F435076

General Info

Members Datasets Scaffolds Average Seq Length
402 242 394 345

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10392477|Ga0105243_103924771
Length 382
Sequence LSLGLIGTEIRPVYNALMTPRFAAAVCALLLGLATTHGQPQTGRQFQLVADGKGYKLEMKTVARPTPGPKQVLVRVRAVSLNQRDMAVTRGQYGGTGGGAMVGKVPLSDGAGEVVAVGSGATRFRVGDRVAGIFFARWIDGHRTADTLASARGGAGMDGMLSEFVAGDENGFVKIPDYLSFEEGATLPCTGVTAYRALFVEGRLKKGEFVLLEGTGGVSTFGLQFAAAAGARPIITSSSDDKIAKVKTMGAFGTVNYRTNPDWQKEVRKLTGDAGVDHVLEVGGRDTLPRALEALAYDGHIALIGGLSGFASDLPAGRLLGMGARVTGIYVGSRADFEAMNRFMIEHKIRPLIDKVFPFEESPQAFDLMDNGSYLGKIVIKL

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
3 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
4 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
237 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
242 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0.5
Rhizoplane 1.99
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10178630 3300003323 Bacteria 3290
2 Ga0065704_10074622 3300005289 Bacteria 6131
3 Ga0065707_10084107 3300005295 Bacteria 7681
4 Ga0070658_10002449 3300005327 Bacteria 15524
5 Ga0070676_10004357 3300005328 Bacteria 7436
6 Ga0070683_100165294 3300005329 Bacteria 2099
7 Ga0070683_100323699 3300005329 Bacteria 1467
8 Ga0070670_100007118 3300005331 Bacteria 9472
9 Ga0070670_100009785 3300005331 Bacteria 8188
10 Ga0068869_100020879 3300005334 Bacteria 4498
11 Ga0070666_10011800 3300005335 Bacteria 5493
12 Ga0070666_10027774 3300005335 Bacteria 3708
13 Ga0070680_100034364 3300005336 Bacteria 4088
14 Ga0070682_100014275 3300005337 Bacteria 4588
15 Ga0070682_100125408 3300005337 Bacteria 1729
16 Ga0068868_100024275 3300005338 Bacteria 4599
17 Ga0068868_100028688 3300005338 Bacteria 4257
18 Ga0070691_10041411 3300005341 Bacteria 2178
19 Ga0070687_100064186 3300005343 Unclassified 1950
20 Ga0070687_100076613 3300005343 Bacteria 1812
21 Ga0070661_100009397 3300005344 Bacteria 6766
22 Ga0070668_100006199 3300005347 Bacteria 8856
23 Ga0070669_100145334 3300005353 Unclassified 1832
24 Ga0070669_100176330 3300005353 Bacteria 1669
25 Ga0070675_100003673 3300005354 Bacteria 11664
26 Ga0070675_100030115 3300005354 Bacteria 4379
27 Ga0070671_100001163 3300005355 Bacteria 19618
28 Ga0070671_100143452 3300005355 Bacteria 2016
29 Ga0070673_100003826 3300005364 Bacteria 9441
30 Ga0070673_100028400 3300005364 Bacteria 4160
31 Ga0070688_100046830 3300005365 Unclassified 2679
32 Ga0070667_100015957 3300005367 Bacteria 6215
33 Ga0070667_100017935 3300005367 Bacteria 5867
34 Ga0070714_100271350 3300005435 Unclassified 1573
35 Ga0070713_100052044 3300005436 Unclassified 3389
36 Ga0070713_100082912 3300005436 Bacteria 2740
37 Ga0070701_10026504 3300005438 Bacteria 2827
38 Ga0070700_100060139 3300005441 Bacteria 2394
39 Ga0070663_100000420 3300005455 Bacteria 22378
40 Ga0070678_100093216 3300005456 Bacteria 2316
41 Ga0070681_10016203 3300005458 Bacteria 7432
42 Ga0070681_10283569 3300005458 Unclassified 1567
43 Ga0068867_100029873 3300005459 Bacteria 3929
44 Ga0068867_100147622 3300005459 Bacteria 1844
45 Ga0070685_10013788 3300005466 Bacteria 4272
46 Ga0070706_100118216 3300005467 Bacteria 2469
47 Ga0070699_100114901 3300005518 Bacteria 2365
48 Ga0070679_100003262 3300005530 Bacteria 14834
49 Ga0070679_100056130 3300005530 Bacteria 3924
50 Ga0070684_100025007 3300005535 Bacteria 5014
51 Ga0070684_100027996 3300005535 Bacteria 4764
52 Ga0068853_100292222 3300005539 Bacteria 1504
53 Ga0070672_100006726 3300005543 Bacteria 7753
54 Ga0070686_100053460 3300005544 Bacteria 2579
55 Ga0070686_100155790 3300005544 Unclassified 1604
56 Ga0070695_100080439 3300005545 Unclassified 2154
57 Ga0070665_100000011 3300005548 Bacteria 525539
58 Ga0070665_100011449 3300005548 Bacteria 8968
59 Ga0068855_100062305 3300005563 Bacteria 4354
60 Ga0068855_100101599 3300005563 Bacteria 3310
61 Ga0068855_100238462 3300005563 Bacteria 2033
62 Ga0070664_100005933 3300005564 Bacteria 9866
63 Ga0070664_100009134 3300005564 Bacteria 8047
64 Ga0068857_100011738 3300005577 Bacteria 7617
65 Ga0068856_100115516 3300005614 Unclassified 2684
66 Ga0068856_100167904 3300005614 Bacteria 2205
67 Ga0068852_100070194 3300005616 Unclassified 3073
68 Ga0068859_100028312 3300005617 Bacteria 5617
69 Ga0068859_100064104 3300005617 Bacteria 3707
70 Ga0068859_100136487 3300005617 Bacteria 2526
71 Ga0068864_100009570 3300005618 Bacteria 7991
72 Ga0068864_100028054 3300005618 Bacteria 4757
73 Ga0068861_100020458 3300005719 Bacteria 4741
74 Ga0068851_10025491 3300005834 Bacteria 2901
75 Ga0068863_100000534 3300005841 Bacteria 38896
76 Ga0068863_100016027 3300005841 Bacteria 7188
77 Ga0068863_100024156 3300005841 Bacteria 5799
78 Ga0068863_100087985 3300005841 Bacteria 2944
79 Ga0068863_100252727 3300005841 Bacteria 1703
80 Ga0068858_100004105 3300005842 Bacteria 14344
81 Ga0068858_100012417 3300005842 Bacteria 8031
82 Ga0068858_100133088 3300005842 Bacteria 2332
83 Ga0068860_100011410 3300005843 Bacteria 8755
84 Ga0068860_100017992 3300005843 Bacteria 6883
85 Ga0068860_100035517 3300005843 Bacteria 4780
86 Ga0068860_100092238 3300005843 Bacteria 2886
87 Ga0068860_100227261 3300005843 Bacteria 1813
88 Ga0068862_100092857 3300005844 Bacteria 2631
89 Ga0070717_10011440 3300006028 Bacteria 6740
90 Ga0097621_100016251 3300006237 Bacteria 5620
91 Ga0097621_100023244 3300006237 Bacteria 4822
92 Ga0068871_100007824 3300006358 Bacteria 7657
93 Ga0068871_100137901 3300006358 Unclassified 2073
94 Ga0068871_100163797 3300006358 Bacteria 1903
95 Ga0075428_100073369 3300006844 Unclassified 3737
96 Ga0075428_100195025 3300006844 Bacteria 2190
97 Ga0075430_100083304 3300006846 Bacteria 2679
98 Ga0075431_100001583 3300006847 Bacteria 21166
99 Ga0075433_10134226 3300006852 Bacteria 2200
100 Ga0075433_10170934 3300006852 Bacteria 1934
101 Ga0075434_100059280 3300006871 Bacteria 3805
102 Ga0075429_100083241 3300006880 Bacteria 2789
103 Ga0075429_100224735 3300006880 Unclassified 1644
104 Ga0075429_100306632 3300006880 Unclassified 1390
105 Ga0068865_100328484 3300006881 Bacteria 1232
106 Ga0097620_100028312 3300006931 Bacteria 5617
107 Ga0097620_100064103 3300006931 Bacteria 3707
108 Ga0097620_100136486 3300006931 Bacteria 2526
109 Ga0079104_1000014 3300006946 Bacteria 337362
110 Ga0099795_10049613 3300007788 Bacteria 1524
111 Ga0105244_10000055 3300009036 Bacteria 130164
112 Ga0105240_10003389 3300009093 Bacteria 24780
113 Ga0105240_10018292 3300009093 Bacteria 9419
114 Ga0105240_10040549 3300009093 Bacteria 5953
115 Ga0105240_10044875 3300009093 Bacteria 5612
116 Ga0105240_10140105 3300009093 Unclassified 2892
117 Ga0105240_10198532 3300009093 Bacteria 2353
118 Ga0105240_10269282 3300009093 Bacteria 1962
119 Ga0111539_10000509 3300009094 Bacteria 49359
120 Ga0111539_10011819 3300009094 Bacteria 10944
121 Ga0111539_10087531 3300009094 Bacteria 3659
122 Ga0111539_10373537 3300009094 Bacteria 1660
123 Ga0105245_10010745 3300009098 Bacteria 7965
124 Ga0105245_10018954 3300009098 Bacteria 6023
125 Ga0105245_10033146 3300009098 Bacteria 4576
126 Ga0105245_10040767 3300009098 Bacteria 4138
127 Ga0105247_10012697 3300009101 Bacteria 5054
128 Ga0114129_10670634 3300009147 Unclassified 1336
129 Ga0105243_10392477 3300009148 Bacteria 1287
130 Ga0105241_10020485 3300009174 Bacteria 4885
131 Ga0105242_10024635 3300009176 Bacteria 4754
132 Ga0105248_10011812 3300009177 Bacteria 9634
133 Ga0105248_10023511 3300009177 Bacteria 6845
134 Ga0105248_10578338 3300009177 Bacteria 1267
135 Ga0105237_10027328 3300009545 Bacteria 5826
136 Ga0105238_10025114 3300009551 Bacteria 6072
137 Ga0105238_10031325 3300009551 Bacteria 5413
138 Ga0105238_10060678 3300009551 Unclassified 3786
139 Ga0105238_10078149 3300009551 Bacteria 3300
140 Ga0105238_10165677 3300009551 Bacteria 2186
141 Ga0105238_10257244 3300009551 Bacteria 1725
142 Ga0105239_10019163 3300010375 Bacteria 7560
143 Ga0105239_10073142 3300010375 Bacteria 3768
144 Ga0105239_10374517 3300010375 Bacteria 1609
145 Ga0105239_10399075 3300010375 Bacteria 1556
146 Ga0105246_10003339 3300011119 Bacteria 9708
147 Ga0157370_10013344 3300013104 Bacteria 8463
148 Ga0157369_10034038 3300013105 Bacteria 5595
149 Ga0157369_10045232 3300013105 Bacteria 4789
150 Ga0157369_10064276 3300013105 Bacteria 3952
151 Ga0157374_10016788 3300013296 Bacteria 6441
152 Ga0163162_10016185 3300013306 Bacteria 7293
153 Ga0163162_10119234 3300013306 Bacteria 2741
154 Ga0157372_10028281 3300013307 Bacteria 6119
155 Ga0157372_10218635 3300013307 Bacteria 2208
156 Ga0157372_10288627 3300013307 Unclassified 1908
157 Ga0157375_10010310 3300013308 Bacteria 8225
158 Ga0163163_10006452 3300014325 Bacteria 10260
159 Ga0163163_10014187 3300014325 Bacteria 7318
160 Ga0163163_10019887 3300014325 Bacteria 6314
161 Ga0163163_10239767 3300014325 Bacteria 1863
162 Ga0157380_10002109 3300014326 Bacteria 13335
163 Ga0157380_10152912 3300014326 Bacteria 1997
164 Ga0157379_10010874 3300014968 Bacteria 7932
165 Ga0157379_10031297 3300014968 Bacteria 4739
166 Ga0209025_1006935 3300025294 Bacteria 8620
167 Ga0209050_1025558 3300025298 Bacteria 2002
168 Ga0207697_10045680 3300025315 Bacteria 1803
169 Ga0207656_10016079 3300025321 Bacteria 2907
170 Ga0207655_1000004 3300025728 Bacteria 1021221
171 Ga0207682_10033296 3300025893 Bacteria 2074
172 Ga0207680_10015649 3300025903 Bacteria 3965
173 Ga0207643_10073591 3300025908 Bacteria 1970
174 Ga0207705_10000890 3300025909 Bacteria 24460
175 Ga0207684_10113865 3300025910 Bacteria 2316
176 Ga0207707_10058583 3300025912 Bacteria 3352
177 Ga0207695_10039731 3300025913 Bacteria 5054
178 Ga0207695_10055995 3300025913 Bacteria 4106
179 Ga0207695_10094912 3300025913 Bacteria 2989
180 Ga0207671_10016410 3300025914 Bacteria 5757
181 Ga0207671_10038320 3300025914 Bacteria 3552
182 Ga0207662_10083283 3300025918 Unclassified 1955
183 Ga0207662_10149119 3300025918 Bacteria 1486
184 Ga0207662_10168126 3300025918 Bacteria 1405
185 Ga0207649_10018164 3300025920 Bacteria 3994
186 Ga0207652_10070036 3300025921 Bacteria 3046
187 Ga0207652_10076496 3300025921 Unclassified 2919
188 Ga0207652_10083918 3300025921 Bacteria 2790
189 Ga0207694_10015983 3300025924 Bacteria 5664
190 Ga0207694_10018700 3300025924 Bacteria 5237
191 Ga0207694_10026609 3300025924 Bacteria 4402
192 Ga0207694_10154515 3300025924 Bacteria 1850
193 Ga0207694_10197209 3300025924 Bacteria 1637
194 Ga0207650_10005888 3300025925 Bacteria 8368
195 Ga0207650_10016546 3300025925 Bacteria 5158
196 Ga0207659_10007137 3300025926 Bacteria 6858
197 Ga0207659_10010426 3300025926 Bacteria 5841
198 Ga0207687_10006980 3300025927 Bacteria 7440
199 Ga0207687_10017055 3300025927 Bacteria 4774
200 Ga0207687_10167585 3300025927 Bacteria 1691
201 Ga0207700_10013828 3300025928 Bacteria 5268
202 Ga0207700_10262126 3300025928 Bacteria 1480
203 Ga0207644_10119094 3300025931 Bacteria 2007
204 Ga0207686_10017266 3300025934 Bacteria 4064
205 Ga0207686_10120443 3300025934 Bacteria 1785
206 Ga0207686_10150362 3300025934 Bacteria 1620
207 Ga0207686_10164085 3300025934 Bacteria 1560
208 Ga0207670_10111157 3300025936 Bacteria 1975
209 Ga0207704_10101111 3300025938 Bacteria 1922
210 Ga0207704_10107606 3300025938 Bacteria 1876
211 Ga0207691_10010581 3300025940 Bacteria 8849
212 Ga0207691_10015959 3300025940 Bacteria 7135
213 Ga0207691_10178136 3300025940 Bacteria 1858
214 Ga0207711_10014014 3300025941 Bacteria 6660
215 Ga0207711_10450733 3300025941 Bacteria 1198
216 Ga0207689_10088654 3300025942 Bacteria 2541
217 Ga0207679_10028937 3300025945 Bacteria 3852
218 Ga0207679_10041387 3300025945 Bacteria 3304
219 Ga0207667_10022329 3300025949 Bacteria 6992
220 Ga0207667_10046106 3300025949 Bacteria 4615
221 Ga0207667_10202184 3300025949 Bacteria 2038
222 Ga0207667_10247172 3300025949 Bacteria 1825
223 Ga0207667_10313124 3300025949 Bacteria 1603
224 Ga0207651_10063710 3300025960 Bacteria 2576
225 Ga0207651_10069635 3300025960 Bacteria 2485
226 Ga0207668_10051590 3300025972 Bacteria 2841
227 Ga0207668_10379410 3300025972 Bacteria 1190
228 Ga0207658_10021249 3300025986 Bacteria 4503
229 Ga0207703_10037117 3300026035 Bacteria 3881
230 Ga0207703_10038475 3300026035 Bacteria 3817
231 Ga0207639_10037317 3300026041 Bacteria 3609
232 Ga0207678_10000514 3300026067 Bacteria 35082
233 Ga0207678_10021134 3300026067 Bacteria 5704
234 Ga0207678_10163485 3300026067 Bacteria 1901
235 Ga0207708_10004413 3300026075 Bacteria 10368
236 Ga0207708_10236397 3300026075 Unclassified 1468
237 Ga0207641_10000047 3300026088 Bacteria 179977
238 Ga0207641_10034421 3300026088 Bacteria 4214
239 Ga0207641_10068714 3300026088 Unclassified 3038
240 Ga0207641_10142261 3300026088 Bacteria 2166
241 Ga0207641_10194427 3300026088 Bacteria 1866
242 Ga0207648_10000163 3300026089 Bacteria 68352
243 Ga0207648_10007528 3300026089 Bacteria 10690
244 Ga0207648_10020631 3300026089 Bacteria 5932
245 Ga0207648_10160874 3300026089 Bacteria 1983
246 Ga0207676_10003712 3300026095 Bacteria 10798
247 Ga0207676_10007400 3300026095 Bacteria 7786
248 Ga0207676_10108145 3300026095 Bacteria 2321
249 Ga0207674_10013533 3300026116 Bacteria 9045
250 Ga0207674_10118700 3300026116 Bacteria 2615
251 Ga0207675_100243305 3300026118 Bacteria 1739
252 Ga0207683_10135940 3300026121 Unclassified 2213
253 Ga0209281_1000032 3300027111 Bacteria 401727
254 Ga0207428_10000236 3300027907 Bacteria 75764
255 Ga0207428_10013853 3300027907 Bacteria 7025
256 Ga0268266_10000063 3300028379 Bacteria 253339
257 Ga0268266_10002110 3300028379 Bacteria 21956
258 Ga0268265_10145558 3300028380 Bacteria 1990
259 Ga0268264_10104480 3300028381 Bacteria 2469
260 Ga0268264_10185733 3300028381 Bacteria 1891
261 Ga0268264_10259479 3300028381 Bacteria 1618
262 Ga0265334_10051338 3300028573 Bacteria 1581
263 Ga0265338_10003114 3300028800 Bacteria 23744
264 Ga0265338_10013194 3300028800 Bacteria 9351
265 Ga0265338_10193483 3300028800 Bacteria 1539
266 Ga0265320_10026255 3300031240 Bacteria 3051
267 Ga0307509_10000177 3300031507 Bacteria 100248
268 Ga0307509_10019902 3300031507 Bacteria 7634
269 Ga0307408_100003770 3300031548 Bacteria 10322
270 Ga0265314_10000723 3300031711 Bacteria 39953
271 Ga0307405_10272463 3300031731 Bacteria 1270
272 Ga0307410_10004781 3300031852 Bacteria 7067
273 Ga0307410_10017215 3300031852 Bacteria 4334
274 Ga0307412_10006138 3300031911 Bacteria 6771
275 Ga0307409_100148699 3300031995 Bacteria 2030
276 Ga0307416_100011157 3300032002 Bacteria 5975
277 Ga0307414_10003031 3300032004 Bacteria 8906
278 Ga0307411_10001140 3300032005 Bacteria 10411
279 Ga0307411_10002736 3300032005 Bacteria 7919
280 Ga0307411_10004799 3300032005 Bacteria 6550
281 Ga0307411_10007613 3300032005 Bacteria 5539
282 Ga0307411_10053099 3300032005 Bacteria 2653
283 Ga0307507_10135975 3300033179 Bacteria 1903
284 Ga0373923_0017209 3300035111 Bacteria 2761
285 Ga0373923_0089820 3300035111 Bacteria 1342
286 Ga0373954_0108064 3300035118 Bacteria 1345
287 Ga0373935_0044718 3300035692 Bacteria 2792
288 Ga0373947_0013053 3300035725 Bacteria 4763
289 Ga0373937_0000854 3300036401 Bacteria 26110
290 Ga0373937_0039412 3300036401 Bacteria 4306
291 Ga0373937_0085911 3300036401 Bacteria 2911
292 Ga0373937_0214270 3300036401 Bacteria 1812
293 Ga0373937_0439307 3300036401 Unclassified 1239
294 Ga0373937_0570391 3300036401 Unclassified 1075
295 Ga0373925_0316642 3300037068 Bacteria 1262
296 Ga0395898_0002294 3300037466 Bacteria 22975
297 Ga0436365_0439305 3300039437 Bacteria 1356
298 Ga0436363_0069527 3300039450 Bacteria 3132
299 Ga0439462_0014781 3300042015 Bacteria 2008
300 Ga0450898_017538 3300042134 Bacteria 1232
301 Ga0439434_0003730 3300042435 Bacteria 4450
302 Ga0439435_0000942 3300042436 Bacteria 5058
303 Ga0466969_0006141 3300044656 Bacteria 6396
304 Ga0466972_0038922 3300044658 Bacteria 2322
305 Ga0453683_0000336 3300044673 Bacteria 57199
306 Ga0466965_0171467 3300044683 Bacteria 1142
307 Ga0466966_0028225 3300044684 Bacteria 3657
308 Ga0466968_0089647 3300044735 Bacteria 1361
309 Ga0466970_0070616 3300044765 Bacteria 1878
310 Ga0466957_0142732 3300044842 Bacteria 1544
311 Ga0466959_0006916 3300045049 Bacteria 7923
312 Ga0451576_0058363 3300045051 Bacteria 4033
313 Ga0495592_0074702 3300046454 Bacteria 2462
314 Ga0495651_0000170 3300046462 Bacteria 48007
315 Ga0495651_0004635 3300046462 Bacteria 10513
316 Ga0495651_0010586 3300046462 Bacteria 7091
317 Ga0495653_0004599 3300046463 Bacteria 11160
318 Ga0495653_0006517 3300046463 Bacteria 9579
319 Ga0495650_0045592 3300046471 Unclassified 1845
320 Ga0495580_0160967 3300046472 Unclassified 1553
321 Ga0495664_0020007 3300046477 Unclassified 3856
322 Ga0495664_0049118 3300046477 Bacteria 2505
323 Ga0495608_0039297 3300046511 Unclassified 3172
324 Ga0495608_0101927 3300046511 Unclassified 1850
325 Ga0495618_0003670 3300046514 Bacteria 9518
326 Ga0495628_0007934 3300046516 Bacteria 9147
327 Ga0495628_0136369 3300046516 Unclassified 1875
328 Ga0495630_0041509 3300046517 Unclassified 3435
329 Ga0495643_0003908 3300046522 Bacteria 10693
330 Ga0495642_0018441 3300046528 Bacteria 2732
331 Ga0495652_0007088 3300046529 Bacteria 10346
332 Ga0495652_0009036 3300046529 Bacteria 9066
333 Ga0495640_0150790 3300046533 Bacteria 1494
334 Ga0495586_0012021 3300046535 Bacteria 4598
335 Ga0495587_0000436 3300046536 Bacteria 29259
336 Ga0495645_0046580 3300046543 Bacteria 3160
337 Ga0495645_0057765 3300046543 Unclassified 2815
338 Ga0495633_0025796 3300046558 Bacteria 2891
339 Ga0495667_0000964 3300046559 Bacteria 18622
340 Ga0495667_0006587 3300046559 Bacteria 7884
341 Ga0495635_0094015 3300046663 Unclassified 2050
342 Ga0495635_0192767 3300046663 Unclassified 1383
343 Ga0495657_0004381 3300046675 Bacteria 11265
344 Ga0495657_0020238 3300046675 Bacteria 4786
345 Ga0495599_0019438 3300046678 Unclassified 4234
346 Ga0495623_0009634 3300046679 Bacteria 6270
347 Ga0495624_0033200 3300046690 Bacteria 3343
348 Ga0495671_0014646 3300046692 Bacteria 4215
349 Ga0495600_0005825 3300046809 Bacteria 7450
350 Ga0495600_0014915 3300046809 Bacteria 4905
351 Ga0495604_0000750 3300047317 Bacteria 27284
352 Ga0495674_0001869 3300047319 Bacteria 20745
353 Ga0495680_0002401 3300047322 Bacteria 19217
354 Ga0495675_0000237 3300047444 Bacteria 39871
355 Ga0495675_0008651 3300047444 Bacteria 6313
356 Ga0495684_0004533 3300047471 Bacteria 10853
357 Ga0495602_0034103 3300048088 Bacteria 4766
358 Ga0495602_0060138 3300048088 Unclassified 3313
359 Ga0495614_0000732 3300048089 Bacteria 13880
360 Ga0495615_0003905 3300048090 Bacteria 2546
361 Ga0496100_0061807 3300048903 Bacteria 2469
362 Ga0496105_0316056 3300048908 Bacteria 1253
363 Ga0496106_0108454 3300048909 Unclassified 2160
364 Ga0496109_0101518 3300048912 Unclassified 2670
365 Ga0496112_0021098 3300048915 Bacteria 6188
366 Ga0496113_0077150 3300048916 Unclassified 2547
367 Ga0496114_0004968 3300048917 Bacteria 10372
368 Ga0496114_0419139 3300048917 Bacteria 1186
369 Ga0496119_0001382 3300048922 Bacteria 29525
370 Ga0496120_0000197 3300048923 Bacteria 103378
371 Ga0496120_0013276 3300048923 Bacteria 5555
372 Ga0496121_0057500 3300048924 Bacteria 3223
373 Ga0496121_0172523 3300048924 Bacteria 1569
374 Ga0501034_0007394 3300049571 Bacteria 11698
375 Ga0501034_0067714 3300049571 Bacteria 3582
376 Ga0501036_0179037 3300049572 Bacteria 1785
377 Ga0501038_0183775 3300049574 Bacteria 1686
378 Ga0501042_0155245 3300049578 Unclassified 1651
379 nmdc:mga09592_284218_c1 3300050508 Unclassified 1435
380 nmdc:mga0qj67_64595_c1 3300050509 Bacteria 2912
381 nmdc:mga08y16_17995_c1 3300050511 Bacteria 7443
382 nmdc:mga08y16_243098_c1 3300050511 Bacteria 1860
383 nmdc:mga08y16_464627_c1 3300050511 Bacteria 1289
384 nmdc:mga08y16_51555_c1 3300050511 Unclassified 4305
385 nmdc:mga0a205_185375_c1 3300050515 Bacteria 1974
386 nmdc:mga0a205_475508_c1 3300050515 Bacteria 1108
387 Ga0500643_003430 3300053087 Bacteria 7640
388 Ga0500641_0066899 3300053096 Bacteria 1505
389 Ga0500608_002331 3300053122 Bacteria 6892
390 Ga0500573_0177332 3300053140 Bacteria 1148
391 Ga0500585_011589 3300053144 Bacteria 2615
392 Ga0500616_0001042 3300053153 Bacteria 29312
393 Ga0500627_0027533 3300053158 Bacteria 2353
394 Ga0500637_0085766 3300053178 Bacteria 1821

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10041411 Ga0070691_100414113 282
2 3300005545 Ga0070695_100080439 Ga0070695_1000804392 282
3 3300005617 Ga0068859_100064104 Ga0068859_1000641042 282
4 3300006844 Ga0075428_100073369 Ga0075428_1000733692 282
5 3300006880 Ga0075429_100306632 Ga0075429_1003066322 282
6 3300006931 Ga0097620_100064103 Ga0097620_1000641034 282
7 3300009094 Ga0111539_10087531 Ga0111539_100875313 282
8 3300009147 Ga0114129_10670634 Ga0114129_106706341 282
9 3300026089 Ga0207648_10160874 Ga0207648_101608742 282
10 3300028380 Ga0268265_10145558 Ga0268265_101455583 282
11 3300046472 Ga0495580_0160967 Ga0495580_0160967_638_1516 282
12 3300046663 Ga0495635_0192767 Ga0495635_0192767_483_1361 282
13 3300050508 nmdc:mga09592_284218_c1 nmdc:mga09592_284218_c1_182_1246 282
14 3300050511 nmdc:mga08y16_51555_c1 nmdc:mga08y16_51555_c1_2798_3862 282
15 3300006852 Ga0075433_10170934 Ga0075433_101709342 283
16 3300050515 nmdc:mga0a205_185375_c1 nmdc:mga0a205_185375_c1_174_1271 283
17 3300005544 Ga0070686_100155790 Ga0070686_1001557901 292
18 3300010375 Ga0105239_10073142 Ga0105239_100731423 292
19 3300037068 Ga0373925_0316642 Ga0373925_0316642_38_949 292
20 3300005331 Ga0070670_100009785 Ga0070670_1000097855 295
21 3300005335 Ga0070666_10011800 Ga0070666_100118003 295
22 3300005338 Ga0068868_100024275 Ga0068868_1000242755 295
23 3300005343 Ga0070687_100064186 Ga0070687_1000641862 295
24 3300005344 Ga0070661_100009397 Ga0070661_1000093975 295
25 3300005355 Ga0070671_100001163 Ga0070671_1000011638 295
26 3300005367 Ga0070667_100017935 Ga0070667_1000179355 295
27 3300005535 Ga0070684_100027996 Ga0070684_1000279964 295
28 3300005564 Ga0070664_100009134 Ga0070664_1000091345 295
29 3300005614 Ga0068856_100115516 Ga0068856_1001155163 295
30 3300005616 Ga0068852_100070194 Ga0068852_1000701943 295
31 3300005617 Ga0068859_100028312 Ga0068859_1000283123 295
32 3300005618 Ga0068864_100009570 Ga0068864_1000095706 295
33 3300005841 Ga0068863_100016027 Ga0068863_1000160276 295
34 3300005842 Ga0068858_100004105 Ga0068858_10000410514 295
35 3300006358 Ga0068871_100137901 Ga0068871_1001379012 295
36 3300006931 Ga0097620_100028312 Ga0097620_1000283123 295
37 3300009093 Ga0105240_10140105 Ga0105240_101401053 295
38 3300009101 Ga0105247_10012697 Ga0105247_100126975 295
39 3300011119 Ga0105246_10003339 Ga0105246_100033394 295
40 3300013296 Ga0157374_10016788 Ga0157374_100167886 295
41 3300013306 Ga0163162_10016185 Ga0163162_100161855 295
42 3300013308 Ga0157375_10010310 Ga0157375_100103103 295
43 3300014968 Ga0157379_10010874 Ga0157379_100108743 295
44 3300025918 Ga0207662_10083283 Ga0207662_100832831 295
45 3300025920 Ga0207649_10018164 Ga0207649_100181643 295
46 3300025927 Ga0207687_10017055 Ga0207687_100170553 295
47 3300025945 Ga0207679_10028937 Ga0207679_100289373 295
48 3300026088 Ga0207641_10068714 Ga0207641_100687142 295
49 3300026095 Ga0207676_10003712 Ga0207676_100037122 295
50 3300045051 Ga0451576_0058363 Ga0451576_0058363_283_1356 295
51 3300048912 Ga0496109_0101518 Ga0496109_0101518_1424_2497 295
52 3300048915 Ga0496112_0021098 Ga0496112_0021098_402_1475 295
53 3300048916 Ga0496113_0077150 Ga0496113_0077150_1135_2208 295
54 3300005843 Ga0068860_100035517 Ga0068860_1000355172 296
55 3300009098 Ga0105245_10033146 Ga0105245_100331465 296
56 3300009551 Ga0105238_10060678 Ga0105238_100606783 296
57 3300046533 Ga0495640_0150790 Ga0495640_0150790_546_1469 296
58 3300048903 Ga0496100_0061807 Ga0496100_0061807_787_1860 296
59 3300048908 Ga0496105_0316056 Ga0496105_0316056_32_1105 296
60 3300048909 Ga0496106_0108454 Ga0496106_0108454_805_1878 296
61 3300048917 Ga0496114_0004968 Ga0496114_0004968_145_1218 296
62 3300036401 Ga0373937_0439307 Ga0373937_0439307_291_1214 298
63 3300053096 Ga0500641_0066899 Ga0500641_0066899_285_1307 308
64 3300014326 Ga0157380_10002109 Ga0157380_1000210911 309
65 3300031240 Ga0265320_10026255 Ga0265320_100262551 309
66 3300039450 Ga0436363_0069527 Ga0436363_0069527_1578_2582 310
67 3300006847 Ga0075431_100001583 Ga0075431_1000015834 311
68 3300006880 Ga0075429_100083241 Ga0075429_1000832415 311
69 3300036401 Ga0373937_0039412 Ga0373937_0039412_1108_2226 312
70 3300046543 Ga0495645_0057765 Ga0495645_0057765_1816_2784 312
71 3300048923 Ga0496120_0013276 Ga0496120_0013276_724_1695 312
72 3300005455 Ga0070663_100000420 Ga0070663_1000004205 313
73 3300026067 Ga0207678_10000514 Ga0207678_1000051414 313
74 3300005347 Ga0070668_100006199 Ga0070668_1000061996 314
75 3300025972 Ga0207668_10379410 Ga0207668_103794101 314
76 iso_pu_bacteria 8003314358 8003320704 317
77 3300036401 Ga0373937_0214270 Ga0373937_0214270_249_1367 318
78 3300048924 Ga0496121_0172523 Ga0496121_0172523_141_1151 318
79 iso_pu_bacteria 2924762789 2924766023 318
80 3300005337 Ga0070682_100014275 Ga0070682_1000142754 319
81 3300009098 Ga0105245_10040767 Ga0105245_100407671 319
82 3300053140 Ga0500573_0177332 Ga0500573_0177332_28_1026 319
83 3300005548 Ga0070665_100000011 Ga0070665_10000001159 320
84 3300005841 Ga0068863_100024156 Ga0068863_1000241563 320
85 3300006871 Ga0075434_100059280 Ga0075434_1000592803 320
86 3300025927 Ga0207687_10167585 Ga0207687_101675851 320
87 3300026088 Ga0207641_10034421 Ga0207641_100344213 320
88 3300028379 Ga0268266_10000063 Ga0268266_1000006356 320
89 3300039437 Ga0436365_0439305 Ga0436365_0439305_178_1182 320
90 3300046528 Ga0495642_0018441 Ga0495642_0018441_1120_2124 320
91 iso_pu_bacteria 2919138771 2919140768 320
92 3300025294 Ga0209025_1006935 Ga0209025_10069355 321
93 3300025298 Ga0209050_1025558 Ga0209050_10255582 321
94 3300025972 Ga0207668_10051590 Ga0207668_100515903 321
95 3300033179 Ga0307507_10135975 Ga0307507_101359752 321
96 3300044658 Ga0466972_0038922 Ga0466972_0038922_597_1598 321
97 3300044683 Ga0466965_0171467 Ga0466965_0171467_44_1045 321
98 3300044735 Ga0466968_0089647 Ga0466968_0089647_142_1143 321
99 3300044765 Ga0466970_0070616 Ga0466970_0070616_157_1158 321
100 3300053153 Ga0500616_0001042 Ga0500616_0001042_180_1190 321
101 3300005327 Ga0070658_10002449 Ga0070658_1000244911 322
102 3300009093 Ga0105240_10269282 Ga0105240_102692822 322
103 3300010375 Ga0105239_10019163 Ga0105239_100191635 322
104 3300025909 Ga0207705_10000890 Ga0207705_1000089014 322
105 3300025949 Ga0207667_10313124 Ga0207667_103131242 322
106 3300026067 Ga0207678_10163485 Ga0207678_101634852 322
107 3300031507 Ga0307509_10000177 Ga0307509_1000017743 322
108 3300031507 Ga0307509_10019902 Ga0307509_100199028 322
109 3300053144 Ga0500585_011589 Ga0500585_011589_1267_2316 322
110 iso_pu_bacteria 2886627955 2886630619 322
111 3300005436 Ga0070713_100052044 Ga0070713_1000520443 323
112 3300005563 Ga0068855_100238462 Ga0068855_1002384622 323
113 3300006946 Ga0079104_1000014 Ga0079104_1000014162 323
114 3300025949 Ga0207667_10202184 Ga0207667_102021842 323
115 3300027111 Ga0209281_1000032 Ga0209281_1000032162 323
116 3300028800 Ga0265338_10193483 Ga0265338_101934831 323
117 3300032004 Ga0307414_10003031 Ga0307414_100030317 323
118 3300046471 Ga0495650_0045592 Ga0495650_0045592_55_1056 323
119 3300053087 Ga0500643_003430 Ga0500643_003430_3775_4788 323
120 iso_pu_bacteria 2617270889 2617918848 323
121 iso_pu_bacteria 2913912277 2913916593 323
122 iso_pu_bacteria 2913939268 2913940661 323
123 iso_pu_bacteria 642555144 642601612 323
124 3300005289 Ga0065704_10074622 Ga0065704_100746222 324
125 3300005295 Ga0065707_10084107 Ga0065707_100841071 324
126 3300005335 Ga0070666_10027774 Ga0070666_100277744 324
127 3300005338 Ga0068868_100028688 Ga0068868_1000286883 324
128 3300005367 Ga0070667_100015957 Ga0070667_1000159576 324
129 3300005458 Ga0070681_10016203 Ga0070681_100162035 324
130 3300005458 Ga0070681_10283569 Ga0070681_102835691 324
131 3300005459 Ga0068867_100029873 Ga0068867_1000298732 324
132 3300005539 Ga0068853_100292222 Ga0068853_1002922221 324
133 3300005563 Ga0068855_100062305 Ga0068855_1000623052 324
134 3300005577 Ga0068857_100011738 Ga0068857_1000117385 324
135 3300005614 Ga0068856_100167904 Ga0068856_1001679042 324
136 3300005617 Ga0068859_100136487 Ga0068859_1001364872 324
137 3300005841 Ga0068863_100087985 Ga0068863_1000879852 324
138 3300005841 Ga0068863_100252727 Ga0068863_1002527273 324
139 3300005842 Ga0068858_100133088 Ga0068858_1001330884 324
140 3300005843 Ga0068860_100017992 Ga0068860_1000179927 324
141 3300006028 Ga0070717_10011440 Ga0070717_100114402 324
142 3300006237 Ga0097621_100016251 Ga0097621_1000162517 324
143 3300006237 Ga0097621_100023244 Ga0097621_1000232442 324
144 3300006358 Ga0068871_100007824 Ga0068871_1000078245 324
145 3300006358 Ga0068871_100163797 Ga0068871_1001637971 324
146 3300006844 Ga0075428_100195025 Ga0075428_1001950252 324
147 3300006846 Ga0075430_100083304 Ga0075430_1000833043 324
148 3300006852 Ga0075433_10134226 Ga0075433_101342261 324
149 3300006881 Ga0068865_100328484 Ga0068865_1003284842 324
150 3300006931 Ga0097620_100136486 Ga0097620_1001364862 324
151 3300007788 Ga0099795_10049613 Ga0099795_100496132 324
152 3300009036 Ga0105244_10000055 Ga0105244_1000005568 324
153 3300009093 Ga0105240_10003389 Ga0105240_1000338911 324
154 3300009093 Ga0105240_10198532 Ga0105240_101985323 324
155 3300009094 Ga0111539_10011819 Ga0111539_100118196 324
156 3300009098 Ga0105245_10010745 Ga0105245_100107455 324
157 3300009098 Ga0105245_10018954 Ga0105245_100189542 324
158 3300009174 Ga0105241_10020485 Ga0105241_100204856 324
159 3300009176 Ga0105242_10024635 Ga0105242_100246355 324
160 3300009177 Ga0105248_10011812 Ga0105248_100118122 324
161 3300009177 Ga0105248_10023511 Ga0105248_100235114 324
162 3300009177 Ga0105248_10578338 Ga0105248_105783382 324
163 3300009551 Ga0105238_10078149 Ga0105238_100781495 324
164 3300010375 Ga0105239_10399075 Ga0105239_103990752 324
165 3300013104 Ga0157370_10013344 Ga0157370_100133442 324
166 3300013105 Ga0157369_10034038 Ga0157369_100340386 324
167 3300013306 Ga0163162_10119234 Ga0163162_101192343 324
168 3300013307 Ga0157372_10288627 Ga0157372_102886272 324
169 3300014325 Ga0163163_10014187 Ga0163163_100141873 324
170 3300014325 Ga0163163_10019887 Ga0163163_100198877 324
171 3300014968 Ga0157379_10031297 Ga0157379_100312975 324
172 3300025728 Ga0207655_1000004 Ga0207655_1000004831 324
173 3300025903 Ga0207680_10015649 Ga0207680_100156493 324
174 3300025912 Ga0207707_10058583 Ga0207707_100585834 324
175 3300025913 Ga0207695_10055995 Ga0207695_100559952 324
176 3300025914 Ga0207671_10016410 Ga0207671_100164103 324
177 3300025921 Ga0207652_10070036 Ga0207652_100700362 324
178 3300025924 Ga0207694_10015983 Ga0207694_100159834 324
179 3300025927 Ga0207687_10006980 Ga0207687_100069807 324
180 3300025934 Ga0207686_10017266 Ga0207686_100172662 324
181 3300025934 Ga0207686_10120443 Ga0207686_101204433 324
182 3300025934 Ga0207686_10150362 Ga0207686_101503622 324
183 3300025938 Ga0207704_10107606 Ga0207704_101076062 324
184 3300025941 Ga0207711_10014014 Ga0207711_100140146 324
185 3300025941 Ga0207711_10450733 Ga0207711_104507331 324
186 3300025949 Ga0207667_10046106 Ga0207667_100461062 324
187 3300025949 Ga0207667_10247172 Ga0207667_102471722 324
188 3300025986 Ga0207658_10021249 Ga0207658_100212494 324
189 3300026035 Ga0207703_10037117 Ga0207703_100371174 324
190 3300026041 Ga0207639_10037317 Ga0207639_100373173 324
191 3300026088 Ga0207641_10194427 Ga0207641_101944273 324
192 3300026089 Ga0207648_10007528 Ga0207648_100075286 324
193 3300026089 Ga0207648_10020631 Ga0207648_100206312 324
194 3300026095 Ga0207676_10108145 Ga0207676_101081454 324
195 3300026116 Ga0207674_10013533 Ga0207674_100135337 324
196 3300026116 Ga0207674_10118700 Ga0207674_101187002 324
197 3300027907 Ga0207428_10000236 Ga0207428_1000023633 324
198 3300028381 Ga0268264_10259479 Ga0268264_102594792 324
199 3300031711 Ga0265314_10000723 Ga0265314_1000072334 324
200 3300035692 Ga0373935_0044718 Ga0373935_0044718_1178_2185 324
201 3300035725 Ga0373947_0013053 Ga0373947_0013053_323_1330 324
202 3300036401 Ga0373937_0000854 Ga0373937_0000854_15855_16862 324
203 3300036401 Ga0373937_0570391 Ga0373937_0570391_15_1022 324
204 3300044842 Ga0466957_0142732 Ga0466957_0142732_81_1094 324
205 3300046454 Ga0495592_0074702 Ga0495592_0074702_190_1197 324
206 3300046462 Ga0495651_0000170 Ga0495651_0000170_12835_13842 324
207 3300046462 Ga0495651_0004635 Ga0495651_0004635_2948_3955 324
208 3300046462 Ga0495651_0010586 Ga0495651_0010586_2625_3632 324
209 3300046463 Ga0495653_0004599 Ga0495653_0004599_4559_5566 324
210 3300046463 Ga0495653_0006517 Ga0495653_0006517_2831_3838 324
211 3300046477 Ga0495664_0020007 Ga0495664_0020007_670_1677 324
212 3300046477 Ga0495664_0049118 Ga0495664_0049118_769_1776 324
213 3300046511 Ga0495608_0039297 Ga0495608_0039297_135_1142 324
214 3300046511 Ga0495608_0101927 Ga0495608_0101927_463_1470 324
215 3300046514 Ga0495618_0003670 Ga0495618_0003670_7705_8712 324
216 3300046516 Ga0495628_0007934 Ga0495628_0007934_2558_3565 324
217 3300046516 Ga0495628_0136369 Ga0495628_0136369_83_1090 324
218 3300046517 Ga0495630_0041509 Ga0495630_0041509_2258_3265 324
219 3300046529 Ga0495652_0007088 Ga0495652_0007088_1588_2595 324
220 3300046529 Ga0495652_0009036 Ga0495652_0009036_1685_2692 324
221 3300046535 Ga0495586_0012021 Ga0495586_0012021_432_1439 324
222 3300046536 Ga0495587_0000436 Ga0495587_0000436_14228_15235 324
223 3300046543 Ga0495645_0046580 Ga0495645_0046580_18_1025 324
224 3300046559 Ga0495667_0000964 Ga0495667_0000964_8398_9405 324
225 3300046559 Ga0495667_0006587 Ga0495667_0006587_6024_7031 324
226 3300046663 Ga0495635_0094015 Ga0495635_0094015_145_1152 324
227 3300046675 Ga0495657_0004381 Ga0495657_0004381_6276_7283 324
228 3300046675 Ga0495657_0020238 Ga0495657_0020238_710_1717 324
229 3300046678 Ga0495599_0019438 Ga0495599_0019438_3102_4109 324
230 3300046679 Ga0495623_0009634 Ga0495623_0009634_3242_4249 324
231 3300046690 Ga0495624_0033200 Ga0495624_0033200_1178_2185 324
232 3300046692 Ga0495671_0014646 Ga0495671_0014646_2585_3601 324
233 3300046809 Ga0495600_0005825 Ga0495600_0005825_3611_4618 324
234 3300046809 Ga0495600_0014915 Ga0495600_0014915_3736_4743 324
235 3300047317 Ga0495604_0000750 Ga0495604_0000750_6265_7272 324
236 3300047319 Ga0495674_0001869 Ga0495674_0001869_5788_6795 324
237 3300047322 Ga0495680_0002401 Ga0495680_0002401_13341_14348 324
238 3300047444 Ga0495675_0000237 Ga0495675_0000237_6288_7295 324
239 3300047444 Ga0495675_0008651 Ga0495675_0008651_1024_2031 324
240 3300047471 Ga0495684_0004533 Ga0495684_0004533_4237_5244 324
241 3300048088 Ga0495602_0034103 Ga0495602_0034103_2353_3360 324
242 3300048088 Ga0495602_0060138 Ga0495602_0060138_86_1093 324
243 3300048089 Ga0495614_0000732 Ga0495614_0000732_11635_12642 324
244 3300048090 Ga0495615_0003905 Ga0495615_0003905_37_1044 324
245 3300048917 Ga0496114_0419139 Ga0496114_0419139_113_1126 324
246 3300048924 Ga0496121_0057500 Ga0496121_0057500_2038_3051 324
247 3300049571 Ga0501034_0007394 Ga0501034_0007394_4406_5428 324
248 3300050509 nmdc:mga0qj67_64595_c1 nmdc:mga0qj67_64595_c1_1767_2780 324
249 3300050515 nmdc:mga0a205_475508_c1 nmdc:mga0a205_475508_c1_48_1061 324
250 3300053122 Ga0500608_002331 Ga0500608_002331_578_1585 324
251 3300053158 Ga0500627_0027533 Ga0500627_0027533_1191_2228 324
252 3300005328 Ga0070676_10004357 Ga0070676_100043576 325
253 3300005331 Ga0070670_100007118 Ga0070670_1000071183 325
254 3300005334 Ga0068869_100020879 Ga0068869_1000208793 325
255 3300005337 Ga0070682_100125408 Ga0070682_1001254082 325
256 3300005353 Ga0070669_100145334 Ga0070669_1001453341 325
257 3300005353 Ga0070669_100176330 Ga0070669_1001763301 325
258 3300005354 Ga0070675_100003673 Ga0070675_1000036737 325
259 3300005354 Ga0070675_100030115 Ga0070675_1000301152 325
260 3300005355 Ga0070671_100143452 Ga0070671_1001434521 325
261 3300005364 Ga0070673_100003826 Ga0070673_1000038264 325
262 3300005438 Ga0070701_10026504 Ga0070701_100265043 325
263 3300005456 Ga0070678_100093216 Ga0070678_1000932164 325
264 3300005459 Ga0068867_100147622 Ga0068867_1001476222 325
265 3300005466 Ga0070685_10013788 Ga0070685_100137884 325
266 3300005543 Ga0070672_100006726 Ga0070672_1000067265 325
267 3300005719 Ga0068861_100020458 Ga0068861_1000204582 325
268 3300005834 Ga0068851_10025491 Ga0068851_100254914 325
269 3300005841 Ga0068863_100000534 Ga0068863_10000053416 325
270 3300005842 Ga0068858_100012417 Ga0068858_1000124178 325
271 3300005843 Ga0068860_100011410 Ga0068860_1000114109 325
272 3300005843 Ga0068860_100092238 Ga0068860_1000922383 325
273 3300009093 Ga0105240_10018292 Ga0105240_100182923 325
274 3300009094 Ga0111539_10373537 Ga0111539_103735372 325
275 3300009148 Ga0105243_10392477 Ga0105243_103924771 325
276 3300009551 Ga0105238_10025114 Ga0105238_100251142 325
277 3300014325 Ga0163163_10006452 Ga0163163_100064523 325
278 3300014325 Ga0163163_10239767 Ga0163163_102397672 325
279 3300014326 Ga0157380_10152912 Ga0157380_101529123 325
280 3300025315 Ga0207697_10045680 Ga0207697_100456802 325
281 3300025321 Ga0207656_10016079 Ga0207656_100160792 325
282 3300025893 Ga0207682_10033296 Ga0207682_100332962 325
283 3300025908 Ga0207643_10073591 Ga0207643_100735912 325
284 3300025913 Ga0207695_10094912 Ga0207695_100949123 325
285 3300025918 Ga0207662_10149119 Ga0207662_101491192 325
286 3300025924 Ga0207694_10018700 Ga0207694_100187002 325
287 3300025924 Ga0207694_10154515 Ga0207694_101545151 325
288 3300025925 Ga0207650_10016546 Ga0207650_100165463 325
289 3300025926 Ga0207659_10007137 Ga0207659_100071376 325
290 3300025926 Ga0207659_10010426 Ga0207659_100104264 325
291 3300025931 Ga0207644_10119094 Ga0207644_101190943 325
292 3300025934 Ga0207686_10164085 Ga0207686_101640851 325
293 3300025936 Ga0207670_10111157 Ga0207670_101111571 325
294 3300025938 Ga0207704_10101111 Ga0207704_101011112 325
295 3300025940 Ga0207691_10010581 Ga0207691_100105813 325
296 3300025940 Ga0207691_10178136 Ga0207691_101781361 325
297 3300025942 Ga0207689_10088654 Ga0207689_100886542 325
298 3300025945 Ga0207679_10041387 Ga0207679_100413874 325
299 3300025960 Ga0207651_10069635 Ga0207651_100696351 325
300 3300026035 Ga0207703_10038475 Ga0207703_100384755 325
301 3300026067 Ga0207678_10021134 Ga0207678_100211344 325
302 3300026075 Ga0207708_10004413 Ga0207708_1000441311 325
303 3300026088 Ga0207641_10000047 Ga0207641_1000004794 325
304 3300026088 Ga0207641_10142261 Ga0207641_101422611 325
305 3300026089 Ga0207648_10000163 Ga0207648_1000016316 325
306 3300026118 Ga0207675_100243305 Ga0207675_1002433052 325
307 3300026121 Ga0207683_10135940 Ga0207683_101359402 325
308 3300028381 Ga0268264_10104480 Ga0268264_101044802 325
309 3300028800 Ga0265338_10003114 Ga0265338_100031147 325
310 3300031548 Ga0307408_100003770 Ga0307408_1000037707 325
311 3300031731 Ga0307405_10272463 Ga0307405_102724631 325
312 3300031852 Ga0307410_10004781 Ga0307410_100047812 325
313 3300031995 Ga0307409_100148699 Ga0307409_1001486993 325
314 3300032002 Ga0307416_100011157 Ga0307416_1000111574 325
315 3300032005 Ga0307411_10001140 Ga0307411_100011409 325
316 3300032005 Ga0307411_10004799 Ga0307411_100047999 325
317 3300032005 Ga0307411_10053099 Ga0307411_100530993 325
318 3300042015 Ga0439462_0014781 Ga0439462_0014781_644_1768 325
319 3300042134 Ga0450898_017538 Ga0450898_017538_37_1161 325
320 3300042435 Ga0439434_0003730 Ga0439434_0003730_1494_2618 325
321 3300042436 Ga0439435_0000942 Ga0439435_0000942_2141_3265 325
322 3300046522 Ga0495643_0003908 Ga0495643_0003908_6163_7266 325
323 3300048922 Ga0496119_0001382 Ga0496119_0001382_1053_2081 325
324 3300048923 Ga0496120_0000197 Ga0496120_0000197_99561_100589 325
325 3300049571 Ga0501034_0067714 Ga0501034_0067714_1429_2460 325
326 3300049572 Ga0501036_0179037 Ga0501036_0179037_16_1047 325
327 3300049574 Ga0501038_0183775 Ga0501038_0183775_60_1181 325
328 3300049578 Ga0501042_0155245 Ga0501042_0155245_171_1274 325
329 3300005329 Ga0070683_100165294 Ga0070683_1001652942 326
330 3300005329 Ga0070683_100323699 Ga0070683_1003236992 326
331 3300005336 Ga0070680_100034364 Ga0070680_1000343641 326
332 3300005343 Ga0070687_100076613 Ga0070687_1000766132 326
333 3300005364 Ga0070673_100028400 Ga0070673_1000284003 326
334 3300005365 Ga0070688_100046830 Ga0070688_1000468302 326
335 3300005436 Ga0070713_100082912 Ga0070713_1000829122 326
336 3300005441 Ga0070700_100060139 Ga0070700_1000601393 326
337 3300005518 Ga0070699_100114901 Ga0070699_1001149011 326
338 3300005530 Ga0070679_100003262 Ga0070679_1000032622 326
339 3300005530 Ga0070679_100056130 Ga0070679_1000561303 326
340 3300005535 Ga0070684_100025007 Ga0070684_1000250075 326
341 3300005544 Ga0070686_100053460 Ga0070686_1000534602 326
342 3300005548 Ga0070665_100011449 Ga0070665_1000114498 326
343 3300005563 Ga0068855_100101599 Ga0068855_1001015992 326
344 3300005564 Ga0070664_100005933 Ga0070664_1000059333 326
345 3300005618 Ga0068864_100028054 Ga0068864_1000280543 326
346 3300005843 Ga0068860_100227261 Ga0068860_1002272612 326
347 3300005844 Ga0068862_100092857 Ga0068862_1000928573 326
348 3300006880 Ga0075429_100224735 Ga0075429_1002247351 326
349 3300009093 Ga0105240_10040549 Ga0105240_100405494 326
350 3300009094 Ga0111539_10000509 Ga0111539_1000050913 326
351 3300009545 Ga0105237_10027328 Ga0105237_100273284 326
352 3300009551 Ga0105238_10031325 Ga0105238_100313255 326
353 3300009551 Ga0105238_10165677 Ga0105238_101656772 326
354 3300009551 Ga0105238_10257244 Ga0105238_102572442 326
355 3300013105 Ga0157369_10045232 Ga0157369_100452323 326
356 3300013105 Ga0157369_10064276 Ga0157369_100642761 326
357 3300013307 Ga0157372_10028281 Ga0157372_100282814 326
358 3300013307 Ga0157372_10218635 Ga0157372_102186352 326
359 3300025913 Ga0207695_10039731 Ga0207695_100397312 326
360 3300025914 Ga0207671_10038320 Ga0207671_100383202 326
361 3300025918 Ga0207662_10168126 Ga0207662_101681262 326
362 3300025921 Ga0207652_10076496 Ga0207652_100764962 326
363 3300025921 Ga0207652_10083918 Ga0207652_100839182 326
364 3300025924 Ga0207694_10026609 Ga0207694_100266095 326
365 3300025924 Ga0207694_10197209 Ga0207694_101972091 326
366 3300025925 Ga0207650_10005888 Ga0207650_100058884 326
367 3300025928 Ga0207700_10013828 Ga0207700_100138283 326
368 3300025928 Ga0207700_10262126 Ga0207700_102621261 326
369 3300025940 Ga0207691_10015959 Ga0207691_100159592 326
370 3300025949 Ga0207667_10022329 Ga0207667_100223292 326
371 3300025960 Ga0207651_10063710 Ga0207651_100637103 326
372 3300026075 Ga0207708_10236397 Ga0207708_102363971 326
373 3300026095 Ga0207676_10007400 Ga0207676_100074005 326
374 3300027907 Ga0207428_10013853 Ga0207428_100138538 326
375 3300028379 Ga0268266_10002110 Ga0268266_1000211011 326
376 3300028381 Ga0268264_10185733 Ga0268264_101857332 326
377 3300031852 Ga0307410_10017215 Ga0307410_100172152 326
378 3300031911 Ga0307412_10006138 Ga0307412_100061385 326
379 3300032005 Ga0307411_10002736 Ga0307411_100027362 326
380 3300032005 Ga0307411_10007613 Ga0307411_100076132 326
381 3300037466 Ga0395898_0002294 Ga0395898_0002294_10278_11291 326
382 3300044656 Ga0466969_0006141 Ga0466969_0006141_567_1718 326
383 3300044673 Ga0453683_0000336 Ga0453683_0000336_30030_31046 326
384 3300044684 Ga0466966_0028225 Ga0466966_0028225_700_1851 326
385 3300045049 Ga0466959_0006916 Ga0466959_0006916_4628_5779 326
386 3300046558 Ga0495633_0025796 Ga0495633_0025796_196_1314 326
387 3300050511 nmdc:mga08y16_17995_c1 nmdc:mga08y16_17995_c1_688_1797 326
388 3300050511 nmdc:mga08y16_243098_c1 nmdc:mga08y16_243098_c1_150_1268 326
389 3300050511 nmdc:mga08y16_464627_c1 nmdc:mga08y16_464627_c1_154_1263 326
390 3300053178 Ga0500637_0085766 Ga0500637_0085766_311_1492 326
391 3300005435 Ga0070714_100271350 Ga0070714_1002713501 327
392 3300005467 Ga0070706_100118216 Ga0070706_1001182162 327
393 3300025910 Ga0207684_10113865 Ga0207684_101138652 327
394 3300028573 Ga0265334_10051338 Ga0265334_100513382 327
395 3300028800 Ga0265338_10013194 Ga0265338_100131943 327
396 3300035111 Ga0373923_0017209 Ga0373923_0017209_939_1952 327
397 3300035111 Ga0373923_0089820 Ga0373923_0089820_16_1029 327
398 3300035118 Ga0373954_0108064 Ga0373954_0108064_284_1297 327
399 3300036401 Ga0373937_0085911 Ga0373937_0085911_836_1849 327
400 3300009093 Ga0105240_10044875 Ga0105240_100448753 328
401 3300010375 Ga0105239_10374517 Ga0105239_103745171 328
402 3300003323 rootH1_10178630 rootH1_101786303 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

217

346

0.95

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

249

380

0.83

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

68

177

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b27-assembly1.cif.gz_A dihydroprecondylocarpine acetate synthase from catharanthus roseus 0.9146 2 326
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.9089 2 326
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.8982 2 326
3uog-assembly1.cif.gz_A crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021 0.8932 2 326
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.8902 1 328
ID Description Score Start End Superfamily
af_Q54UL7_143_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9493 133 273 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 137 273 3.40.50.720
af_P72043_133_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 146 273 3.40.50.720
3uogB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 133 274 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9305 138 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A142HFC5-F1-model_v4 deleted 0.9745 152 327
AF-A0A356CKQ3-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9674 133 328 GO:0016491
AF-A0A142HFC5-F1-model_v4 deleted 0.9637 152 327
AF-A0A440IWI4-F1-model_v4 deleted 0.963 181 328
AF-A0A356CKQ3-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9532 133 328 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map