F434982

General Info

Members Datasets Scaffolds Average Seq Length
401 301 802 329

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221558|2643810269
Length 374
Sequence DLSTFARVKKLCMRICVKAKRASIEGKSVFAALSLTGRIHFMSLPTTMRHVDLPSFGGPDVMSFTNGPVPQPGAGEILVKVQAAGVNRPDVAQRQGIYPPPKDASPILGLEVAGTVAAVGAGVTDFAVGDQVCGLANGGGYAEFCILPVGQALPFPKGYDAVKAAAVPETFFTVWANLFQMAGLTEGENVLIHGGTSGIGTTAIQLAKAFGATVYTTAGSAEKCEACEKLGATRGINYKSEDFAAVIKEVTGGKGVDVVLDMIGAAYFERNLSCLAKDGCLSIIAFLGGNIAEKVDLRPIMVKRLTVTGSTMRPRTAEEKRAIRDELVAQVWPLLESGSVAPVIHSVLPFDQVVEAHRLMESSSHIGKIVLTLG

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
75 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 2643221558 Rhizobium sp. Root149 Isolate Unclassified
160 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
161 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
162 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
163 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
164 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
165 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
166 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
167 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
168 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
169 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
170 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
171 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
172 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
173 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
174 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
175 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
176 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
177 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
178 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
179 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
180 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
181 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
182 2643221568 Rhizobium sp. Root564 Isolate Unclassified
183 2643221582 Rhizobium sp. Root651 Isolate Unclassified
184 2643221640 Caulobacter sp. Root342 Isolate Unclassified
185 2643221642 Caulobacter sp. Root343 Isolate Unclassified
186 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
187 2643221693 Rhizobium sp. Root491 Isolate Unclassified
188 2718217882 Rhizobium sp. N741 Isolate Nodule
189 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
190 2718218009 Rhizobium sp. N561 Isolate Nodule
191 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
192 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
193 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
194 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
195 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
196 2718218363 Rhizobium sp. N113 Isolate Nodule
197 2718218365 Rhizobium sp. N731 Isolate Nodule
198 2718218366 Rhizobium sp. N621 Isolate Nodule
199 2721755514 Rhizobium sp. N6212 Isolate Nodule
200 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
201 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
202 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
203 2721755810 Rhizobium sp. N871 Isolate Nodule
204 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
205 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
206 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
207 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
208 2728369365 Rhizobium sp. N1341 Isolate Nodule
209 2728369397 Rhizobium sp. N1314 Isolate Nodule
210 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
211 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
212 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
213 2739367700 Dyella sp. YR388 Isolate Unclassified
214 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
215 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
216 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
217 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
218 2791355264 Rhizobium sp. S9 Isolate Nodule
219 2802429637 Rhizobium anhuiense C15 Isolate Nodule
220 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
221 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
222 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
223 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
224 2838061910 Rhizobium phaseoli L15 Isolate Nodule
225 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
226 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
227 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
228 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
229 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
230 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
231 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
232 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
233 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
234 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
235 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
236 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
237 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
238 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
239 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
240 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
241 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
242 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
243 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
244 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
245 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
246 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
247 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
248 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
252 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
253 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
254 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
255 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
256 2849560528 Caulobacter zeae 410 Isolate Unclassified
257 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
258 2851153111 Caulobacter radicis 736 Isolate Unclassified
259 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
260 2884411467 Dyella sp. AD56 Isolate Rhizosphere
261 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
262 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
263 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
264 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
265 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
266 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
267 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
268 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
269 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
270 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
271 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
272 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
273 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
274 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
275 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
276 2933599457 Rhizobium phaseoli M3 Isolate Nodule
277 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
278 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
279 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
280 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
281 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
282 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
283 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
284 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
285 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
286 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
287 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
288 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
289 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
290 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
291 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
292 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
293 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
294 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
295 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
296 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
297 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
298 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
299 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
300 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
301 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.09
Metatranscriptomes 0.25
Isolates 35.66

Biome Distribution

Category Percentage (%)
Aerial Root 1.25
Bulb 0
Endosphere 18.2
Nodule 18.95
Rhizoplane 3.99
Rhizosphere 31.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25162J39368_1002496 3300002737 Bacteria 7054
3 JGI25152J39213_1007211 3300002773 Bacteria 2907
4 JGI25152J39213_1007543 3300002773 Bacteria 2804
5 JGI25150J39212_1000052 3300002774 Bacteria 72258
6 JGI25159J45721_1000001 3300002987 Bacteria 303489
7 JGI25151J46595_10000101 3300003187 Bacteria 115630
8 JGI25151J46595_10004043 3300003187 Bacteria 7868
9 JGI25153J46596_10001360 3300003215 Bacteria 14640
10 JGI25153J46596_10017644 3300003215 Bacteria 2804
11 JGI25160J50197_1000002 3300003354 Bacteria 561707
12 Ga0055526_1000744 3300003771 Bacteria 24506
13 Ga0055526_1017268 3300003771 Bacteria 2767
14 Ga0055524_1012979 3300003775 Bacteria 3168
15 Ga0055528_1000442 3300003790 Bacteria 33264
16 Ga0055531_10026779 3300003794 Bacteria 2044
17 Ga0055531_10028294 3300003794 Bacteria 1937
18 Ga0055543_1000057 3300004625 Bacteria 102841
19 Ga0065165_1000004 3300005262 Bacteria 377081
20 Ga0065165_1013219 3300005262 Bacteria 3298
21 Ga0070676_10030153 3300005328 Bacteria 3091
22 Ga0070689_100008765 3300005340 Bacteria 7138
23 Ga0070691_10008920 3300005341 Bacteria 4591
24 Ga0070661_100118909 3300005344 Bacteria 1978
25 Ga0070688_100189145 3300005365 Bacteria 1433
26 Ga0070703_10033601 3300005406 Bacteria 1562
27 Ga0070700_100044456 3300005441 Bacteria 2736
28 Ga0070663_100079974 3300005455 Bacteria 2400
29 Ga0070697_100097020 3300005536 Bacteria 2446
30 Ga0070695_100001504 3300005545 Bacteria 12927
31 Ga0068855_100126790 3300005563 Bacteria 2918
32 Ga0068861_100126788 3300005719 Bacteria 2066
33 Ga0068870_10046032 3300005840 Bacteria 2287
34 Ga0068862_100188721 3300005844 Bacteria 1853
35 Ga0075365_10003747 3300006038 Bacteria 7909
36 Ga0075368_10008556 3300006042 Bacteria 3649
37 Ga0075362_10039578 3300006177 Bacteria 2073
38 Ga0075369_10000800 3300006186 Bacteria 10314
39 Ga0075366_10012408 3300006195 Bacteria 4833
40 Ga0075428_100018005 3300006844 Bacteria 7806
41 Ga0099826_10004568 3300006948 Bacteria 9732
42 Ga0105251_10001128 3300009011 Bacteria 23213
43 Ga0105250_10017060 3300009092 Bacteria 2952
44 Ga0111539_10008004 3300009094 Bacteria 13484
45 Ga0114129_10492067 3300009147 Bacteria 1603
46 Ga0105238_10062009 3300009551 Bacteria 3741
47 Ga0123342_1005401 3300009766 Bacteria 18530
48 Ga0157373_10008462 3300013100 Bacteria 7639
49 Ga0157371_10000200 3300013102 Bacteria 87804
50 Ga0157371_10050740 3300013102 Bacteria 2949
51 Ga0157370_10000090 3300013104 Bacteria 103336
52 Ga0163162_10245890 3300013306 Bacteria 1921
53 Ga0163162_10294062 3300013306 Bacteria 1756
54 Ga0157372_10127018 3300013307 Bacteria 2932
55 Ga0182008_10081254 3300014497 Bacteria 1595
56 Ga0163161_10026065 3300017792 Bacteria 4141
57 Ga0213875_10005161 3300021388 Bacteria 7063
58 Ga0207425_1000071 3300025245 Bacteria 116125
59 Ga0207425_1003241 3300025245 Bacteria 5305
60 Ga0209026_1002429 3300025250 Bacteria 7005
61 Ga0209129_1000078 3300025258 Bacteria 192880
62 Ga0209129_1000143 3300025258 Bacteria 116125
63 Ga0209129_1001843 3300025258 Bacteria 11225
64 Ga0209673_1000015 3300025273 Bacteria 530618
65 Ga0209673_1006616 3300025273 Bacteria 5545
66 Ga0209130_1000008 3300025284 Bacteria 581232
67 Ga0209676_1013823 3300025292 Bacteria 3078
68 Ga0209676_1016848 3300025292 Bacteria 2616
69 Ga0209676_1019446 3300025292 Bacteria 2336
70 Ga0209025_1000100 3300025294 Bacteria 229182
71 Ga0209025_1000118 3300025294 Bacteria 214009
72 Ga0209025_1000280 3300025294 Bacteria 116125
73 Ga0209025_1001137 3300025294 Bacteria 38011
74 Ga0209025_1001927 3300025294 Bacteria 24051
75 Ga0209564_1000104 3300025295 Bacteria 219017
76 Ga0209564_1002425 3300025295 Bacteria 14789
77 Ga0209758_1000235 3300025297 Bacteria 116093
78 Ga0209758_1000486 3300025297 Bacteria 65083
79 Ga0209758_1028347 3300025297 Bacteria 2371
80 Ga0209050_1024876 3300025298 Bacteria 2056
81 Ga0209256_1001051 3300025299 Bacteria 32086
82 Ga0209256_1001400 3300025299 Bacteria 25116
83 Ga0209256_1011914 3300025299 Bacteria 3408
84 Ga0209256_1014158 3300025299 Bacteria 2896
85 Ga0209256_1028712 3300025299 Bacteria 1564
86 Ga0207426_1000016 3300025302 Bacteria 581232
87 Ga0209051_1021647 3300025303 Bacteria 2728
88 Ga0209257_1006560 3300025304 Bacteria 7423
89 Ga0209257_1022242 3300025304 Bacteria 2268
90 Ga0207655_1005900 3300025728 Bacteria 8210
91 Ga0207713_1000992 3300025735 Bacteria 24891
92 Ga0207645_10026860 3300025907 Bacteria 3719
93 Ga0207643_10003751 3300025908 Bacteria 8163
94 Ga0207649_10102959 3300025920 Bacteria 1893
95 Ga0207670_10005104 3300025936 Bacteria 7167
96 Ga0207704_10150233 3300025938 Bacteria 1643
97 Ga0207678_10211100 3300026067 Bacteria 1661
98 Ga0207708_10091406 3300026075 Bacteria 2347
99 Ga0209371_1000009 3300027312 Bacteria 963030
100 Ga0209371_1003091 3300027312 Bacteria 8491
101 Ga0209282_1000143 3300027666 Bacteria 42143
102 Ga0268256_1000010 3300030500 Bacteria 963034
103 Ga0268256_1005992 3300030500 Bacteria 4635
104 Ga0265331_10022921 3300031250 Bacteria 3180
105 Ga0265327_10000044 3300031251 Bacteria 284808
106 Ga0307406_10305998 3300031901 Bacteria 1223
107 Ga0373932_0019733 3300035112 Bacteria 1760
108 Ga0373942_0038379 3300035207 Bacteria 1298
109 Ga0373962_0001186 3300035242 Bacteria 6095
110 Ga0373931_0000887 3300035691 Bacteria 12649
111 Ga0373937_0260991 3300036401 Bacteria 1634
112 Ga0395905_0005374 3300037471 Bacteria 13092
113 Ga0395905_0010331 3300037471 Bacteria 9086
114 Ga0436364_0655360 3300037853 Bacteria 1812
115 Ga0436364_0714857 3300037853 Bacteria 42197
116 Ga0436365_0501115 3300039437 Bacteria 2958
117 Ga0436360_0659324 3300039438 Bacteria 3312
118 Ga0439438_000595 3300041405 Bacteria 16370
119 Ga0439462_0009534 3300042015 Bacteria 2455
120 Ga0466960_0015400 3300044901 Bacteria 3296
121 Ga0495627_004529 3300046453 Bacteria 5796
122 Ga0495591_000040 3300046458 Bacteria 155841
123 Ga0495591_000054 3300046458 Bacteria 135364
124 Ga0495638_0000052 3300046460 Bacteria 203695
125 Ga0495638_0000166 3300046460 Bacteria 102926
126 Ga0495638_0000258 3300046460 Bacteria 71672
127 Ga0495638_0009366 3300046460 Bacteria 6885
128 Ga0495638_0009743 3300046460 Bacteria 6710
129 Ga0495638_0150277 3300046460 Bacteria 1351
130 Ga0495650_0000145 3300046471 Bacteria 164687
131 Ga0495650_0008419 3300046471 Bacteria 6023
132 Ga0495605_0000001 3300046474 Bacteria 614538
133 Ga0495605_0000017 3300046474 Bacteria 273775
134 Ga0495605_0012514 3300046474 Bacteria 4704
135 Ga0495584_0069859 3300046491 Bacteria 1765
136 Ga0495607_0000022 3300046501 Bacteria 162516
137 Ga0495607_0000835 3300046501 Bacteria 29081
138 Ga0495607_0001430 3300046501 Bacteria 21274
139 Ga0495583_0000732 3300046506 Bacteria 41759
140 Ga0495583_0001780 3300046506 Bacteria 20527
141 Ga0495606_0000343 3300046507 Bacteria 79977
142 Ga0495606_0003662 3300046507 Bacteria 16100
143 Ga0495620_0000105 3300046515 Bacteria 67077
144 Ga0495632_0042716 3300046519 Bacteria 2271
145 Ga0495637_0020998 3300046520 Bacteria 2996
146 Ga0495654_0052130 3300046530 Bacteria 1994
147 Ga0495609_0000020 3300046538 Bacteria 294662
148 Ga0495622_0027865 3300046557 Bacteria 2636
149 Ga0495633_0093260 3300046558 Bacteria 1399
150 Ga0495668_0018724 3300046616 Bacteria 4002
151 Ga0495661_0016051 3300046665 Bacteria 4975
152 Ga0495649_0000533 3300046694 Bacteria 32351
153 Ga0495672_0035286 3300047320 Bacteria 3081
154 Ga0495683_0000019 3300047323 Bacteria 183206
155 Ga0495679_021009 3300047446 Bacteria 2264
156 Ga0495673_0009946 3300047469 Bacteria 5213
157 Ga0495681_0015856 3300047470 Bacteria 4252
158 Ga0495686_0000757 3300047472 Bacteria 42627
159 Ga0495686_0025297 3300047472 Bacteria 3893
160 Ga0496100_0214162 3300048903 Bacteria 1411
161 Ga0496102_0200310 3300048905 Bacteria 1882
162 Ga0496104_0012074 3300048907 Bacteria 7753
163 Ga0496105_0140217 3300048908 Bacteria 1990
164 Ga0496107_0124682 3300048910 Bacteria 1899
165 Ga0496107_0125583 3300048910 Bacteria 1892
166 Ga0496115_0000950 3300048918 Bacteria 21033
167 Ga0496115_0008717 3300048918 Bacteria 7516
168 Ga0496115_0266198 3300048918 Bacteria 1409
169 Ga0496115_0393924 3300048918 Bacteria 1124
170 Ga0496116_0000036 3300048919 Bacteria 388508
171 Ga0496116_0002949 3300048919 Bacteria 17333
172 Ga0496116_0024423 3300048919 Bacteria 4471
173 Ga0496116_0138561 3300048919 Bacteria 1373
174 Ga0496117_0000002 3300048920 Bacteria 2483758
175 Ga0496117_0002003 3300048920 Bacteria 26991
176 Ga0496117_0029584 3300048920 Bacteria 4221
177 Ga0496117_0092500 3300048920 Bacteria 1942
178 Ga0496118_0000084 3300048921 Bacteria 181733
179 Ga0496118_0012554 3300048921 Bacteria 8114
180 Ga0496118_0020250 3300048921 Bacteria 5906
181 Ga0496118_0038531 3300048921 Bacteria 3829
182 Ga0496118_0078850 3300048921 Bacteria 2328
183 Ga0496118_0157552 3300048921 Bacteria 1410
184 Ga0496119_0001129 3300048922 Bacteria 33640
185 Ga0496119_0008885 3300048922 Bacteria 8740
186 Ga0496119_0023347 3300048922 Bacteria 4391
187 Ga0496119_0042445 3300048922 Bacteria 2883
188 Ga0496120_0001179 3300048923 Bacteria 33269
189 Ga0496120_0003418 3300048923 Bacteria 14503
190 Ga0496120_0110157 3300048923 Bacteria 1440
191 Ga0496121_0000001 3300048924 Bacteria 1830318
192 Ga0496121_0002217 3300048924 Bacteria 30352
193 Ga0496121_0016196 3300048924 Bacteria 7717
194 Ga0496121_0026819 3300048924 Bacteria 5413
195 Ga0496121_0094228 3300048924 Bacteria 2330
196 Ga0496122_0000001 3300048925 Bacteria 1827766
197 Ga0496122_0000009 3300048925 Bacteria 584024
198 Ga0496122_0000043 3300048925 Bacteria 280333
199 Ga0496122_0000604 3300048925 Bacteria 73844
200 Ga0496122_0008955 3300048925 Bacteria 10643
201 Ga0496122_0009272 3300048925 Bacteria 10406
202 Ga0496122_0026073 3300048925 Bacteria 5055
203 Ga0496122_0090474 3300048925 Bacteria 2088
204 Ga0496122_0109963 3300048925 Bacteria 1812
205 Ga0496123_0000001 3300048926 Bacteria 1831497
206 Ga0496123_0000020 3300048926 Bacteria 388748
207 Ga0496123_0000090 3300048926 Bacteria 179735
208 Ga0496123_0001019 3300048926 Bacteria 42794
209 Ga0496123_0012552 3300048926 Bacteria 7213
210 Ga0496123_0091150 3300048926 Bacteria 1809
211 Ga0496123_0149645 3300048926 Bacteria 1262
212 Ga0496123_0187785 3300048926 Bacteria 1072
213 Ga0496124_0000187 3300048927 Bacteria 122984
214 Ga0496124_0000714 3300048927 Bacteria 54365
215 Ga0496124_0001104 3300048927 Bacteria 42442
216 Ga0496124_0004186 3300048927 Bacteria 16993
217 Ga0496124_0022103 3300048927 Bacteria 5840
218 Ga0496124_0036090 3300048927 Bacteria 4317
219 Ga0496124_0197857 3300048927 Bacteria 1531
220 Ga0496124_0252806 3300048927 Bacteria 1302
221 Ga0496125_0000001 3300048928 Bacteria 1766138
222 Ga0496125_0002201 3300048928 Bacteria 26004
223 Ga0496125_0152221 3300048928 Bacteria 1586
224 Ga0496126_0000289 3300048929 Bacteria 106590
225 Ga0496126_0120118 3300048929 Bacteria 2280
226 Ga0496126_0121763 3300048929 Bacteria 2261
227 Ga0496126_0136449 3300048929 Bacteria 2115
228 Ga0496126_0241604 3300048929 Bacteria 1508
229 Ga0496126_0383412 3300048929 Bacteria 1143
230 Ga0496126_0400330 3300048929 Bacteria 1113
231 Ga0495682_0000355 3300049460 Bacteria 33636
232 Ga0501032_0061211 3300049569 Bacteria 2524
233 Ga0501033_0000038 3300049570 Bacteria 144438
234 Ga0501033_0009570 3300049570 Bacteria 7457
235 Ga0501037_0215319 3300049573 Bacteria 1353
236 Ga0501047_0268192 3300049581 Bacteria 1554
237 Ga0501035_0002759 3300049822 Bacteria 17027
238 nmdc:mga03683_93048_c1 3300050489 Bacteria 1317
239 nmdc:mga00v17_11422_c1 3300050491 Bacteria 4881
240 nmdc:mga00v17_532_c1 3300050491 Bacteria 21380
241 nmdc:mga0yw44_11437_c1 3300050492 Bacteria 4582
242 nmdc:mga0k408_10166_c1 3300050493 Bacteria 5087
243 nmdc:mga06z11_39348_c1 3300050494 Bacteria 2353
244 nmdc:mga05p37_436915_c1 3300050507 Bacteria 1519
245 nmdc:mga06r32_349810_c1 3300050510 Bacteria 1462
246 nmdc:mga0sz30_60765_c1 3300050516 Bacteria 1614
247 Ga0500644_0089200 3300053088 Bacteria 1150
248 Ga0500572_045030 3300053111 Bacteria 1295
249 Ga0500618_000355 3300053125 Bacteria 31809
250 Ga0500561_0000035 3300053137 Bacteria 27996
251 Ga0500568_0000408 3300053139 Bacteria 32817
252 Ga0500573_0002701 3300053140 Bacteria 8961
253 Ga0500616_0001981 3300053153 Bacteria 18200
254 Ga0500622_0006798 3300053156 Bacteria 6580
255 Ga0500624_001812 3300053157 Bacteria 3101
256 Ga0500634_0007855 3300053161 Bacteria 5296
257 Ga0500636_0003721 3300053177 Bacteria 8611
258 Ga0587090_007479 3300059510 Bacteria 1436
259 2643810269 2643221558 Bacteria 5460675
260 2509107376 2508501122 Bacteria 6292184
261 2511183162 2510917028 Bacteria 6185411
262 2511196599 2510917030 Bacteria 7460662
263 2513907819 2513237144 Bacteria 7530820
264 2513927432 2513237146 Bacteria 7166346
265 2524457793 2524023209 Bacteria 6679728
266 2530644187 2529292951 Bacteria 6916614
267 2537873775 2537561587 Bacteria 5425293
268 2554246850 2554235003 Bacteria 5877155
269 2559294076 2558860242 Bacteria 5568029
270 2561469174 2558860983 Bacteria 4133860
271 2585256894 2582581304 Bacteria 5831370
272 2585405202 2582581867 Bacteria 7184437
273 2585823126 2585427590 Bacteria 6824633
274 2599418860 2599185170 Bacteria 7295545
275 2599603596 2599185210 Bacteria 5624189
276 2599971470 2599185307 Bacteria 6194719
277 2601608946 2600255279 Bacteria 5605316
278 2601623836 2600255283 Bacteria 6061572
279 2601745721 2600255308 Bacteria 5611129
280 2616296868 2615840624 Bacteria 6557588
281 2616553709 2615840698 Bacteria 7319877
282 2643856125 2643221568 Bacteria 5187270
283 2643920930 2643221582 Bacteria 5804683
284 2644224011 2643221640 Bacteria 5258820
285 2644232997 2643221642 Bacteria 5357871
286 2644241255 2643221643 Bacteria 5749658
287 2644519008 2643221693 Bacteria 5513853
288 2719179988 2718217882 Bacteria 6556348
289 2719664336 2718217997 Bacteria 6740740
290 2719730737 2718218009 Bacteria 6478651
291 2720490756 2718218199 Bacteria 6740745
292 2720612118 2718218232 Bacteria 6720332
293 2720618950 2718218233 Bacteria 6662049
294 2720630357 2718218235 Bacteria 6630699
295 2720774051 2718218269 Bacteria 6906114
296 2721146081 2718218363 Bacteria 6524337
297 2721157600 2718218365 Bacteria 6274507
298 2721162961 2718218366 Bacteria 6425255
299 2722839131 2721755514 Bacteria 6424414
300 2723025778 2721755556 Bacteria 6745503
301 2723559318 2721755684 Bacteria 6859907
302 2723565939 2721755685 Bacteria 6704835
303 2724043493 2721755810 Bacteria 6479005
304 2724088658 2721755819 Bacteria 6906405
305 2724103204 2721755822 Bacteria 6726041
306 2724109038 2721755823 Bacteria 6752556
307 2730106714 2728369352 Bacteria 6745171
308 2730163225 2728369365 Bacteria 6555560
309 2730297232 2728369397 Bacteria 6274511
310 2738689180 2738541271 Bacteria 5657310
311 2738945895 2738541317 Bacteria 5340176
312 2739264567 2738543016 Bacteria 5657564
313 2739731013 2739367700 Bacteria 4747630
314 2776912474 2775507049 Bacteria 6284736
315 2788433501 2786546940 Bacteria 6396474
316 2792459977 2791355048 Bacteria 5832535
317 2792642064 2791355094 Bacteria 7011481
318 2793349264 2791355264 Bacteria 6429314
319 2806075907 2802429637 Bacteria 7067217
320 2808986149 2808606387 Bacteria 5697198
321 2819556276 2818991439 Bacteria 6907412
322 2838021826 2838016132 Bacteria 6577831
323 2838037453 2838035591 Bacteria 7166484
324 2838068083 2838061910 Bacteria 6794874
325 2838073047 2838068647 Bacteria 6208656
326 2838663402 2838661181 Bacteria 7385261
327 2838677002 2838675328 Bacteria 4909118
328 2838715889 2838714209 Bacteria 5525906
329 2838720310 2838719591 Bacteria 5523910
330 2838726642 2838724970 Bacteria 4908691
331 2841847240 2841846520 Bacteria 5345850
332 2841860222 2841859092 Bacteria 5436171
333 2842126730 2842124991 Bacteria 5346824
334 2842131895 2842130223 Bacteria 4909145
335 2842152935 2842152218 Bacteria 4908957
336 2842172133 2842170452 Bacteria 5525737
337 2842176554 2842175837 Bacteria 4908771
338 2842188998 2842187318 Bacteria 5524014
339 2842213310 2842211629 Bacteria 5523832
340 2842225072 2842224351 Bacteria 5524473
341 2842269973 2842264693 Bacteria 6472963
342 2842300592 2842298080 Bacteria 6123127
343 2842316935 2842311132 Bacteria 6616990
344 2842358290 2842357229 Bacteria 6485165
345 2842426780 2842422224 Bacteria 6239196
346 2842434399 2842428310 Bacteria 6767288
347 2842440759 2842434925 Bacteria 6502746
348 2842447411 2842441272 Bacteria 6769273
349 2842468755 2842462802 Bacteria 6588055
350 2842475328 2842469257 Bacteria 6752936
351 2842482633 2842482326 Bacteria 7212537
352 2842509483 2842509118 Bacteria 6850950
353 2842517007 2842515876 Bacteria 5436280
354 2842778262 2842775625 Bacteria 5587290
355 2843744431 2843744320 Bacteria 5659202
356 2849565014 2849560528 Bacteria 5393480
357 2849575049 2849573788 Bacteria 5421256
358 2851155905 2851153111 Bacteria 5542585
359 2883581446 2883577096 Bacteria 4709178
360 2884415480 2884411467 Bacteria 5246714
361 2891376432 2891373044 Bacteria 5202277
362 2898332460 2898329390 Bacteria 5168154
363 2899792287 2899792073 Bacteria 4926588
364 2899805978 2899803654 Bacteria 5577784
365 2899846564 2899845264 Bacteria 5672268
366 2913310421 2913308742 Bacteria 5350706
367 2919116091 2919114240 Bacteria 5700270
368 2919167109 2919166419 Bacteria 4952238
369 2926757045 2926754445 Bacteria 5964435
370 2926761269 2926760298 Bacteria 5505990
371 2928534902 2928531327 Bacteria 5101314
372 2929139197 2929138655 Bacteria 5810547
373 2933007580 2933006813 Bacteria 4912075
374 2933012350 2933011516 Bacteria 5439334
375 2933594792 2933594066 Bacteria 5594265
376 2933603239 2933599457 Bacteria 5858799
377 2978973527 2978969890 Bacteria 5400756
378 2979093450 2979089926 Bacteria 5670289
379 2979099164 2979095461 Bacteria 5669583
380 2979105424 2979100975 Bacteria 5423623
381 2984512726 2984509177 Bacteria 5274802
382 2984520912 2984518228 Bacteria 5277463
383 2984540207 2984537506 Bacteria 5277481
384 2984591810 2984587000 Bacteria 5263363
385 2984602402 2984601300 Bacteria 5455244
386 3005411491 3005409236 Bacteria 7188837
387 650739267 650716007 Bacteria 5573770
388 8003570304 8003570095 Bacteria 5747666
389 8005285594 8005282627 Bacteria 6675747
390 8005432517 8005430974 Bacteria 6689030
391 8005499049 8005497431 Bacteria 6477605
392 8005620238 8005619151 Bacteria 7030230
393 8005626789 8005626139 Bacteria 6534237
394 8005662250 8005658619 Bacteria 4500593
395 8005670463 8005668836 Bacteria 6953162
396 8015690944 8015687852 Bacteria 6613826
397 8018131000 8018127388 Bacteria 7351159
398 8018154215 8018150411 Bacteria 5549903
399 8054461613 8054460903 Bacteria 4872905
400 8056879391 8056875544 Bacteria 4355797
401 8057578971 8057575449 Bacteria 7367519
402 JGI25155J39150_1000006
403 JGI25162J39368_1002496
404 JGI25152J39213_1007211
405 JGI25152J39213_1007543
406 JGI25150J39212_1000052
407 JGI25159J45721_1000001
408 JGI25151J46595_10000101
409 JGI25151J46595_10004043
410 JGI25153J46596_10001360
411 JGI25153J46596_10017644
412 JGI25160J50197_1000002
413 Ga0055526_1000744
414 Ga0055526_1017268
415 Ga0055524_1012979
416 Ga0055528_1000442
417 Ga0055531_10026779
418 Ga0055531_10028294
419 Ga0055543_1000057
420 Ga0065165_1000004
421 Ga0065165_1013219
422 Ga0070676_10030153
423 Ga0070689_100008765
424 Ga0070691_10008920
425 Ga0070661_100118909
426 Ga0070688_100189145
427 Ga0070703_10033601
428 Ga0070700_100044456
429 Ga0070663_100079974
430 Ga0070697_100097020
431 Ga0070695_100001504
432 Ga0068855_100126790
433 Ga0068861_100126788
434 Ga0068870_10046032
435 Ga0068862_100188721
436 Ga0075365_10003747
437 Ga0075368_10008556
438 Ga0075362_10039578
439 Ga0075369_10000800
440 Ga0075366_10012408
441 Ga0075428_100018005
442 Ga0099826_10004568
443 Ga0105251_10001128
444 Ga0105250_10017060
445 Ga0111539_10008004
446 Ga0114129_10492067
447 Ga0105238_10062009
448 Ga0123342_1005401
449 Ga0157373_10008462
450 Ga0157371_10000200
451 Ga0157371_10050740
452 Ga0157370_10000090
453 Ga0163162_10245890
454 Ga0163162_10294062
455 Ga0157372_10127018
456 Ga0182008_10081254
457 Ga0163161_10026065
458 Ga0213875_10005161
459 Ga0207425_1000071
460 Ga0207425_1003241
461 Ga0209026_1002429
462 Ga0209129_1000078
463 Ga0209129_1000143
464 Ga0209129_1001843
465 Ga0209673_1000015
466 Ga0209673_1006616
467 Ga0209130_1000008
468 Ga0209676_1013823
469 Ga0209676_1016848
470 Ga0209676_1019446
471 Ga0209025_1000100
472 Ga0209025_1000118
473 Ga0209025_1000280
474 Ga0209025_1001137
475 Ga0209025_1001927
476 Ga0209564_1000104
477 Ga0209564_1002425
478 Ga0209758_1000235
479 Ga0209758_1000486
480 Ga0209758_1028347
481 Ga0209050_1024876
482 Ga0209256_1001051
483 Ga0209256_1001400
484 Ga0209256_1011914
485 Ga0209256_1014158
486 Ga0209256_1028712
487 Ga0207426_1000016
488 Ga0209051_1021647
489 Ga0209257_1006560
490 Ga0209257_1022242
491 Ga0207655_1005900
492 Ga0207713_1000992
493 Ga0207645_10026860
494 Ga0207643_10003751
495 Ga0207649_10102959
496 Ga0207670_10005104
497 Ga0207704_10150233
498 Ga0207678_10211100
499 Ga0207708_10091406
500 Ga0209371_1000009
501 Ga0209371_1003091
502 Ga0209282_1000143
503 Ga0268256_1000010
504 Ga0268256_1005992
505 Ga0265331_10022921
506 Ga0265327_10000044
507 Ga0307406_10305998
508 Ga0373932_0019733
509 Ga0373942_0038379
510 Ga0373962_0001186
511 Ga0373931_0000887
512 Ga0373937_0260991
513 Ga0395905_0005374
514 Ga0395905_0010331
515 Ga0436364_0655360
516 Ga0436364_0714857
517 Ga0436365_0501115
518 Ga0436360_0659324
519 Ga0439438_000595
520 Ga0439462_0009534
521 Ga0466960_0015400
522 Ga0495627_004529
523 Ga0495591_000040
524 Ga0495591_000054
525 Ga0495638_0000052
526 Ga0495638_0000166
527 Ga0495638_0000258
528 Ga0495638_0009366
529 Ga0495638_0009743
530 Ga0495638_0150277
531 Ga0495650_0000145
532 Ga0495650_0008419
533 Ga0495605_0000001
534 Ga0495605_0000017
535 Ga0495605_0012514
536 Ga0495584_0069859
537 Ga0495607_0000022
538 Ga0495607_0000835
539 Ga0495607_0001430
540 Ga0495583_0000732
541 Ga0495583_0001780
542 Ga0495606_0000343
543 Ga0495606_0003662
544 Ga0495620_0000105
545 Ga0495632_0042716
546 Ga0495637_0020998
547 Ga0495654_0052130
548 Ga0495609_0000020
549 Ga0495622_0027865
550 Ga0495633_0093260
551 Ga0495668_0018724
552 Ga0495661_0016051
553 Ga0495649_0000533
554 Ga0495672_0035286
555 Ga0495683_0000019
556 Ga0495679_021009
557 Ga0495673_0009946
558 Ga0495681_0015856
559 Ga0495686_0000757
560 Ga0495686_0025297
561 Ga0496100_0214162
562 Ga0496102_0200310
563 Ga0496104_0012074
564 Ga0496105_0140217
565 Ga0496107_0124682
566 Ga0496107_0125583
567 Ga0496115_0000950
568 Ga0496115_0008717
569 Ga0496115_0266198
570 Ga0496115_0393924
571 Ga0496116_0000036
572 Ga0496116_0002949
573 Ga0496116_0024423
574 Ga0496116_0138561
575 Ga0496117_0000002
576 Ga0496117_0002003
577 Ga0496117_0029584
578 Ga0496117_0092500
579 Ga0496118_0000084
580 Ga0496118_0012554
581 Ga0496118_0020250
582 Ga0496118_0038531
583 Ga0496118_0078850
584 Ga0496118_0157552
585 Ga0496119_0001129
586 Ga0496119_0008885
587 Ga0496119_0023347
588 Ga0496119_0042445
589 Ga0496120_0001179
590 Ga0496120_0003418
591 Ga0496120_0110157
592 Ga0496121_0000001
593 Ga0496121_0002217
594 Ga0496121_0016196
595 Ga0496121_0026819
596 Ga0496121_0094228
597 Ga0496122_0000001
598 Ga0496122_0000009
599 Ga0496122_0000043
600 Ga0496122_0000604
601 Ga0496122_0008955
602 Ga0496122_0009272
603 Ga0496122_0026073
604 Ga0496122_0090474
605 Ga0496122_0109963
606 Ga0496123_0000001
607 Ga0496123_0000020
608 Ga0496123_0000090
609 Ga0496123_0001019
610 Ga0496123_0012552
611 Ga0496123_0091150
612 Ga0496123_0149645
613 Ga0496123_0187785
614 Ga0496124_0000187
615 Ga0496124_0000714
616 Ga0496124_0001104
617 Ga0496124_0004186
618 Ga0496124_0022103
619 Ga0496124_0036090
620 Ga0496124_0197857
621 Ga0496124_0252806
622 Ga0496125_0000001
623 Ga0496125_0002201
624 Ga0496125_0152221
625 Ga0496126_0000289
626 Ga0496126_0120118
627 Ga0496126_0121763
628 Ga0496126_0136449
629 Ga0496126_0241604
630 Ga0496126_0383412
631 Ga0496126_0400330
632 Ga0495682_0000355
633 Ga0501032_0061211
634 Ga0501033_0000038
635 Ga0501033_0009570
636 Ga0501037_0215319
637 Ga0501047_0268192
638 Ga0501035_0002759
639 nmdc:mga03683_93048_c1
640 nmdc:mga00v17_11422_c1
641 nmdc:mga00v17_532_c1
642 nmdc:mga0yw44_11437_c1
643 nmdc:mga0k408_10166_c1
644 nmdc:mga06z11_39348_c1
645 nmdc:mga05p37_436915_c1
646 nmdc:mga06r32_349810_c1
647 nmdc:mga0sz30_60765_c1
648 Ga0500644_0089200
649 Ga0500572_045030
650 Ga0500618_000355
651 Ga0500561_0000035
652 Ga0500568_0000408
653 Ga0500573_0002701
654 Ga0500616_0001981
655 Ga0500622_0006798
656 Ga0500624_001812
657 Ga0500634_0007855
658 Ga0500636_0003721
659 Ga0587090_007479
660 2643810269
661 2509107376
662 2511183162
663 2511196599
664 2513907819
665 2513927432
666 2524457793
667 2530644187
668 2537873775
669 2554246850
670 2559294076
671 2561469174
672 2585256894
673 2585405202
674 2585823126
675 2599418860
676 2599603596
677 2599971470
678 2601608946
679 2601623836
680 2601745721
681 2616296868
682 2616553709
683 2643856125
684 2643920930
685 2644224011
686 2644232997
687 2644241255
688 2644519008
689 2719179988
690 2719664336
691 2719730737
692 2720490756
693 2720612118
694 2720618950
695 2720630357
696 2720774051
697 2721146081
698 2721157600
699 2721162961
700 2722839131
701 2723025778
702 2723559318
703 2723565939
704 2724043493
705 2724088658
706 2724103204
707 2724109038
708 2730106714
709 2730163225
710 2730297232
711 2738689180
712 2738945895
713 2739264567
714 2739731013
715 2776912474
716 2788433501
717 2792459977
718 2792642064
719 2793349264
720 2806075907
721 2808986149
722 2819556276
723 2838021826
724 2838037453
725 2838068083
726 2838073047
727 2838663402
728 2838677002
729 2838715889
730 2838720310
731 2838726642
732 2841847240
733 2841860222
734 2842126730
735 2842131895
736 2842152935
737 2842172133
738 2842176554
739 2842188998
740 2842213310
741 2842225072
742 2842269973
743 2842300592
744 2842316935
745 2842358290
746 2842426780
747 2842434399
748 2842440759
749 2842447411
750 2842468755
751 2842475328
752 2842482633
753 2842509483
754 2842517007
755 2842778262
756 2843744431
757 2849565014
758 2849575049
759 2851155905
760 2883581446
761 2884415480
762 2891376432
763 2898332460
764 2899792287
765 2899805978
766 2899846564
767 2913310421
768 2919116091
769 2919167109
770 2926757045
771 2926761269
772 2928534902
773 2929139197
774 2933007580
775 2933012350
776 2933594792
777 2933603239
778 2978973527
779 2979093450
780 2979099164
781 2979105424
782 2984512726
783 2984520912
784 2984540207
785 2984591810
786 2984602402
787 3005411491
788 650739267
789 8003570304
790 8005285594
791 8005432517
792 8005499049
793 8005620238
794 8005626789
795 8005662250
796 8005670463
797 8015690944
798 8018131000
799 8018154215
800 8054461613
801 8056879391
802 8057578971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

198

327

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

230

371

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

73

157

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.994 1 331
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.991 1 331
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9866 3 331
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9835 3 331
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9813 6 332
ID Description Score Start End Superfamily
af_Q4DAS0_3_129_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9935 7 130 3.90.180.10
af_C6TID4_1_124_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9901 7 128 3.90.180.10
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9831 6 330 3.90.180.10
af_Q75JT6_2_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9823 7 128 3.90.180.10
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9822 7 331 3.90.180.10
ID Description Score Start End GO Terms
AF-B9JTA9-F1-model_v4 Quinone oxidoreductase 0.9973 1 331 GO:0016651
GO:0070402
AF-A0A7H4MI33-F1-model_v4 Quinone oxidoreductase (EC 2.3.1.41) 0.9946 7 147 GO:0004315
GO:0016651
GO:0070402
AF-B9JTA9-F1-model_v4 Quinone oxidoreductase 0.9913 1 331 GO:0016651
GO:0070402
AF-A0A354UX27-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.99 1 100 GO:0016651
GO:0070402
AF-A0A512H9F7-F1-model_v4 NAD(P)H quinone oxidoreductase 0.9892 3 332 GO:0016651
GO:0070402

Map