F435017

General Info

Members Datasets Scaffolds Average Seq Length
402 238 805 128

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100072664|Ga0070680_1000726642
Length 147
Sequence MAQKAVETKQPNFNLFRQSAAFSSFSVNDLNKAQEFYGSTLGLETTKTPEGLMLRIAGGSPIFIYPKSNHTPASFTILNFPVDDIDEAVDELTKRGIHFESYNEPMKTDEKGIHRGESTGQGPNIAWFKDPAGNFLSVLENTGSADQ

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
15 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
16 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
17 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
18 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
19 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
103 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
104 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
105 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
106 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
107 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
108 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
109 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 1.74
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100072664 3300005336 Bacteria 2827
2 SwRhRL3b_contig_2609502 2162886006 Archaea 1512
3 SwRhRL3b_contig_378765 2162886006 Archaea 1790
4 MRS1b_contig_6031450 2162886011 Archaea 1637
5 2214828557 2209111006 Archaea 1806
6 ARcpr5oldR_c000714 3300000041 Archaea 3827
7 ARSoilYngRDRAFT_c00715 3300000042 Archaea 3080
8 ARCol0yngRDRAFT_1000102 3300000652 Archaea 15846
9 JGI24737J22298_10028520 3300001990 Unclassified 1754
10 JGI24033J26618_1006462 3300002155 Archaea 1316
11 rootH1_10004557 3300003316 Bacteria 1533
12 rootH1_10004557 3300003323 Bacteria 5638
13 rootH1_10077413 3300003316 Bacteria 1826
14 rootL2_10220025 3300003322 Unclassified 3332
15 rootL2_10279067 3300003322 Bacteria 1392
16 JGI26129J50193_1000420 3300003349 Archaea 2632
17 JGI26145J50221_1000028 3300003371 Archaea 10329
18 JGI26142J50222_100784 3300003379 Archaea 1009
19 JGI26140J50224_101077 3300003383 Archaea 990
20 JGI26134J50242_100224 3300003392 Archaea 2657
21 JGI26136J50244_100409 3300003399 Archaea 1513
22 JGI26131J50246_100106 3300003400 Archaea 4060
23 JGI26138J51218_100218 3300003504 Archaea 2537
24 Ga0065716_1000223 3300005277 Archaea 2543
25 Ga0065704_10631375 3300005289 Bacteria 538
26 Ga0065712_10001104 3300005290 Archaea 20445
27 Ga0065715_10126374 3300005293 Archaea 2108
28 Ga0065715_10256125 3300005293 Archaea 1116
29 Ga0065715_10768800 3300005293 Bacteria 618
30 Ga0065707_10000638 3300005295 Archaea 27995
31 Ga0070658_10031923 3300005327 Bacteria 4232
32 Ga0070676_10266664 3300005328 Archaea 1148
33 Ga0070676_10680272 3300005328 Archaea 750
34 Ga0070670_100024010 3300005331 Archaea 5245
35 Ga0070670_100215903 3300005331 Archaea 1668
36 Ga0070670_101030808 3300005331 Bacteria 749
37 Ga0070670_101409041 3300005331 Unclassified 639
38 Ga0070677_10030635 3300005333 Archaea 2049
39 Ga0068869_100015806 3300005334 Archaea 5073
40 Ga0070680_100089619 3300005336 Archaea 2545
41 Ga0070680_100153106 3300005336 Unclassified 1936
42 Ga0070680_100305252 3300005336 Archaea 1350
43 Ga0070680_101522317 3300005336 Bacteria 579
44 Ga0070682_100590255 3300005337 Bacteria 875
45 Ga0070682_100805845 3300005337 Bacteria 763
46 Ga0070660_100684287 3300005339 Bacteria 860
47 Ga0070687_100952626 3300005343 Archaea 619
48 Ga0070687_100965406 3300005343 Archaea 615
49 Ga0070661_100244712 3300005344 Bacteria 1382
50 Ga0070661_100279848 3300005344 Archaea 1294
51 Ga0070692_10120184 3300005345 Archaea 1464
52 Ga0070668_100036975 3300005347 Archaea 3727
53 Ga0070669_100262555 3300005353 Archaea 1378
54 Ga0070669_100711579 3300005353 Archaea 849
55 Ga0070671_100982258 3300005355 Archaea 739
56 Ga0070674_100147685 3300005356 Unclassified 1771
57 Ga0070674_101617205 3300005356 Bacteria 584
58 Ga0070673_100246124 3300005364 Archaea 1556
59 Ga0070659_100075053 3300005366 Archaea 2694
60 Ga0070659_101486574 3300005366 Unclassified 603
61 Ga0070667_101040279 3300005367 Archaea 764
62 Ga0070701_10300538 3300005438 Archaea 986
63 Ga0070711_101381521 3300005439 Unclassified 612
64 Ga0070705_100369414 3300005440 Bacteria 1052
65 Ga0070705_100506300 3300005440 Archaea 918
66 Ga0070705_101119675 3300005440 Bacteria 645
67 Ga0070705_101392502 3300005440 Unclassified 584
68 Ga0070705_101909531 3300005440 Archaea 505
69 Ga0070700_100257274 3300005441 Archaea 1255
70 Ga0070694_100048022 3300005444 Archaea 2870
71 Ga0070694_100545810 3300005444 Archaea 927
72 Ga0070694_100868691 3300005444 Archaea 743
73 Ga0070708_100158432 3300005445 Bacteria 2109
74 Ga0070708_100272853 3300005445 Archaea 1591
75 Ga0070708_100445889 3300005445 Bacteria 1221
76 Ga0070708_100722539 3300005445 Bacteria 937
77 Ga0070708_101645219 3300005445 Unclassified 597
78 Ga0070708_102225838 3300005445 Archaea 506
79 Ga0070663_100396803 3300005455 Archaea 1127
80 Ga0070662_100026840 3300005457 Bacteria 3992
81 Ga0070662_100734424 3300005457 Archaea 837
82 Ga0070662_100889937 3300005457 Archaea 759
83 Ga0070681_10030325 3300005458 Bacteria 5426
84 Ga0070681_11578031 3300005458 Bacteria 581
85 Ga0068867_100019669 3300005459 Archaea 4810
86 Ga0068867_100050804 3300005459 Archaea 3057
87 Ga0068867_100198173 3300005459 Bacteria 1606
88 Ga0070706_100002656 3300005467 Bacteria 17913
89 Ga0070706_100101879 3300005467 Archaea 2668
90 Ga0070706_100172280 3300005467 Bacteria 2021
91 Ga0070706_100213710 3300005467 Bacteria 1800
92 Ga0070706_100310199 3300005467 Bacteria 1472
93 Ga0070707_100012946 3300005468 Bacteria 7794
94 Ga0070707_100018613 3300005468 Bacteria 6535
95 Ga0070707_100276020 3300005468 Archaea 1634
96 Ga0070707_100395777 3300005468 Bacteria 1341
97 Ga0070707_100533250 3300005468 Bacteria 1136
98 Ga0070698_100001367 3300005471 Bacteria 27160
99 Ga0070698_100004631 3300005471 Bacteria 15114
100 Ga0070698_100478019 3300005471 Archaea 1183
101 Ga0070698_100487888 3300005471 Bacteria 1169
102 Ga0070698_100559690 3300005471 Bacteria 1083
103 Ga0070698_100635473 3300005471 Bacteria 1008
104 Ga0070698_101278988 3300005471 Unclassified 683
105 Ga0070699_100003444 3300005518 Bacteria 13990
106 Ga0070699_100517446 3300005518 Unclassified 1085
107 Ga0070699_100775551 3300005518 Unclassified 877
108 Ga0070699_100868524 3300005518 Archaea 826
109 Ga0070679_100086901 3300005530 Bacteria 3114
110 Ga0070679_100283603 3300005530 Archaea 1608
111 Ga0070684_100603827 3300005535 Archaea 1020
112 Ga0070697_100000001 3300005536 Bacteria 662298
113 Ga0070697_100632309 3300005536 Archaea 942
114 Ga0070697_101845955 3300005536 Unclassified 541
115 Ga0068853_100067878 3300005539 Bacteria 3099
116 Ga0070672_100006602 3300005543 Archaea 7811
117 Ga0070672_100202423 3300005543 Archaea 1661
118 Ga0070686_101451426 3300005544 Archaea 577
119 Ga0070695_100223984 3300005545 Bacteria 1356
120 Ga0070695_100296557 3300005545 Archaea 1193
121 Ga0070695_101066446 3300005545 Unclassified 660
122 Ga0070696_100552743 3300005546 Archaea 923
123 Ga0070696_100647967 3300005546 Unclassified 856
124 Ga0070696_100732307 3300005546 Archaea 809
125 Ga0070693_100315971 3300005547 Archaea 1058
126 Ga0070704_100459917 3300005549 Archaea 1097
127 Ga0068855_100014049 3300005563 Bacteria 9652
128 Ga0068855_100069509 3300005563 Bacteria 4098
129 Ga0068855_100888351 3300005563 Bacteria 942
130 Ga0068857_100065097 3300005577 Bacteria 3241
131 Ga0068857_100209984 3300005577 Archaea 1776
132 Ga0068857_100631206 3300005577 Bacteria 1014
133 Ga0068857_100639198 3300005577 Unclassified 1008
134 Ga0068857_101109438 3300005577 Archaea 764
135 Ga0068854_101258258 3300005578 Archaea 665
136 Ga0068856_100129581 3300005614 Bacteria 2527
137 Ga0068856_102297578 3300005614 Bacteria 547
138 Ga0068852_100077947 3300005616 Archaea 2930
139 Ga0068852_101837998 3300005616 Unclassified 628
140 Ga0068859_100234716 3300005617 Archaea 1923
141 Ga0068859_100489792 3300005617 Archaea 1325
142 Ga0068859_102865510 3300005617 Unclassified 529
143 Ga0068864_100013556 3300005618 Archaea 6759
144 Ga0068861_101305040 3300005719 Archaea 706
145 Ga0068851_10296677 3300005834 Bacteria 928
146 Ga0068870_10065216 3300005840 Archaea 1969
147 Ga0068870_10153255 3300005840 Archaea 1359
148 Ga0068860_100603659 3300005843 Archaea 1103
149 Ga0068860_100653181 3300005843 Archaea 1060
150 Ga0068862_100069743 3300005844 Archaea 3034
151 Ga0068862_100145353 3300005844 Archaea 2107
152 Ga0081538_10069935 3300005981 Archaea 1941
153 Ga0081539_10254442 3300005985 Bacteria 778
154 Ga0070717_10158670 3300006028 Bacteria 1961
155 Ga0070717_11083123 3300006028 Bacteria 730
156 Ga0075365_10000397 3300006038 Bacteria 15949
157 Ga0075364_10001592 3300006051 Bacteria 12402
158 Ga0075364_10838917 3300006051 Unclassified 626
159 Ga0075432_10340866 3300006058 Archaea 633
160 Ga0070716_100173273 3300006173 Bacteria 1410
161 Ga0097621_100325126 3300006237 Archaea 1363
162 Ga0075428_100174761 3300006844 Archaea 2327
163 Ga0075428_100293865 3300006844 Bacteria 1747
164 Ga0075428_101665393 3300006844 Unclassified 666
165 Ga0075433_10259021 3300006852 Archaea 1542
166 Ga0075433_11005205 3300006852 Unclassified 726
167 Ga0075434_100048138 3300006871 Archaea 4231
168 Ga0075429_100744569 3300006880 Archaea 858
169 Ga0075429_100754159 3300006880 Archaea 853
170 Ga0068865_100417301 3300006881 Archaea 1103
171 Ga0075436_100058308 3300006914 Archaea 2666
172 Ga0097620_100234724 3300006931 Archaea 1923
173 Ga0097620_100489823 3300006931 Archaea 1325
174 Ga0105245_10166103 3300009098 Bacteria 2098
175 Ga0114129_10005807 3300009147 Archaea 17472
176 Ga0114129_10064747 3300009147 Archaea 5102
177 Ga0114129_10153541 3300009147 Bacteria 3150
178 Ga0114129_10242081 3300009147 Archaea 2425
179 Ga0114129_10271759 3300009147 Bacteria 2267
180 Ga0114129_10888519 3300009147 Archaea 1130
181 Ga0114129_10989770 3300009147 Unclassified 1060
182 Ga0114129_12470517 3300009147 Bacteria 621
183 Ga0105243_10011180 3300009148 Bacteria 6789
184 Ga0105241_10548818 3300009174 Bacteria 1037
185 Ga0105241_11041628 3300009174 Bacteria 767
186 Ga0105242_10021814 3300009176 Archaea 5033
187 Ga0105237_10649502 3300009545 Unclassified 1062
188 Ga0105249_10517857 3300009553 Archaea 1240
189 Ga0105249_12427593 3300009553 Archaea 597
190 Ga0105239_10594223 3300010375 Archaea 1262
191 Ga0105239_10681036 3300010375 Unclassified 1175
192 Ga0105239_11842797 3300010375 Unclassified 701
193 Ga0105239_13116256 3300010375 Bacteria 540
194 Ga0105246_10026473 3300011119 Archaea 3789
195 Ga0105246_10338772 3300011119 Archaea 1228
196 Ga0105246_10360005 3300011119 Archaea 1195
197 Ga0157340_1000524 3300012473 Archaea 1501
198 Ga0157336_1001260 3300012477 Archaea 1286
199 Ga0157337_1000262 3300012483 Archaea 2428
200 Ga0157341_1007661 3300012494 Archaea 865
201 Ga0157345_1001292 3300012498 Archaea 1765
202 Ga0157313_1000116 3300012503 Unclassified 3535
203 Ga0157316_1001849 3300012510 Archaea 1373
204 Ga0157338_1010696 3300012515 Archaea 931
205 Ga0157373_10040781 3300013100 Unclassified 3321
206 Ga0157373_10054985 3300013100 Unclassified 2828
207 Ga0157373_10349337 3300013100 Bacteria 1055
208 Ga0157371_10000561 3300013102 Bacteria 43999
209 Ga0157371_10142868 3300013102 Bacteria 1705
210 Ga0157371_10715996 3300013102 Bacteria 750
211 Ga0157370_10164386 3300013104 Bacteria 2064
212 Ga0157370_10356672 3300013104 Bacteria 1347
213 Ga0157369_10021418 3300013105 Bacteria 7232
214 Ga0157369_10412099 3300013105 Unclassified 1401
215 Ga0157369_11707508 3300013105 Bacteria 640
216 Ga0157378_10034192 3300013297 Archaea 4495
217 Ga0157378_10046095 3300013297 Archaea 3875
218 Ga0157372_10851186 3300013307 Bacteria 1059
219 Ga0157372_11097845 3300013307 Bacteria 920
220 Ga0157375_11421371 3300013308 Archaea 817
221 Ga0157375_11479925 3300013308 Archaea 801
222 Ga0157380_10095271 3300014326 Archaea 2466
223 Ga0157380_10492354 3300014326 Archaea 1189
224 Ga0209455_1001944 3300025272 Bacteria 8536
225 Ga0207682_10031172 3300025893 Archaea 2139
226 Ga0207642_10013096 3300025899 Archaea 3015
227 Ga0207642_10502493 3300025899 Archaea 742
228 Ga0207647_10017360 3300025904 Archaea 4892
229 Ga0207645_10006750 3300025907 Archaea 8197
230 Ga0207645_10012571 3300025907 Archaea 5741
231 Ga0207643_10002365 3300025908 Archaea 10252
232 Ga0207643_10017433 3300025908 Archaea 3927
233 Ga0207684_10001474 3300025910 Bacteria 25315
234 Ga0207684_10156955 3300025910 Bacteria 1958
235 Ga0207684_10172492 3300025910 Bacteria 1864
236 Ga0207684_10178415 3300025910 Archaea 1831
237 Ga0207684_10691065 3300025910 Unclassified 867
238 Ga0207707_10204196 3300025912 Archaea 1722
239 Ga0207707_11359494 3300025912 Unclassified 568
240 Ga0207660_10183704 3300025917 Unclassified 1625
241 Ga0207660_10232991 3300025917 Bacteria 1448
242 Ga0207660_10786452 3300025917 Archaea 776
243 Ga0207660_11186690 3300025917 Archaea 621
244 Ga0207662_10348527 3300025918 Archaea 994
245 Ga0207657_10031076 3300025919 Bacteria 4841
246 Ga0207657_11067201 3300025919 Bacteria 618
247 Ga0207657_11375039 3300025919 Archaea 531
248 Ga0207649_10253069 3300025920 Bacteria 1269
249 Ga0207652_10025915 3300025921 Bacteria 4878
250 Ga0207652_10223144 3300025921 Bacteria 1698
251 Ga0207652_10524150 3300025921 Archaea 1066
252 Ga0207646_10013844 3300025922 Bacteria 7693
253 Ga0207646_10042615 3300025922 Bacteria 4077
254 Ga0207646_10098531 3300025922 Unclassified 2619
255 Ga0207646_11064117 3300025922 Archaea 713
256 Ga0207681_10322683 3300025923 Archaea 1228
257 Ga0207681_10871403 3300025923 Archaea 753
258 Ga0207650_10013622 3300025925 Archaea 5635
259 Ga0207650_10064384 3300025925 Archaea 2744
260 Ga0207687_10854479 3300025927 Unclassified 778
261 Ga0207664_10893449 3300025929 Unclassified 798
262 Ga0207690_10220746 3300025932 Bacteria 1450
263 Ga0207690_10312737 3300025932 Archaea 1232
264 Ga0207690_11597232 3300025932 Unclassified 545
265 Ga0207706_10032443 3300025933 Archaea 4651
266 Ga0207709_10007272 3300025935 Bacteria 6175
267 Ga0207669_10941902 3300025937 Archaea 723
268 Ga0207704_10083022 3300025938 Archaea 2078
269 Ga0207704_10825998 3300025938 Archaea 775
270 Ga0207691_10028158 3300025940 Archaea 5263
271 Ga0207689_10016242 3300025942 Archaea 6306
272 Ga0207679_10054451 3300025945 Archaea 2945
273 Ga0207679_10356971 3300025945 Bacteria 1275
274 Ga0207667_10087767 3300025949 Bacteria 3217
275 Ga0207651_10111367 3300025960 Archaea 2055
276 Ga0207712_10261538 3300025961 Archaea 1404
277 Ga0207640_10010034 3300025981 Bacteria 5321
278 Ga0207640_10220196 3300025981 Archaea 1452
279 Ga0207677_10808971 3300026023 Archaea 839
280 Ga0207639_10878826 3300026041 Unclassified 837
281 Ga0207678_10385647 3300026067 Archaea 1212
282 Ga0207708_10022390 3300026075 Archaea 4772
283 Ga0207708_10147409 3300026075 Archaea 1850
284 Ga0207708_10646664 3300026075 Archaea 900
285 Ga0207702_12154554 3300026078 Bacteria 547
286 Ga0207648_10016887 3300026089 Archaea 6653
287 Ga0207648_10042357 3300026089 Archaea 3996
288 Ga0207676_10113290 3300026095 Archaea 2273
289 Ga0207674_10020812 3300026116 Bacteria 7080
290 Ga0207674_10028979 3300026116 Bacteria 5836
291 Ga0207674_10135805 3300026116 Archaea 2422
292 Ga0207675_100632627 3300026118 Archaea 1075
293 Ga0207683_10296026 3300026121 Archaea 1480
294 Ga0207683_10484002 3300026121 Archaea 1142
295 Ga0207698_10017033 3300026142 Archaea 4919
296 Ga0207698_11337972 3300026142 Unclassified 731
297 Ga0209973_1000801 3300027252 Archaea 2528
298 Ga0209967_1020207 3300027364 Archaea 970
299 Ga0209981_1026234 3300027378 Archaea 845
300 Ga0210000_1003097 3300027462 Archaea 2385
301 Ga0209995_1000182 3300027471 Archaea 10072
302 Ga0209995_1033242 3300027471 Archaea 866
303 Ga0209968_1000164 3300027526 Archaea 11612
304 Ga0209999_1002675 3300027543 Archaea 3150
305 Ga0209999_1019675 3300027543 Archaea 1238
306 Ga0209999_1073204 3300027543 Archaea 658
307 Ga0209982_1000463 3300027552 Archaea 4997
308 Ga0209970_1009869 3300027614 Archaea 1560
309 Ga0209983_1001356 3300027665 Archaea 5450
310 Ga0209971_1002213 3300027682 Archaea 4714
311 Ga0209966_1000520 3300027695 Archaea 9940
312 Ga0209974_10002674 3300027876 Archaea 6455
313 Ga0207428_10031641 3300027907 Archaea 4363
314 Ga0268265_10203701 3300028380 Archaea 1718
315 Ga0268265_10337788 3300028380 Archaea 1370
316 Ga0268264_10476546 3300028381 Archaea 1213
317 Ga0265319_1201378 3300028563 Bacteria 611
318 Ga0265318_10144146 3300028577 Bacteria 874
319 Ga0265322_10058072 3300028654 Bacteria 1097
320 Ga0265338_10433601 3300028800 Bacteria 932
321 Ga0314311_1180264 3300030733 Unclassified 558
322 Ga0316179_1003690 3300030734 Bacteria 927
323 Ga0265332_10148533 3300031238 Bacteria 981
324 Ga0265320_10102805 3300031240 Bacteria 1315
325 Ga0265339_10068463 3300031249 Bacteria 1897
326 Ga0265316_10010993 3300031344 Bacteria 8213
327 Ga0307408_100463707 3300031548 Bacteria 1102
328 Ga0265342_10156904 3300031712 Bacteria 1260
329 Ga0307405_10563663 3300031731 Bacteria 924
330 Ga0307413_11107950 3300031824 Bacteria 684
331 Ga0307413_11862547 3300031824 Bacteria 540
332 Ga0307410_10364153 3300031852 Bacteria 1159
333 Ga0307407_10351542 3300031903 Bacteria 1044
334 Ga0307409_100273991 3300031995 Bacteria 1556
335 Ga0307409_101204580 3300031995 Bacteria 781
336 Ga0307416_100458982 3300032002 Bacteria 1328
337 Ga0307414_11429522 3300032004 Bacteria 643
338 Ga0307411_10608253 3300032005 Bacteria 941
339 Ga0307415_100684685 3300032126 Bacteria 923
340 Ga0307415_101377680 3300032126 Bacteria 671
341 Ga0373947_0803261 3300035725 Unclassified 642
342 Ga0395899_0002439 3300037312 Bacteria 15118
343 Ga0395899_0048931 3300037312 Bacteria 3143
344 Ga0395899_0297830 3300037312 Bacteria 1092
345 Ga0395900_0015549 3300037418 Bacteria 7756
346 Ga0395900_0078098 3300037418 Bacteria 3401
347 Ga0395900_0134804 3300037418 Bacteria 2529
348 Ga0395898_0001404 3300037466 Bacteria 34348
349 Ga0395905_0039364 3300037471 Bacteria 4435
350 Ga0395905_0081911 3300037471 Bacteria 3024
351 Ga0395905_0131663 3300037471 Bacteria 2352
352 Ga0395901_0003763 3300038443 Bacteria 15291
353 Ga0395901_0021179 3300038443 Bacteria 6659
354 Ga0395901_0265330 3300038443 Unclassified 1786
355 Ga0395901_0578583 3300038443 Unclassified 1135
356 Ga0395901_1348362 3300038443 Bacteria 673
357 Ga0242420_000704 3300038996 Archaea 3994
358 Ga0451793_1131357 3300041452 Bacteria 1100
359 Ga0439443_008932 3300042003 Archaea 1426
360 Ga0439440_0009859 3300042993 Archaea 1985
361 Ga0451576_2666389 3300045051 Archaea 509
362 Ga0495613_0531288 3300046689 Bacteria 789
363 Ga0495675_0572735 3300047444 Bacteria 642
364 Ga0496102_0193893 3300048905 Bacteria 1915
365 Ga0496102_1781628 3300048905 Bacteria 533
366 Ga0496106_1138611 3300048909 Unclassified 610
367 Ga0496107_0146039 3300048910 Archaea 1749
368 Ga0496112_1306100 3300048915 Archaea 641
369 Ga0496115_0730645 3300048918 Unclassified 776
370 Ga0496121_0129682 3300048924 Bacteria 1890
371 Ga0496124_0252369 3300048927 Bacteria 1304
372 Ga0501033_0274920 3300049570 Bacteria 1190
373 Ga0501043_0052650 3300049579 Bacteria 3197
374 Ga0501047_0442695 3300049581 Bacteria 1129
375 Ga0501069_0089519 3300049585 Archaea 1740
376 Ga0501083_0127151 3300049744 Bacteria 1670
377 Ga0501044_0140625 3300049823 Bacteria 2403
378 nmdc:mga00v17_543968_c1 3300050491 Unclassified 751
379 nmdc:mga00v17_723_c1 3300050491 Bacteria 18023
380 nmdc:mga0yw44_127_c1 3300050492 Bacteria 26145
381 nmdc:mga05p37_14906_c1 3300050507 Archaea 9334
382 nmdc:mga05p37_344571_c1 3300050507 Bacteria 1756
383 nmdc:mga05p37_54717_c1 3300050507 Archaea 4909
384 nmdc:mga05p37_563393_c1 3300050507 Unclassified 1294
385 nmdc:mga05p37_670557_c1 3300050507 Archaea 1158
386 nmdc:mga09592_157948_c1 3300050508 Archaea 1958
387 nmdc:mga09592_525131_c1 3300050508 Unclassified 1018
388 nmdc:mga06r32_435152_c1 3300050510 Unclassified 1292
389 nmdc:mga06r32_610666_c1 3300050510 Archaea 1061
390 nmdc:mga08y16_163094_c1 3300050511 Archaea 2316
391 nmdc:mga08y16_245930_c1 3300050511 Archaea 1849
392 nmdc:mga0n895_100325_c1 3300050512 Archaea 2904
393 nmdc:mga08x19_24625_c1 3300050514 Archaea 3743
394 nmdc:mga0a205_1084529_c1 3300050515 Unclassified 648
395 nmdc:mga0a205_279868_c1 3300050515 Archaea 1544
396 Ga0495619_1012746 3300053085 Unclassified 555
397 Ga0500651_0258252 3300053093 Bacteria 1011
398 Ga0500562_000198 3300053108 Bacteria 16330
399 Ga0500559_0000192 3300053136 Bacteria 49223
400 Ga0500561_0000002 3300053137 Bacteria 394147
401 Ga0500645_019070 3300053730 Bacteria 2136
402 Ga0500661_014997 3300055283 Bacteria 1392
403 2644198216 2643221635 Bacteria 2632343
404 Ga0070680_100072664
405 SwRhRL3b_contig_2609502
406 SwRhRL3b_contig_378765
407 MRS1b_contig_6031450
408 2214828557
409 ARcpr5oldR_c000714
410 ARSoilYngRDRAFT_c00715
411 ARCol0yngRDRAFT_1000102
412 JGI24737J22298_10028520
413 JGI24033J26618_1006462
414 rootH1_10004557
415 rootH1_10077413
416 rootL2_10220025
417 rootL2_10279067
418 JGI26129J50193_1000420
419 JGI26145J50221_1000028
420 JGI26142J50222_100784
421 JGI26140J50224_101077
422 JGI26134J50242_100224
423 JGI26136J50244_100409
424 JGI26131J50246_100106
425 JGI26138J51218_100218
426 Ga0065716_1000223
427 Ga0065704_10631375
428 Ga0065712_10001104
429 Ga0065715_10126374
430 Ga0065715_10256125
431 Ga0065715_10768800
432 Ga0065707_10000638
433 Ga0070658_10031923
434 Ga0070676_10266664
435 Ga0070676_10680272
436 Ga0070670_100024010
437 Ga0070670_100215903
438 Ga0070670_101030808
439 Ga0070670_101409041
440 Ga0070677_10030635
441 Ga0068869_100015806
442 Ga0070680_100089619
443 Ga0070680_100153106
444 Ga0070680_100305252
445 Ga0070680_101522317
446 Ga0070682_100590255
447 Ga0070682_100805845
448 Ga0070660_100684287
449 Ga0070687_100952626
450 Ga0070687_100965406
451 Ga0070661_100244712
452 Ga0070661_100279848
453 Ga0070692_10120184
454 Ga0070668_100036975
455 Ga0070669_100262555
456 Ga0070669_100711579
457 Ga0070671_100982258
458 Ga0070674_100147685
459 Ga0070674_101617205
460 Ga0070673_100246124
461 Ga0070659_100075053
462 Ga0070659_101486574
463 Ga0070667_101040279
464 Ga0070701_10300538
465 Ga0070711_101381521
466 Ga0070705_100369414
467 Ga0070705_100506300
468 Ga0070705_101119675
469 Ga0070705_101392502
470 Ga0070705_101909531
471 Ga0070700_100257274
472 Ga0070694_100048022
473 Ga0070694_100545810
474 Ga0070694_100868691
475 Ga0070708_100158432
476 Ga0070708_100272853
477 Ga0070708_100445889
478 Ga0070708_100722539
479 Ga0070708_101645219
480 Ga0070708_102225838
481 Ga0070663_100396803
482 Ga0070662_100026840
483 Ga0070662_100734424
484 Ga0070662_100889937
485 Ga0070681_10030325
486 Ga0070681_11578031
487 Ga0068867_100019669
488 Ga0068867_100050804
489 Ga0068867_100198173
490 Ga0070706_100002656
491 Ga0070706_100101879
492 Ga0070706_100172280
493 Ga0070706_100213710
494 Ga0070706_100310199
495 Ga0070707_100012946
496 Ga0070707_100018613
497 Ga0070707_100276020
498 Ga0070707_100395777
499 Ga0070707_100533250
500 Ga0070698_100001367
501 Ga0070698_100004631
502 Ga0070698_100478019
503 Ga0070698_100487888
504 Ga0070698_100559690
505 Ga0070698_100635473
506 Ga0070698_101278988
507 Ga0070699_100003444
508 Ga0070699_100517446
509 Ga0070699_100775551
510 Ga0070699_100868524
511 Ga0070679_100086901
512 Ga0070679_100283603
513 Ga0070684_100603827
514 Ga0070697_100000001
515 Ga0070697_100632309
516 Ga0070697_101845955
517 Ga0068853_100067878
518 Ga0070672_100006602
519 Ga0070672_100202423
520 Ga0070686_101451426
521 Ga0070695_100223984
522 Ga0070695_100296557
523 Ga0070695_101066446
524 Ga0070696_100552743
525 Ga0070696_100647967
526 Ga0070696_100732307
527 Ga0070693_100315971
528 Ga0070704_100459917
529 Ga0068855_100014049
530 Ga0068855_100069509
531 Ga0068855_100888351
532 Ga0068857_100065097
533 Ga0068857_100209984
534 Ga0068857_100631206
535 Ga0068857_100639198
536 Ga0068857_101109438
537 Ga0068854_101258258
538 Ga0068856_100129581
539 Ga0068856_102297578
540 Ga0068852_100077947
541 Ga0068852_101837998
542 Ga0068859_100234716
543 Ga0068859_100489792
544 Ga0068859_102865510
545 Ga0068864_100013556
546 Ga0068861_101305040
547 Ga0068851_10296677
548 Ga0068870_10065216
549 Ga0068870_10153255
550 Ga0068860_100603659
551 Ga0068860_100653181
552 Ga0068862_100069743
553 Ga0068862_100145353
554 Ga0081538_10069935
555 Ga0081539_10254442
556 Ga0070717_10158670
557 Ga0070717_11083123
558 Ga0075365_10000397
559 Ga0075364_10001592
560 Ga0075364_10838917
561 Ga0075432_10340866
562 Ga0070716_100173273
563 Ga0097621_100325126
564 Ga0075428_100174761
565 Ga0075428_100293865
566 Ga0075428_101665393
567 Ga0075433_10259021
568 Ga0075433_11005205
569 Ga0075434_100048138
570 Ga0075429_100744569
571 Ga0075429_100754159
572 Ga0068865_100417301
573 Ga0075436_100058308
574 Ga0097620_100234724
575 Ga0097620_100489823
576 Ga0105245_10166103
577 Ga0114129_10005807
578 Ga0114129_10064747
579 Ga0114129_10153541
580 Ga0114129_10242081
581 Ga0114129_10271759
582 Ga0114129_10888519
583 Ga0114129_10989770
584 Ga0114129_12470517
585 Ga0105243_10011180
586 Ga0105241_10548818
587 Ga0105241_11041628
588 Ga0105242_10021814
589 Ga0105237_10649502
590 Ga0105249_10517857
591 Ga0105249_12427593
592 Ga0105239_10594223
593 Ga0105239_10681036
594 Ga0105239_11842797
595 Ga0105239_13116256
596 Ga0105246_10026473
597 Ga0105246_10338772
598 Ga0105246_10360005
599 Ga0157340_1000524
600 Ga0157336_1001260
601 Ga0157337_1000262
602 Ga0157341_1007661
603 Ga0157345_1001292
604 Ga0157313_1000116
605 Ga0157316_1001849
606 Ga0157338_1010696
607 Ga0157373_10040781
608 Ga0157373_10054985
609 Ga0157373_10349337
610 Ga0157371_10000561
611 Ga0157371_10142868
612 Ga0157371_10715996
613 Ga0157370_10164386
614 Ga0157370_10356672
615 Ga0157369_10021418
616 Ga0157369_10412099
617 Ga0157369_11707508
618 Ga0157378_10034192
619 Ga0157378_10046095
620 Ga0157372_10851186
621 Ga0157372_11097845
622 Ga0157375_11421371
623 Ga0157375_11479925
624 Ga0157380_10095271
625 Ga0157380_10492354
626 Ga0209455_1001944
627 Ga0207682_10031172
628 Ga0207642_10013096
629 Ga0207642_10502493
630 Ga0207647_10017360
631 Ga0207645_10006750
632 Ga0207645_10012571
633 Ga0207643_10002365
634 Ga0207643_10017433
635 Ga0207684_10001474
636 Ga0207684_10156955
637 Ga0207684_10172492
638 Ga0207684_10178415
639 Ga0207684_10691065
640 Ga0207707_10204196
641 Ga0207707_11359494
642 Ga0207660_10183704
643 Ga0207660_10232991
644 Ga0207660_10786452
645 Ga0207660_11186690
646 Ga0207662_10348527
647 Ga0207657_10031076
648 Ga0207657_11067201
649 Ga0207657_11375039
650 Ga0207649_10253069
651 Ga0207652_10025915
652 Ga0207652_10223144
653 Ga0207652_10524150
654 Ga0207646_10013844
655 Ga0207646_10042615
656 Ga0207646_10098531
657 Ga0207646_11064117
658 Ga0207681_10322683
659 Ga0207681_10871403
660 Ga0207650_10013622
661 Ga0207650_10064384
662 Ga0207687_10854479
663 Ga0207664_10893449
664 Ga0207690_10220746
665 Ga0207690_10312737
666 Ga0207690_11597232
667 Ga0207706_10032443
668 Ga0207709_10007272
669 Ga0207669_10941902
670 Ga0207704_10083022
671 Ga0207704_10825998
672 Ga0207691_10028158
673 Ga0207689_10016242
674 Ga0207679_10054451
675 Ga0207679_10356971
676 Ga0207667_10087767
677 Ga0207651_10111367
678 Ga0207712_10261538
679 Ga0207640_10010034
680 Ga0207640_10220196
681 Ga0207677_10808971
682 Ga0207639_10878826
683 Ga0207678_10385647
684 Ga0207708_10022390
685 Ga0207708_10147409
686 Ga0207708_10646664
687 Ga0207702_12154554
688 Ga0207648_10016887
689 Ga0207648_10042357
690 Ga0207676_10113290
691 Ga0207674_10020812
692 Ga0207674_10028979
693 Ga0207674_10135805
694 Ga0207675_100632627
695 Ga0207683_10296026
696 Ga0207683_10484002
697 Ga0207698_10017033
698 Ga0207698_11337972
699 Ga0209973_1000801
700 Ga0209967_1020207
701 Ga0209981_1026234
702 Ga0210000_1003097
703 Ga0209995_1000182
704 Ga0209995_1033242
705 Ga0209968_1000164
706 Ga0209999_1002675
707 Ga0209999_1019675
708 Ga0209999_1073204
709 Ga0209982_1000463
710 Ga0209970_1009869
711 Ga0209983_1001356
712 Ga0209971_1002213
713 Ga0209966_1000520
714 Ga0209974_10002674
715 Ga0207428_10031641
716 Ga0268265_10203701
717 Ga0268265_10337788
718 Ga0268264_10476546
719 Ga0265319_1201378
720 Ga0265318_10144146
721 Ga0265322_10058072
722 Ga0265338_10433601
723 Ga0314311_1180264
724 Ga0316179_1003690
725 Ga0265332_10148533
726 Ga0265320_10102805
727 Ga0265339_10068463
728 Ga0265316_10010993
729 Ga0307408_100463707
730 Ga0265342_10156904
731 Ga0307405_10563663
732 Ga0307413_11107950
733 Ga0307413_11862547
734 Ga0307410_10364153
735 Ga0307407_10351542
736 Ga0307409_100273991
737 Ga0307409_101204580
738 Ga0307416_100458982
739 Ga0307414_11429522
740 Ga0307411_10608253
741 Ga0307415_100684685
742 Ga0307415_101377680
743 Ga0373947_0803261
744 Ga0395899_0002439
745 Ga0395899_0048931
746 Ga0395899_0297830
747 Ga0395900_0015549
748 Ga0395900_0078098
749 Ga0395900_0134804
750 Ga0395898_0001404
751 Ga0395905_0039364
752 Ga0395905_0081911
753 Ga0395905_0131663
754 Ga0395901_0003763
755 Ga0395901_0021179
756 Ga0395901_0265330
757 Ga0395901_0578583
758 Ga0395901_1348362
759 Ga0242420_000704
760 Ga0451793_1131357
761 Ga0439443_008932
762 Ga0439440_0009859
763 Ga0451576_2666389
764 Ga0495613_0531288
765 Ga0495675_0572735
766 Ga0496102_0193893
767 Ga0496102_1781628
768 Ga0496106_1138611
769 Ga0496107_0146039
770 Ga0496112_1306100
771 Ga0496115_0730645
772 Ga0496121_0129682
773 Ga0496124_0252369
774 Ga0501033_0274920
775 Ga0501043_0052650
776 Ga0501047_0442695
777 Ga0501069_0089519
778 Ga0501083_0127151
779 Ga0501044_0140625
780 nmdc:mga00v17_543968_c1
781 nmdc:mga00v17_723_c1
782 nmdc:mga0yw44_127_c1
783 nmdc:mga05p37_14906_c1
784 nmdc:mga05p37_344571_c1
785 nmdc:mga05p37_54717_c1
786 nmdc:mga05p37_563393_c1
787 nmdc:mga05p37_670557_c1
788 nmdc:mga09592_157948_c1
789 nmdc:mga09592_525131_c1
790 nmdc:mga06r32_435152_c1
791 nmdc:mga06r32_610666_c1
792 nmdc:mga08y16_163094_c1
793 nmdc:mga08y16_245930_c1
794 nmdc:mga0n895_100325_c1
795 nmdc:mga08x19_24625_c1
796 nmdc:mga0a205_1084529_c1
797 nmdc:mga0a205_279868_c1
798 Ga0495619_1012746
799 Ga0500651_0258252
800 Ga0500562_000198
801 Ga0500559_0000192
802 Ga0500561_0000002
803 Ga0500645_019070
804 Ga0500661_014997
805 2644198216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7841 6 122
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7649 6 122
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7637 6 126
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7622 7 126
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7594 7 126
ID Description Score Start End Superfamily
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7673 10 55 3.30.720.120
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7644 63 126 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7638 7 55 3.30.720.120
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7591 6 126 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7556 9 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4R7EJ75-F1-model_v4 deleted 0.9808 4 126
AF-A0A1N7R5G9-F1-model_v4 VOC domain-containing protein 0.9774 2 126
AF-A0A495WKB7-F1-model_v4 deleted 0.972 6 124
AF-A0A1N7R5G9-F1-model_v4 VOC domain-containing protein 0.9623 2 126
AF-A0A3D5SN61-F1-model_v4 Glyoxalase 0.962 4 112

Map