffolds Average Seq Length
401 285 359 110

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10000018|Ga0307508_1000001811
Length 127
Sequence MSVLLTHMTDVVREGLNMKIPALPFTVTDWSQVAPTRHPGETGEALWRTLNIGDLRVRMVEYSPGYLADHWCDRGHVLLVIEGELDTELRDGRSFKLTPGMSYEVSDFGDAAHRSSTKLGAKLFIVD

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
6 2547132374 Acidovorax radicis N35 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
16 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
17 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
18 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
19 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
20 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
21 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
22 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
23 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
24 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
25 2904699407
26 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
27 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
28 2922425934
29 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
30 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
31 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
32 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
33 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
34 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
35 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
36 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
37 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
38 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
200 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
263 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
267 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
276 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
279 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
283 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
284 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
285 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.97
Metatranscriptomes 0
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 6.48
Rhizoplane 7.48
Rhizosphere 66.33
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10096896 3300002067 Bacteria 846
2 JGI25162J39368_1000768 3300002737 Bacteria 21685
3 JGI25165J46597_1000866 3300003214 Bacteria 21685
4 JGI25153J46596_10003653 3300003215 Bacteria 8519
5 Ga0065715_10356116 3300005293 Bacteria 943
6 Ga0070658_10450865 3300005327 Bacteria 1108
7 Ga0070676_10398935 3300005328 Bacteria 956
8 Ga0070670_100419516 3300005331 Bacteria 1183
9 Ga0068869_100227790 3300005334 Bacteria 1480
10 Ga0070680_100992684 3300005336 Unclassified 725
11 Ga0068868_100018639 3300005338 Bacteria 5193
12 Ga0068868_101372091 3300005338 Bacteria 658
13 Ga0070661_100324759 3300005344 Bacteria 1202
14 Ga0070661_100435100 3300005344 Bacteria 1042
15 Ga0070668_100189606 3300005347 Bacteria 1683
16 Ga0070668_100366008 3300005347 Bacteria 1224
17 Ga0070668_101469589 3300005347 Bacteria 623
18 Ga0070674_101975793 3300005356 Bacteria 531
19 Ga0070688_100414035 3300005365 Bacteria 1000
20 Ga0070688_100665670 3300005365 Bacteria 803
21 Ga0070667_100077285 3300005367 Bacteria 2842
22 Ga0070709_10015475 3300005434 Bacteria 4341
23 Ga0070709_10342988 3300005434 Bacteria 1102
24 Ga0070709_11197110 3300005434 Bacteria 610
25 Ga0070714_101089825 3300005435 Bacteria 778
26 Ga0070714_101317158 3300005435 Bacteria 705
27 Ga0070713_100030094 3300005436 Bacteria 4308
28 Ga0070713_100381392 3300005436 Bacteria 1313
29 Ga0070713_100763900 3300005436 Bacteria 925
30 Ga0070710_10003702 3300005437 Bacteria 7230
31 Ga0070710_10581634 3300005437 Bacteria 777
32 Ga0070711_100010613 3300005439 Bacteria 5706
33 Ga0070711_100945944 3300005439 Bacteria 737
34 Ga0070711_101346741 3300005439 Unclassified 620
35 Ga0070708_100552831 3300005445 Bacteria 1086
36 Ga0070663_100165450 3300005455 Bacteria 1705
37 Ga0070663_100244630 3300005455 Bacteria 1417
38 Ga0070678_100416397 3300005456 Bacteria 1170
39 Ga0070678_100750860 3300005456 Bacteria 882
40 Ga0070662_100947844 3300005457 Bacteria 736
41 Ga0070685_10006713 3300005466 Bacteria 5874
42 Ga0070699_100542781 3300005518 Bacteria 1058
43 Ga0068853_100041183 3300005539 Bacteria 3944
44 Ga0068853_100883889 3300005539 Bacteria 858
45 Ga0070672_100828239 3300005543 Bacteria 815
46 Ga0070686_100500241 3300005544 Bacteria 943
47 Ga0070665_100147673 3300005548 Bacteria 2354
48 Ga0070665_100353762 3300005548 Bacteria 1474
49 Ga0070665_100774469 3300005548 Bacteria 972
50 Ga0070665_101603393 3300005548 Bacteria 659
51 Ga0070704_100717104 3300005549 Bacteria 888
52 Ga0070704_101061899 3300005549 Unclassified 734
53 Ga0070664_100137574 3300005564 Bacteria 2149
54 Ga0068852_100423289 3300005616 Bacteria 1314
55 Ga0068859_100294042 3300005617 Bacteria 1717
56 Ga0068859_102408742 3300005617 Bacteria 580
57 Ga0068864_100512800 3300005618 Bacteria 1155
58 Ga0068861_100102950 3300005719 Bacteria 2274
59 Ga0068863_100013236 3300005841 Bacteria 7957
60 Ga0068863_100308453 3300005841 Bacteria 1536
61 Ga0068858_100217278 3300005842 Bacteria 1810
62 Ga0068858_100369411 3300005842 Bacteria 1375
63 Ga0068858_101635858 3300005842 Bacteria 636
64 Ga0068858_101904568 3300005842 Bacteria 587
65 Ga0068860_100001708 3300005843 Bacteria 23464
66 Ga0068862_100084709 3300005844 Bacteria 2754
67 Ga0081540_1003015 3300005983 Bacteria 13484
68 Ga0081540_1309876 3300005983 Unclassified 542
69 Ga0070717_10050191 3300006028 Bacteria 3427
70 Ga0075363_100298911 3300006048 Bacteria 934
71 Ga0070715_10248261 3300006163 Bacteria 929
72 Ga0070716_100017312 3300006173 Bacteria 3733
73 Ga0070716_100564178 3300006173 Bacteria 851
74 Ga0070712_100063171 3300006175 Bacteria 2621
75 Ga0070712_100161831 3300006175 Bacteria 1729
76 Ga0075362_10064688 3300006177 Bacteria 1660
77 Ga0075362_10144331 3300006177 Bacteria 1139
78 Ga0097621_100016261 3300006237 Bacteria 5619
79 Ga0097621_100185369 3300006237 Bacteria 1800
80 Ga0097621_100885705 3300006237 Bacteria 831
81 Ga0068871_100081780 3300006358 Bacteria 2677
82 Ga0068871_100522447 3300006358 Bacteria 1072
83 Ga0075428_101360940 3300006844 Bacteria 746
84 Ga0068865_101970010 3300006881 Bacteria 530
85 Ga0097620_100162997 3300006931 Unclassified 2309
86 Ga0097620_100294055 3300006931 Bacteria 1717
87 Ga0097620_102407340 3300006931 Bacteria 580
88 Ga0075435_100205689 3300007076 Bacteria 1668
89 Ga0111539_11456558 3300009094 Bacteria 794
90 Ga0105245_10117808 3300009098 Bacteria 2477
91 Ga0105245_11170872 3300009098 Bacteria 816
92 Ga0105245_12148330 3300009098 Bacteria 612
93 Ga0105247_10383921 3300009101 Bacteria 997
94 Ga0105247_11837669 3300009101 Bacteria 505
95 Ga0105241_10441934 3300009174 Bacteria 1149
96 Ga0105248_10410876 3300009177 Bacteria 1524
97 Ga0105248_11347328 3300009177 Unclassified 807
98 Ga0105237_10287554 3300009545 Bacteria 1647
99 Ga0105237_10509983 3300009545 Bacteria 1209
100 Ga0105237_11152000 3300009545 Bacteria 782
101 Ga0105238_10492469 3300009551 Bacteria 1226
102 Ga0105249_10109697 3300009553 Bacteria 2607
103 Ga0105249_10211314 3300009553 Bacteria 1904
104 Ga0105239_10680296 3300010375 Bacteria 1176
105 Ga0105239_10974960 3300010375 Bacteria 974
106 Ga0105239_12658765 3300010375 Bacteria 584
107 Ga0105246_10023862 3300011119 Bacteria 3964
108 Ga0157373_10543224 3300013100 Bacteria 842
109 Ga0157374_10294635 3300013296 Bacteria 1604
110 Ga0157374_10408948 3300013296 Bacteria 1354
111 Ga0157374_10411567 3300013296 Bacteria 1350
112 Ga0157378_10839753 3300013297 Bacteria 946
113 Ga0163162_10180545 3300013306 Bacteria 2237
114 Ga0163162_10408818 3300013306 Bacteria 1490
115 Ga0157372_10680342 3300013307 Bacteria 1198
116 Ga0157375_10021748 3300013308 Bacteria 5889
117 Ga0157375_10152378 3300013308 Bacteria 2448
118 Ga0157375_11433528 3300013308 Unclassified 814
119 Ga0157375_12065755 3300013308 Bacteria 678
120 Ga0163163_10015288 3300014325 Bacteria 7092
121 Ga0163163_10164154 3300014325 Bacteria 2267
122 Ga0182008_10052440 3300014497 Bacteria 2022
123 Ga0157377_10128330 3300014745 Bacteria 1545
124 Ga0157379_10366470 3300014968 Bacteria 1321
125 Ga0157379_10437192 3300014968 Bacteria 1206
126 Ga0157376_10005599 3300014969 Bacteria 8786
127 Ga0163161_10427912 3300017792 Bacteria 1066
128 Ga0213876_10011401 3300021384 Bacteria 4746
129 Ga0209672_113943 3300025228 Bacteria 946
130 Ga0209437_100326 3300025233 Bacteria 60536
131 Ga0209646_1010812 3300025246 Bacteria 1422
132 Ga0209026_1031106 3300025250 Bacteria 791
133 Ga0209233_1000505 3300025261 Bacteria 23256
134 Ga0209758_1008964 3300025297 Bacteria 6338
135 Ga0209758_1013766 3300025297 Bacteria 4376
136 Ga0207697_10155236 3300025315 Bacteria 997
137 Ga0207697_10449713 3300025315 Bacteria 571
138 Ga0207692_10085385 3300025898 Bacteria 1698
139 Ga0207642_10945111 3300025899 Bacteria 554
140 Ga0207710_10284797 3300025900 Bacteria 832
141 Ga0207710_10310792 3300025900 Bacteria 798
142 Ga0207688_10338691 3300025901 Bacteria 925
143 Ga0207699_10074221 3300025906 Bacteria 2089
144 Ga0207699_10298273 3300025906 Bacteria 1125
145 Ga0207643_10242574 3300025908 Bacteria 1108
146 Ga0207643_10417497 3300025908 Bacteria 850
147 Ga0207705_10523638 3300025909 Bacteria 921
148 Ga0207654_10355534 3300025911 Bacteria 1009
149 Ga0207654_11318950 3300025911 Bacteria 526
150 Ga0207671_10113085 3300025914 Bacteria 2068
151 Ga0207671_10268041 3300025914 Bacteria 1345
152 Ga0207671_10298484 3300025914 Bacteria 1272
153 Ga0207693_10135963 3300025915 Bacteria 1933
154 Ga0207663_10106019 3300025916 Bacteria 1898
155 Ga0207649_10236261 3300025920 Bacteria 1310
156 Ga0207649_10311878 3300025920 Bacteria 1153
157 Ga0207649_10354610 3300025920 Bacteria 1087
158 Ga0207649_11692100 3300025920 Bacteria 501
159 Ga0207646_10313740 3300025922 Bacteria 1417
160 Ga0207694_10273206 3300025924 Bacteria 1387
161 Ga0207694_10501938 3300025924 Bacteria 1016
162 Ga0207687_10147772 3300025927 Bacteria 1790
163 Ga0207700_10035247 3300025928 Bacteria 3603
164 Ga0207700_10296570 3300025928 Bacteria 1395
165 Ga0207700_10982747 3300025928 Unclassified 755
166 Ga0207690_10856090 3300025932 Unclassified 753
167 Ga0207706_10482835 3300025933 Bacteria 1071
168 Ga0207709_10695114 3300025935 Bacteria 813
169 Ga0207665_10431625 3300025939 Bacteria 1008
170 Ga0207665_10526520 3300025939 Bacteria 916
171 Ga0207691_10268222 3300025940 Unclassified 1470
172 Ga0207691_10874171 3300025940 Bacteria 753
173 Ga0207711_11205546 3300025941 Bacteria 698
174 Ga0207711_11401073 3300025941 Bacteria 641
175 Ga0207689_11082930 3300025942 Bacteria 676
176 Ga0207661_10833540 3300025944 Bacteria 849
177 Ga0207661_11632626 3300025944 Bacteria 590
178 Ga0207679_10027676 3300025945 Bacteria 3924
179 Ga0207712_10040854 3300025961 Bacteria 3186
180 Ga0207712_10199720 3300025961 Bacteria 1585
181 Ga0207668_10233377 3300025972 Bacteria 1484
182 Ga0207668_10291764 3300025972 Bacteria 1342
183 Ga0207658_10292708 3300025986 Bacteria 1400
184 Ga0207658_10736678 3300025986 Bacteria 892
185 Ga0207677_10119775 3300026023 Bacteria 1977
186 Ga0207703_10022563 3300026035 Bacteria 4938
187 Ga0207703_10191608 3300026035 Bacteria 1811
188 Ga0207703_10401673 3300026035 Bacteria 1271
189 Ga0207703_10900633 3300026035 Bacteria 847
190 Ga0207639_10087913 3300026041 Bacteria 2478
191 Ga0207639_10413735 3300026041 Bacteria 1217
192 Ga0207639_10415726 3300026041 Bacteria 1215
193 Ga0207678_10178552 3300026067 Bacteria 1813
194 Ga0207678_10298127 3300026067 Bacteria 1385
195 Ga0207708_10304786 3300026075 Bacteria 1296
196 Ga0207702_10000040 3300026078 Bacteria 151483
197 Ga0207641_10009889 3300026088 Bacteria 7853
198 Ga0207641_10731777 3300026088 Bacteria 976
199 Ga0207648_10689666 3300026089 Bacteria 946
200 Ga0207676_10327063 3300026095 Bacteria 1409
201 Ga0207676_10611812 3300026095 Bacteria 1048
202 Ga0207676_10749266 3300026095 Bacteria 950
203 Ga0207675_100078234 3300026118 Bacteria 3099
204 Ga0207675_100610963 3300026118 Bacteria 1094
205 Ga0207683_10436189 3300026121 Bacteria 1207
206 Ga0207683_10462291 3300026121 Bacteria 1170
207 Ga0207698_11940993 3300026142 Bacteria 603
208 Ga0209974_10011596 3300027876 Bacteria 2958
209 Ga0268266_10261005 3300028379 Bacteria 1605
210 Ga0268266_10376584 3300028379 Bacteria 1338
211 Ga0268265_10178960 3300028380 Bacteria 1820
212 Ga0268264_10000149 3300028381 Bacteria 163972
213 Ga0307517_10654946 3300028786 Bacteria 510
214 Ga0307511_10125907 3300030521 Bacteria 1563
215 Ga0265330_10295764 3300031235 Bacteria 682
216 Ga0265332_10313522 3300031238 Bacteria 648
217 Ga0265327_10042311 3300031251 Bacteria 2446
218 Ga0307509_10004311 3300031507 Bacteria 20669
219 Ga0307509_10074087 3300031507 Bacteria 3543
220 Ga0307509_10432074 3300031507 Unclassified 1015
221 Ga0307408_100269458 3300031548 Bacteria 1413
222 Ga0307508_10000018 3300031616 Bacteria 202701
223 Ga0307508_10109943 3300031616 Bacteria 2355
224 Ga0265314_10335455 3300031711 Bacteria 837
225 Ga0307516_10151220 3300031730 Bacteria 2081
226 Ga0307516_10590103 3300031730 Bacteria 765
227 Ga0307516_10623843 3300031730 Unclassified 733
228 Ga0307410_11124945 3300031852 Unclassified 682
229 Ga0307412_10165818 3300031911 Bacteria 1647
230 Ga0307411_10076282 3300032005 Bacteria 2291
231 Ga0307507_10022838 3300033179 Bacteria 6892
232 Ga0307510_10059620 3300033180 Bacteria 3938
233 Ga0373940_0341583 3300035088 Bacteria 524
234 Ga0373943_0194994 3300035170 Bacteria 1119
235 Ga0373935_0062064 3300035692 Bacteria 2393
236 Ga0373927_0003237 3300035695 Bacteria 11718
237 Ga0373927_0947582 3300035695 Unclassified 568
238 Ga0373947_0202522 3300035725 Bacteria 1299
239 Ga0373937_0109298 3300036401 Bacteria 2571
240 Ga0373925_0021188 3300037068 Bacteria 4736
241 Ga0373925_0075820 3300037068 Bacteria 2549
242 Ga0373925_1511436 3300037068 Unclassified 549
243 Ga0395900_0149691 3300037418 Bacteria 2385
244 Ga0436364_1553594 3300037853 Unclassified 1081
245 Ga0436365_0059329 3300039437 Bacteria 12786
246 Ga0436363_0068060 3300039450 Bacteria 672
247 Ga0436363_0912950 3300039450 Bacteria 9571
248 Ga0439439_0131743 3300041406 Bacteria 702
249 Ga0439466_0118629 3300041411 Bacteria 818
250 Ga0451789_1031529 3300041443 Bacteria 756
251 Ga0451804_0833197 3300041463 Bacteria 1242
252 Ga0451833_0108840 3300041491 Bacteria 625
253 Ga0451853_0300582 3300041512 Bacteria 2124
254 Ga0439433_0015213 3300041999 Bacteria 1698
255 Ga0439437_028854 3300042000 Bacteria 692
256 Ga0439449_0005619 3300042007 Bacteria 4795
257 Ga0439462_0000745 3300042015 Bacteria 6738
258 Ga0439462_0044978 3300042015 Bacteria 1182
259 Ga0450914_008141 3300042118 Bacteria 963
260 Ga0450923_038294 3300042125 Bacteria 1000
261 Ga0439446_0204643 3300042156 Bacteria 667
262 Ga0466966_0000068 3300044684 Bacteria 68468
263 Ga0466961_0018916 3300044693 Bacteria 4432
264 Ga0495617_013796 3300046452 Bacteria 2748
265 Ga0495629_0263787 3300046459 Bacteria 1184
266 Ga0495638_0041985 3300046460 Bacteria 2890
267 Ga0495650_0283391 3300046471 Bacteria 557
268 Ga0495605_0032069 3300046474 Bacteria 2679
269 Ga0495639_0720979 3300046475 Unclassified 515
270 Ga0495585_0289014 3300046492 Bacteria 808
271 Ga0495594_0323226 3300046499 Bacteria 879
272 Ga0495596_0139092 3300046500 Bacteria 943
273 Ga0495606_0228644 3300046507 Bacteria 1044
274 Ga0495608_0427122 3300046511 Bacteria 808
275 Ga0495610_0380300 3300046512 Bacteria 525
276 Ga0495616_0073607 3300046513 Bacteria 1648
277 Ga0495616_0106505 3300046513 Bacteria 1308
278 Ga0495631_0050690 3300046518 Bacteria 1815
279 Ga0495643_0294641 3300046522 Bacteria 742
280 Ga0495648_0430502 3300046524 Bacteria 582
281 Ga0495665_0068196 3300046531 Bacteria 1876
282 Ga0495597_0197951 3300046542 Bacteria 806
283 Ga0495597_0293917 3300046542 Bacteria 631
284 Ga0495622_0019370 3300046557 Bacteria 3168
285 Ga0495622_0055686 3300046557 Bacteria 1834
286 Ga0495633_0036716 3300046558 Bacteria 2347
287 Ga0495668_0035929 3300046616 Bacteria 2777
288 Ga0495625_0511015 3300046660 Bacteria 733
289 Ga0495669_0078457 3300046684 Bacteria 1513
290 Ga0495669_0146692 3300046684 Bacteria 1116
291 Ga0495649_0393427 3300046694 Bacteria 696
292 Ga0495581_0092361 3300047315 Bacteria 1757
293 Ga0495636_0576433 3300047318 Bacteria 549
294 Ga0495672_0220882 3300047320 Bacteria 935
295 Ga0495684_0464515 3300047471 Bacteria 877
296 Ga0496100_0037385 3300048903 Bacteria 3069
297 Ga0496100_0275084 3300048903 Bacteria 1253
298 Ga0496101_0101587 3300048904 Bacteria 2153
299 Ga0496101_0841752 3300048904 Bacteria 723
300 Ga0496102_0006904 3300048905 Bacteria 9684
301 Ga0496102_0135995 3300048905 Bacteria 2303
302 Ga0496103_0072235 3300048906 Bacteria 2161
303 Ga0496103_0187515 3300048906 Bacteria 1330
304 Ga0496103_0575719 3300048906 Bacteria 718
305 Ga0496103_0875080 3300048906 Bacteria 564
306 Ga0496104_0971487 3300048907 Bacteria 754
307 Ga0496104_1024226 3300048907 Bacteria 729
308 Ga0496105_0035275 3300048908 Bacteria 4116
309 Ga0496106_0004983 3300048909 Bacteria 9830
310 Ga0496106_0012623 3300048909 Bacteria 6241
311 Ga0496106_0089116 3300048909 Bacteria 2379
312 Ga0496106_0758919 3300048909 Unclassified 771
313 Ga0496107_0037062 3300048910 Bacteria 3499
314 Ga0496107_0554680 3300048910 Bacteria 851
315 Ga0496108_0141407 3300048911 Bacteria 2073
316 Ga0496111_0127600 3300048914 Bacteria 1881
317 Ga0496111_0284625 3300048914 Bacteria 1226
318 Ga0496112_0058807 3300048915 Bacteria 3786
319 Ga0496113_0060292 3300048916 Bacteria 2860
320 Ga0496114_0127558 3300048917 Bacteria 2194
321 Ga0496114_1476290 3300048917 Bacteria 568
322 Ga0496115_0101304 3300048918 Bacteria 2361
323 Ga0496117_0060994 3300048920 Bacteria 2595
324 Ga0496118_0022727 3300048921 Bacteria 5470
325 Ga0496118_0312325 3300048921 Bacteria 857
326 Ga0496121_0001749 3300048924 Bacteria 35439
327 Ga0496121_0083873 3300048924 Bacteria 2514
328 Ga0496124_0010603 3300048927 Bacteria 9314
329 Ga0496125_0183091 3300048928 Bacteria 1393
330 Ga0496126_0057989 3300048929 Bacteria 3492
331 Ga0496126_0218959 3300048929 Bacteria 1600
332 Ga0496126_0452802 3300048929 Bacteria 1033
333 Ga0501070_0228674 3300049586 Bacteria 1524
334 nmdc:mga03683_534375_c1 3300050489 Bacteria 570
335 nmdc:mga03n38_659751_c1 3300050490 Bacteria 600
336 nmdc:mga0yw44_53700_c1 3300050492 Bacteria 2447
337 nmdc:mga06r32_1779477_c1 3300050510 Bacteria 552
338 Ga0495655_0052855 3300053083 Bacteria 1082
339 Ga0500644_0202925 3300053088 Bacteria 821
340 Ga0500646_0106073 3300053090 Bacteria 888
341 Ga0500647_0124431 3300053091 Bacteria 1219
342 Ga0500641_0001604 3300053096 Bacteria 8055
343 Ga0500648_372650 3300053097 Bacteria 564
344 Ga0500558_117782 3300053106 Bacteria 1033
345 Ga0500595_125953 3300053119 Bacteria 723
346 Ga0500658_0168228 3300053134 Bacteria 995
347 Ga0500559_0016966 3300053136 Bacteria 3076
348 Ga0500577_0043575 3300053142 Bacteria 1649
349 Ga0500590_067892 3300053148 Bacteria 1778
350 Ga0500603_043625 3300053150 Bacteria 1205
351 Ga0500603_105981 3300053150 Bacteria 840
352 Ga0500627_0180765 3300053158 Bacteria 949
353 Ga0500633_0182921 3300053160 Bacteria 786
354 Ga0500634_0401539 3300053161 Bacteria 506
355 Ga0500636_0018765 3300053177 Bacteria 4090
356 Ga0500552_089177 3300053733 Bacteria 575
357 Ga0500596_005269 3300053735 Bacteria 2296
358 Ga0590074_050217 3300059423 Bacteria 762
359 Ga0590075_059695 3300059424 Bacteria 983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_101061899 Ga0070704_1010618991 102
2 3300013308 Ga0157375_11433528 Ga0157375_114335281 102
3 3300014325 Ga0163163_10015288 Ga0163163_100152887 102
4 3300035695 Ga0373927_0947582 Ga0373927_0947582_78_386 102
5 3300037068 Ga0373925_1511436 Ga0373925_1511436_117_425 102
6 3300046475 Ga0495639_0720979 Ga0495639_0720979_105_413 102
7 3300046531 Ga0495665_0068196 Ga0495665_0068196_986_1294 102
8 3300047471 Ga0495684_0464515 Ga0495684_0464515_499_807 102
9 iso_pu_bacteria 2547132374 2548501279 105
10 iso_pu_bacteria 2643221570 2643868481 105
11 iso_pu_bacteria 2643221596 2643994589 105
12 iso_pu_bacteria 2643221652 2644295433 105
13 iso_pu_bacteria 2643221717 2644649177 105
14 iso_pu_bacteria 2513237094 2513640671 106
15 iso_pu_bacteria 2513237095 2513645614 106
16 iso_pu_bacteria 2517093001 2517102837 106
17 iso_pu_bacteria 2524023228 2524534266 106
18 iso_pu_bacteria 2528768022 2528853870 106
19 iso_pu_bacteria 2667528174 2671117308 106
20 iso_pu_bacteria 2728368998 2728753146 106
21 iso_pu_bacteria 2744054633 2745079654 106
22 iso_pu_bacteria 2816332527 2818238660 106
23 iso_pu_bacteria 2824704595 2824708600 106
24 iso_pu_bacteria 2824753945 2824759519 106
25 iso_pu_bacteria 2824763712 2824771730 106
26 iso_pu_bacteria 2841957949 2841964206 106
27 iso_pu_bacteria 2842038055 2842038755 106
28 iso_pu_bacteria 2842045827 2842048300 106
29 iso_pu_bacteria 2876761206 2876764753 106
30 iso_pu_bacteria 2888378607 2888384292 106
31 iso_pu_bacteria 2888388044 2888393594 106
32 iso_pu_bacteria 2904690495 2904694759 106
33 iso_pu_bacteria 2904699407 2904702309 106
34 iso_pu_bacteria 2904711408 2904714903 106
35 iso_pu_bacteria 2906643746 2906645149 106
36 iso_pu_bacteria 2922425934 2922430531 106
37 iso_pu_bacteria 2929615660 2929621743 106
38 iso_pu_bacteria 2929624759 2929629950 106
39 iso_pu_bacteria 2932794094 2932798133 106
40 iso_pu_bacteria 2932801729 2932807011 106
41 iso_pu_bacteria 2933577622 2933583981 106
42 iso_pu_bacteria 2935883170 2935886865 106
43 iso_pu_bacteria 2935959822 2935960634 106
44 iso_pu_bacteria 2941531003 2941533031 106
45 iso_pu_bacteria 3005594810 3005599457 106
46 iso_pu_bacteria 3005718088 3005722517 106
47 iso_pu_bacteria 8016622563 8016626347 106
48 iso_pu_bacteria 8019547302 8019553436 106
49 iso_pu_bacteria 8055742211 8055746091 106
50 iso_pu_bacteria 8056689827 8056691294 106
51 3300005439 Ga0070711_101346741 Ga0070711_1013467411 107
52 3300005445 Ga0070708_100552831 Ga0070708_1005528312 107
53 3300005841 Ga0068863_100013236 Ga0068863_1000132365 107
54 3300005842 Ga0068858_100217278 Ga0068858_1002172782 107
55 3300009177 Ga0105248_11347328 Ga0105248_113473281 107
56 3300013296 Ga0157374_10408948 Ga0157374_104089482 107
57 3300025922 Ga0207646_10313740 Ga0207646_103137401 107
58 3300026035 Ga0207703_10191608 Ga0207703_101916081 107
59 3300026088 Ga0207641_10009889 Ga0207641_100098895 107
60 3300031730 Ga0307516_10623843 Ga0307516_106238432 107
61 3300005293 Ga0065715_10356116 Ga0065715_103561162 109
62 3300005328 Ga0070676_10398935 Ga0070676_103989352 109
63 3300005331 Ga0070670_100419516 Ga0070670_1004195162 109
64 3300005336 Ga0070680_100992684 Ga0070680_1009926841 109
65 3300005338 Ga0068868_101372091 Ga0068868_1013720911 109
66 3300006048 Ga0075363_100298911 Ga0075363_1002989112 109
67 3300006177 Ga0075362_10064688 Ga0075362_100646882 109
68 3300006177 Ga0075362_10144331 Ga0075362_101443312 109
69 3300006237 Ga0097621_100016261 Ga0097621_1000162616 109
70 3300006931 Ga0097620_100162997 Ga0097620_1001629974 109
71 3300014497 Ga0182008_10052440 Ga0182008_100524401 109
72 3300025932 Ga0207690_10856090 Ga0207690_108560902 109
73 3300027876 Ga0209974_10011596 Ga0209974_100115965 109
74 3300031507 Ga0307509_10432074 Ga0307509_104320741 109
75 3300031852 Ga0307410_11124945 Ga0307410_111249451 109
76 3300032005 Ga0307411_10076282 Ga0307411_100762823 109
77 3300036401 Ga0373937_0109298 Ga0373937_0109298_717_1085 109
78 3300041406 Ga0439439_0131743 Ga0439439_0131743_210_539 109
79 3300041411 Ga0439466_0118629 Ga0439466_0118629_221_550 109
80 3300041999 Ga0439433_0015213 Ga0439433_0015213_1008_1337 109
81 3300042000 Ga0439437_028854 Ga0439437_028854_231_560 109
82 3300042007 Ga0439449_0005619 Ga0439449_0005619_755_1084 109
83 3300042015 Ga0439462_0000745 Ga0439462_0000745_4489_4818 109
84 3300042015 Ga0439462_0044978 Ga0439462_0044978_685_1014 109
85 3300042118 Ga0450914_008141 Ga0450914_008141_570_899 109
86 3300042125 Ga0450923_038294 Ga0450923_038294_36_365 109
87 3300042156 Ga0439446_0204643 Ga0439446_0204643_201_530 109
88 3300046511 Ga0495608_0427122 Ga0495608_0427122_321_689 109
89 3300047315 Ga0495581_0092361 Ga0495581_0092361_971_1339 109
90 3300050489 nmdc:mga03683_534375_c1 nmdc:mga03683_534375_c1_150_479 109
91 3300050490 nmdc:mga03n38_659751_c1 nmdc:mga03n38_659751_c1_58_387 109
92 3300050492 nmdc:mga0yw44_53700_c1 nmdc:mga0yw44_53700_c1_1230_1559 109
93 3300059423 Ga0590074_050217 Ga0590074_050217_310_639 109
94 3300059424 Ga0590075_059695 Ga0590075_059695_416_745 109
95 3300002067 JGI24735J21928_10096896 JGI24735J21928_100968962 110
96 3300002737 JGI25162J39368_1000768 JGI25162J39368_100076816 110
97 3300003214 JGI25165J46597_1000866 JGI25165J46597_100086615 110
98 3300003215 JGI25153J46596_10003653 JGI25153J46596_100036534 110
99 3300005327 Ga0070658_10450865 Ga0070658_104508652 110
100 3300005334 Ga0068869_100227790 Ga0068869_1002277903 110
101 3300005338 Ga0068868_100018639 Ga0068868_1000186396 110
102 3300005344 Ga0070661_100324759 Ga0070661_1003247593 110
103 3300005344 Ga0070661_100435100 Ga0070661_1004351002 110
104 3300005347 Ga0070668_100189606 Ga0070668_1001896062 110
105 3300005347 Ga0070668_100366008 Ga0070668_1003660082 110
106 3300005347 Ga0070668_101469589 Ga0070668_1014695892 110
107 3300005356 Ga0070674_101975793 Ga0070674_1019757931 110
108 3300005365 Ga0070688_100414035 Ga0070688_1004140352 110
109 3300005365 Ga0070688_100665670 Ga0070688_1006656702 110
110 3300005367 Ga0070667_100077285 Ga0070667_1000772852 110
111 3300005434 Ga0070709_10015475 Ga0070709_100154755 110
112 3300005434 Ga0070709_10342988 Ga0070709_103429883 110
113 3300005434 Ga0070709_11197110 Ga0070709_111971101 110
114 3300005435 Ga0070714_101089825 Ga0070714_1010898252 110
115 3300005435 Ga0070714_101317158 Ga0070714_1013171582 110
116 3300005436 Ga0070713_100030094 Ga0070713_1000300944 110
117 3300005436 Ga0070713_100381392 Ga0070713_1003813923 110
118 3300005436 Ga0070713_100763900 Ga0070713_1007639002 110
119 3300005437 Ga0070710_10003702 Ga0070710_100037024 110
120 3300005437 Ga0070710_10581634 Ga0070710_105816342 110
121 3300005439 Ga0070711_100010613 Ga0070711_1000106135 110
122 3300005439 Ga0070711_100945944 Ga0070711_1009459442 110
123 3300005455 Ga0070663_100165450 Ga0070663_1001654501 110
124 3300005455 Ga0070663_100244630 Ga0070663_1002446302 110
125 3300005456 Ga0070678_100416397 Ga0070678_1004163972 110
126 3300005456 Ga0070678_100750860 Ga0070678_1007508602 110
127 3300005457 Ga0070662_100947844 Ga0070662_1009478441 110
128 3300005466 Ga0070685_10006713 Ga0070685_100067134 110
129 3300005518 Ga0070699_100542781 Ga0070699_1005427812 110
130 3300005539 Ga0068853_100041183 Ga0068853_1000411832 110
131 3300005539 Ga0068853_100883889 Ga0068853_1008838892 110
132 3300005543 Ga0070672_100828239 Ga0070672_1008282391 110
133 3300005544 Ga0070686_100500241 Ga0070686_1005002411 110
134 3300005548 Ga0070665_100147673 Ga0070665_1001476731 110
135 3300005548 Ga0070665_100353762 Ga0070665_1003537622 110
136 3300005548 Ga0070665_100774469 Ga0070665_1007744691 110
137 3300005548 Ga0070665_101603393 Ga0070665_1016033932 110
138 3300005549 Ga0070704_100717104 Ga0070704_1007171042 110
139 3300005564 Ga0070664_100137574 Ga0070664_1001375742 110
140 3300005616 Ga0068852_100423289 Ga0068852_1004232893 110
141 3300005617 Ga0068859_100294042 Ga0068859_1002940422 110
142 3300005617 Ga0068859_102408742 Ga0068859_1024087422 110
143 3300005618 Ga0068864_100512800 Ga0068864_1005128002 110
144 3300005719 Ga0068861_100102950 Ga0068861_1001029503 110
145 3300005841 Ga0068863_100308453 Ga0068863_1003084532 110
146 3300005842 Ga0068858_100369411 Ga0068858_1003694111 110
147 3300005842 Ga0068858_101635858 Ga0068858_1016358581 110
148 3300005842 Ga0068858_101904568 Ga0068858_1019045682 110
149 3300005843 Ga0068860_100001708 Ga0068860_1000017087 110
150 3300005844 Ga0068862_100084709 Ga0068862_1000847093 110
151 3300005983 Ga0081540_1003015 Ga0081540_10030154 110
152 3300005983 Ga0081540_1309876 Ga0081540_13098761 110
153 3300006028 Ga0070717_10050191 Ga0070717_100501914 110
154 3300006163 Ga0070715_10248261 Ga0070715_102482611 110
155 3300006173 Ga0070716_100017312 Ga0070716_1000173126 110
156 3300006173 Ga0070716_100564178 Ga0070716_1005641782 110
157 3300006175 Ga0070712_100063171 Ga0070712_1000631712 110
158 3300006175 Ga0070712_100161831 Ga0070712_1001618312 110
159 3300006237 Ga0097621_100185369 Ga0097621_1001853691 110
160 3300006237 Ga0097621_100885705 Ga0097621_1008857052 110
161 3300006358 Ga0068871_100081780 Ga0068871_1000817803 110
162 3300006358 Ga0068871_100522447 Ga0068871_1005224472 110
163 3300006844 Ga0075428_101360940 Ga0075428_1013609401 110
164 3300006881 Ga0068865_101970010 Ga0068865_1019700101 110
165 3300006931 Ga0097620_100294055 Ga0097620_1002940552 110
166 3300006931 Ga0097620_102407340 Ga0097620_1024073402 110
167 3300007076 Ga0075435_100205689 Ga0075435_1002056893 110
168 3300009094 Ga0111539_11456558 Ga0111539_114565581 110
169 3300009098 Ga0105245_10117808 Ga0105245_101178082 110
170 3300009098 Ga0105245_11170872 Ga0105245_111708722 110
171 3300009098 Ga0105245_12148330 Ga0105245_121483302 110
172 3300009101 Ga0105247_10383921 Ga0105247_103839212 110
173 3300009101 Ga0105247_11837669 Ga0105247_118376691 110
174 3300009174 Ga0105241_10441934 Ga0105241_104419342 110
175 3300009177 Ga0105248_10410876 Ga0105248_104108763 110
176 3300009545 Ga0105237_10287554 Ga0105237_102875543 110
177 3300009545 Ga0105237_10509983 Ga0105237_105099832 110
178 3300009545 Ga0105237_11152000 Ga0105237_111520002 110
179 3300009551 Ga0105238_10492469 Ga0105238_104924693 110
180 3300009553 Ga0105249_10109697 Ga0105249_101096972 110
181 3300009553 Ga0105249_10211314 Ga0105249_102113142 110
182 3300010375 Ga0105239_10680296 Ga0105239_106802962 110
183 3300010375 Ga0105239_10974960 Ga0105239_109749602 110
184 3300010375 Ga0105239_12658765 Ga0105239_126587651 110
185 3300011119 Ga0105246_10023862 Ga0105246_100238621 110
186 3300013100 Ga0157373_10543224 Ga0157373_105432242 110
187 3300013296 Ga0157374_10294635 Ga0157374_102946351 110
188 3300013296 Ga0157374_10411567 Ga0157374_104115672 110
189 3300013297 Ga0157378_10839753 Ga0157378_108397532 110
190 3300013306 Ga0163162_10180545 Ga0163162_101805452 110
191 3300013306 Ga0163162_10408818 Ga0163162_104088182 110
192 3300013307 Ga0157372_10680342 Ga0157372_106803421 110
193 3300013308 Ga0157375_10021748 Ga0157375_100217488 110
194 3300013308 Ga0157375_10152378 Ga0157375_101523782 110
195 3300013308 Ga0157375_12065755 Ga0157375_120657552 110
196 3300014325 Ga0163163_10164154 Ga0163163_101641542 110
197 3300014745 Ga0157377_10128330 Ga0157377_101283302 110
198 3300014968 Ga0157379_10366470 Ga0157379_103664701 110
199 3300014968 Ga0157379_10437192 Ga0157379_104371921 110
200 3300014969 Ga0157376_10005599 Ga0157376_100055996 110
201 3300017792 Ga0163161_10427912 Ga0163161_104279122 110
202 3300021384 Ga0213876_10011401 Ga0213876_100114012 110
203 3300025228 Ga0209672_113943 Ga0209672_1139432 110
204 3300025233 Ga0209437_100326 Ga0209437_10032610 110
205 3300025246 Ga0209646_1010812 Ga0209646_10108122 110
206 3300025250 Ga0209026_1031106 Ga0209026_10311061 110
207 3300025261 Ga0209233_1000505 Ga0209233_100050513 110
208 3300025297 Ga0209758_1008964 Ga0209758_10089648 110
209 3300025297 Ga0209758_1013766 Ga0209758_10137662 110
210 3300025315 Ga0207697_10155236 Ga0207697_101552361 110
211 3300025315 Ga0207697_10449713 Ga0207697_104497132 110
212 3300025898 Ga0207692_10085385 Ga0207692_100853852 110
213 3300025899 Ga0207642_10945111 Ga0207642_109451111 110
214 3300025900 Ga0207710_10284797 Ga0207710_102847971 110
215 3300025900 Ga0207710_10310792 Ga0207710_103107921 110
216 3300025901 Ga0207688_10338691 Ga0207688_103386912 110
217 3300025906 Ga0207699_10074221 Ga0207699_100742213 110
218 3300025906 Ga0207699_10298273 Ga0207699_102982733 110
219 3300025908 Ga0207643_10242574 Ga0207643_102425741 110
220 3300025908 Ga0207643_10417497 Ga0207643_104174972 110
221 3300025909 Ga0207705_10523638 Ga0207705_105236381 110
222 3300025911 Ga0207654_10355534 Ga0207654_103555342 110
223 3300025911 Ga0207654_11318950 Ga0207654_113189501 110
224 3300025914 Ga0207671_10113085 Ga0207671_101130852 110
225 3300025914 Ga0207671_10268041 Ga0207671_102680412 110
226 3300025914 Ga0207671_10298484 Ga0207671_102984843 110
227 3300025915 Ga0207693_10135963 Ga0207693_101359632 110
228 3300025916 Ga0207663_10106019 Ga0207663_101060192 110
229 3300025920 Ga0207649_10236261 Ga0207649_102362611 110
230 3300025920 Ga0207649_10311878 Ga0207649_103118781 110
231 3300025920 Ga0207649_10354610 Ga0207649_103546102 110
232 3300025920 Ga0207649_11692100 Ga0207649_116921001 110
233 3300025924 Ga0207694_10273206 Ga0207694_102732063 110
234 3300025924 Ga0207694_10501938 Ga0207694_105019382 110
235 3300025927 Ga0207687_10147772 Ga0207687_101477722 110
236 3300025928 Ga0207700_10035247 Ga0207700_100352473 110
237 3300025928 Ga0207700_10296570 Ga0207700_102965703 110
238 3300025928 Ga0207700_10982747 Ga0207700_109827472 110
239 3300025933 Ga0207706_10482835 Ga0207706_104828352 110
240 3300025935 Ga0207709_10695114 Ga0207709_106951141 110
241 3300025939 Ga0207665_10431625 Ga0207665_104316252 110
242 3300025939 Ga0207665_10526520 Ga0207665_105265201 110
243 3300025940 Ga0207691_10268222 Ga0207691_102682223 110
244 3300025940 Ga0207691_10874171 Ga0207691_108741712 110
245 3300025941 Ga0207711_11205546 Ga0207711_112055461 110
246 3300025941 Ga0207711_11401073 Ga0207711_114010731 110
247 3300025942 Ga0207689_11082930 Ga0207689_110829302 110
248 3300025944 Ga0207661_10833540 Ga0207661_108335402 110
249 3300025944 Ga0207661_11632626 Ga0207661_116326261 110
250 3300025945 Ga0207679_10027676 Ga0207679_100276765 110
251 3300025961 Ga0207712_10040854 Ga0207712_100408542 110
252 3300025961 Ga0207712_10199720 Ga0207712_101997202 110
253 3300025972 Ga0207668_10233377 Ga0207668_102333771 110
254 3300025972 Ga0207668_10291764 Ga0207668_102917642 110
255 3300025986 Ga0207658_10292708 Ga0207658_102927081 110
256 3300025986 Ga0207658_10736678 Ga0207658_107366781 110
257 3300026023 Ga0207677_10119775 Ga0207677_101197752 110
258 3300026035 Ga0207703_10022563 Ga0207703_100225632 110
259 3300026035 Ga0207703_10401673 Ga0207703_104016732 110
260 3300026035 Ga0207703_10900633 Ga0207703_109006332 110
261 3300026041 Ga0207639_10087913 Ga0207639_100879134 110
262 3300026041 Ga0207639_10413735 Ga0207639_104137351 110
263 3300026041 Ga0207639_10415726 Ga0207639_104157262 110
264 3300026067 Ga0207678_10178552 Ga0207678_101785521 110
265 3300026067 Ga0207678_10298127 Ga0207678_102981272 110
266 3300026075 Ga0207708_10304786 Ga0207708_103047863 110
267 3300026078 Ga0207702_10000040 Ga0207702_1000004010 110
268 3300026088 Ga0207641_10731777 Ga0207641_107317772 110
269 3300026089 Ga0207648_10689666 Ga0207648_106896662 110
270 3300026095 Ga0207676_10327063 Ga0207676_103270633 110
271 3300026095 Ga0207676_10611812 Ga0207676_106118122 110
272 3300026095 Ga0207676_10749266 Ga0207676_107492661 110
273 3300026118 Ga0207675_100078234 Ga0207675_1000782343 110
274 3300026118 Ga0207675_100610963 Ga0207675_1006109632 110
275 3300026121 Ga0207683_10436189 Ga0207683_104361892 110
276 3300026121 Ga0207683_10462291 Ga0207683_104622912 110
277 3300026142 Ga0207698_11940993 Ga0207698_119409931 110
278 3300028379 Ga0268266_10261005 Ga0268266_102610052 110
279 3300028379 Ga0268266_10376584 Ga0268266_103765842 110
280 3300028380 Ga0268265_10178960 Ga0268265_101789603 110
281 3300028381 Ga0268264_10000149 Ga0268264_1000014919 110
282 3300028786 Ga0307517_10654946 Ga0307517_106549461 110
283 3300030521 Ga0307511_10125907 Ga0307511_101259072 110
284 3300031235 Ga0265330_10295764 Ga0265330_102957642 110
285 3300031238 Ga0265332_10313522 Ga0265332_103135222 110
286 3300031251 Ga0265327_10042311 Ga0265327_100423112 110
287 3300031507 Ga0307509_10004311 Ga0307509_1000431114 110
288 3300031507 Ga0307509_10074087 Ga0307509_100740873 110
289 3300031548 Ga0307408_100269458 Ga0307408_1002694582 110
290 3300031616 Ga0307508_10000018 Ga0307508_1000001811 110
291 3300031616 Ga0307508_10109943 Ga0307508_101099431 110
292 3300031711 Ga0265314_10335455 Ga0265314_103354552 110
293 3300031730 Ga0307516_10151220 Ga0307516_101512202 110
294 3300031730 Ga0307516_10590103 Ga0307516_105901032 110
295 3300031911 Ga0307412_10165818 Ga0307412_101658182 110
296 3300033179 Ga0307507_10022838 Ga0307507_100228383 110
297 3300033180 Ga0307510_10059620 Ga0307510_100596202 110
298 3300035088 Ga0373940_0341583 Ga0373940_0341583_59_391 110
299 3300035170 Ga0373943_0194994 Ga0373943_0194994_704_1066 110
300 3300035692 Ga0373935_0062064 Ga0373935_0062064_754_1116 110
301 3300035695 Ga0373927_0003237 Ga0373927_0003237_10591_10953 110
302 3300035725 Ga0373947_0202522 Ga0373947_0202522_870_1232 110
303 3300037068 Ga0373925_0021188 Ga0373925_0021188_1763_2125 110
304 3300037068 Ga0373925_0075820 Ga0373925_0075820_772_1104 110
305 3300037418 Ga0395900_0149691 Ga0395900_0149691_707_1039 110
306 3300037853 Ga0436364_1553594 Ga0436364_1553594_89_421 110
307 3300039437 Ga0436365_0059329 Ga0436365_0059329_10076_10408 110
308 3300039450 Ga0436363_0068060 Ga0436363_0068060_142_474 110
309 3300039450 Ga0436363_0912950 Ga0436363_0912950_1235_1567 110
310 3300041443 Ga0451789_1031529 Ga0451789_1031529_364_696 110
311 3300041463 Ga0451804_0833197 Ga0451804_0833197_395_727 110
312 3300041491 Ga0451833_0108840 Ga0451833_0108840_14_346 110
313 3300041512 Ga0451853_0300582 Ga0451853_0300582_1144_1476 110
314 3300044684 Ga0466966_0000068 Ga0466966_0000068_35792_36124 110
315 3300044693 Ga0466961_0018916 Ga0466961_0018916_1688_2020 110
316 3300046452 Ga0495617_013796 Ga0495617_013796_1885_2217 110
317 3300046459 Ga0495629_0263787 Ga0495629_0263787_351_683 110
318 3300046460 Ga0495638_0041985 Ga0495638_0041985_2479_2811 110
319 3300046471 Ga0495650_0283391 Ga0495650_0283391_203_535 110
320 3300046474 Ga0495605_0032069 Ga0495605_0032069_417_749 110
321 3300046492 Ga0495585_0289014 Ga0495585_0289014_87_419 110
322 3300046499 Ga0495594_0323226 Ga0495594_0323226_63_425 110
323 3300046500 Ga0495596_0139092 Ga0495596_0139092_220_552 110
324 3300046507 Ga0495606_0228644 Ga0495606_0228644_30_362 110
325 3300046512 Ga0495610_0380300 Ga0495610_0380300_83_415 110
326 3300046513 Ga0495616_0073607 Ga0495616_0073607_404_736 110
327 3300046513 Ga0495616_0106505 Ga0495616_0106505_819_1151 110
328 3300046518 Ga0495631_0050690 Ga0495631_0050690_75_407 110
329 3300046522 Ga0495643_0294641 Ga0495643_0294641_323_655 110
330 3300046524 Ga0495648_0430502 Ga0495648_0430502_12_344 110
331 3300046542 Ga0495597_0197951 Ga0495597_0197951_103_435 110
332 3300046542 Ga0495597_0293917 Ga0495597_0293917_203_535 110
333 3300046557 Ga0495622_0019370 Ga0495622_0019370_37_399 110
334 3300046557 Ga0495622_0055686 Ga0495622_0055686_384_716 110
335 3300046558 Ga0495633_0036716 Ga0495633_0036716_557_889 110
336 3300046616 Ga0495668_0035929 Ga0495668_0035929_1948_2280 110
337 3300046660 Ga0495625_0511015 Ga0495625_0511015_326_658 110
338 3300046684 Ga0495669_0078457 Ga0495669_0078457_44_376 110
339 3300046684 Ga0495669_0146692 Ga0495669_0146692_567_899 110
340 3300046694 Ga0495649_0393427 Ga0495649_0393427_239_571 110
341 3300047318 Ga0495636_0576433 Ga0495636_0576433_128_460 110
342 3300047320 Ga0495672_0220882 Ga0495672_0220882_535_867 110
343 3300048903 Ga0496100_0037385 Ga0496100_0037385_22_354 110
344 3300048903 Ga0496100_0275084 Ga0496100_0275084_566_898 110
345 3300048904 Ga0496101_0101587 Ga0496101_0101587_1800_2132 110
346 3300048904 Ga0496101_0841752 Ga0496101_0841752_315_647 110
347 3300048905 Ga0496102_0006904 Ga0496102_0006904_5045_5377 110
348 3300048905 Ga0496102_0135995 Ga0496102_0135995_1808_2140 110
349 3300048906 Ga0496103_0072235 Ga0496103_0072235_1699_2031 110
350 3300048906 Ga0496103_0187515 Ga0496103_0187515_274_606 110
351 3300048906 Ga0496103_0575719 Ga0496103_0575719_330_662 110
352 3300048906 Ga0496103_0875080 Ga0496103_0875080_123_455 110
353 3300048907 Ga0496104_0971487 Ga0496104_0971487_279_611 110
354 3300048907 Ga0496104_1024226 Ga0496104_1024226_246_578 110
355 3300048908 Ga0496105_0035275 Ga0496105_0035275_1378_1710 110
356 3300048909 Ga0496106_0004983 Ga0496106_0004983_4396_4728 110
357 3300048909 Ga0496106_0012623 Ga0496106_0012623_3293_3625 110
358 3300048909 Ga0496106_0089116 Ga0496106_0089116_1515_1847 110
359 3300048909 Ga0496106_0758919 Ga0496106_0758919_186_518 110
360 3300048910 Ga0496107_0037062 Ga0496107_0037062_2054_2386 110
361 3300048910 Ga0496107_0554680 Ga0496107_0554680_181_513 110
362 3300048911 Ga0496108_0141407 Ga0496108_0141407_534_866 110
363 3300048914 Ga0496111_0127600 Ga0496111_0127600_814_1146 110
364 3300048914 Ga0496111_0284625 Ga0496111_0284625_97_429 110
365 3300048915 Ga0496112_0058807 Ga0496112_0058807_3012_3344 110
366 3300048916 Ga0496113_0060292 Ga0496113_0060292_124_456 110
367 3300048917 Ga0496114_0127558 Ga0496114_0127558_587_919 110
368 3300048917 Ga0496114_1476290 Ga0496114_1476290_188_520 110
369 3300048918 Ga0496115_0101304 Ga0496115_0101304_883_1215 110
370 3300048920 Ga0496117_0060994 Ga0496117_0060994_1464_1796 110
371 3300048921 Ga0496118_0022727 Ga0496118_0022727_2514_2846 110
372 3300048921 Ga0496118_0312325 Ga0496118_0312325_425_757 110
373 3300048924 Ga0496121_0001749 Ga0496121_0001749_31158_31490 110
374 3300048924 Ga0496121_0083873 Ga0496121_0083873_243_575 110
375 3300048927 Ga0496124_0010603 Ga0496124_0010603_750_1082 110
376 3300048928 Ga0496125_0183091 Ga0496125_0183091_711_1043 110
377 3300048929 Ga0496126_0057989 Ga0496126_0057989_686_1018 110
378 3300048929 Ga0496126_0218959 Ga0496126_0218959_493_825 110
379 3300048929 Ga0496126_0452802 Ga0496126_0452802_352_684 110
380 3300049586 Ga0501070_0228674 Ga0501070_0228674_200_532 110
381 3300050510 nmdc:mga06r32_1779477_c1 nmdc:mga06r32_1779477_c1_156_488 110
382 3300053083 Ga0495655_0052855 Ga0495655_0052855_124_456 110
383 3300053088 Ga0500644_0202925 Ga0500644_0202925_69_401 110
384 3300053090 Ga0500646_0106073 Ga0500646_0106073_23_355 110
385 3300053091 Ga0500647_0124431 Ga0500647_0124431_582_914 110
386 3300053096 Ga0500641_0001604 Ga0500641_0001604_6431_6763 110
387 3300053097 Ga0500648_372650 Ga0500648_372650_58_390 110
388 3300053106 Ga0500558_117782 Ga0500558_117782_615_947 110
389 3300053119 Ga0500595_125953 Ga0500595_125953_29_361 110
390 3300053134 Ga0500658_0168228 Ga0500658_0168228_402_734 110
391 3300053136 Ga0500559_0016966 Ga0500559_0016966_1290_1628 110
392 3300053142 Ga0500577_0043575 Ga0500577_0043575_807_1139 110
393 3300053148 Ga0500590_067892 Ga0500590_067892_785_1117 110
394 3300053150 Ga0500603_043625 Ga0500603_043625_771_1103 110
395 3300053150 Ga0500603_105981 Ga0500603_105981_26_358 110
396 3300053158 Ga0500627_0180765 Ga0500627_0180765_197_529 110
397 3300053160 Ga0500633_0182921 Ga0500633_0182921_130_462 110
398 3300053161 Ga0500634_0401539 Ga0500634_0401539_141_473 110
399 3300053177 Ga0500636_0018765 Ga0500636_0018765_3336_3668 110
400 3300053733 Ga0500552_089177 Ga0500552_089177_104_466 110
401 3300053735 Ga0500596_005269 Ga0500596_005269_115_477 110

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8736 38 109
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.8691 38 109
4xfg-assembly1.cif.gz_A cysteine dioxygenase variant - c93a at ph 6.2 with cysteine 0.8676 36 109
4xfh-assembly1.cif.gz_A cysteine dioxygenase variant - y157f at ph 6.2 with cysteine 0.8672 36 109
3eln-assembly1.cif.gz_A a putative fe2+-bound persulfenate intermediate in cysteine dioxygenase 0.8636 36 109
ID Description Score Start End Superfamily
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8634 36 109 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8482 39 109 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8405 28 109 2.60.120.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8235 42 108 2.60.120.10
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8234 38 109 2.60.120.10
ID Description Score Start End GO Terms
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9897 17 110
AF-A0A127Q2B0-F1-model_v4 Cupin domain protein 0.9884 6 110
AF-A0A645I2J9-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.982 28 110
AF-A0A1I0SAU6-F1-model_v4 DHCW motif cupin fold protein 0.9812 7 110
AF-A0A8B6KSK9-F1-model_v4 deleted 0.9809 44 110

Feature Viewer

pLDDT pTM Quality
94.59 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map