F435076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 402 | 242 | 394 | 345 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10392477|Ga0105243_103924771 |
| Length | 382 |
| Sequence | LSLGLIGTEIRPVYNALMTPRFAAAVCALLLGLATTHGQPQTGRQFQLVADGKGYKLEMKTVARPTPGPKQVLVRVRAVSLNQRDMAVTRGQYGGTGGGAMVGKVPLSDGAGEVVAVGSGATRFRVGDRVAGIFFARWIDGHRTADTLASARGGAGMDGMLSEFVAGDENGFVKIPDYLSFEEGATLPCTGVTAYRALFVEGRLKKGEFVLLEGTGGVSTFGLQFAAAAGARPIITSSSDDKIAKVKTMGAFGTVNYRTNPDWQKEVRKLTGDAGVDHVLEVGGRDTLPRALEALAYDGHIALIGGLSGFASDLPAGRLLGMGARVTGIYVGSRADFEAMNRFMIEHKIRPLIDKVFPFEESPQAFDLMDNGSYLGKIVIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 2 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 3 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 4 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 5 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 6 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 168 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 169 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 170 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 171 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 172 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 173 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 177 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 223 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 234 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 235 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 236 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 237 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 241 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 242 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.01 |
| Metatranscriptomes | 0 |
| Isolates | 1.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.49 |
| Nodule | 0.5 |
| Rhizoplane | 1.99 |
| Rhizosphere | 90.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10178630 | 3300003323 | Bacteria | 3290 |
| 2 | Ga0065704_10074622 | 3300005289 | Bacteria | 6131 |
| 3 | Ga0065707_10084107 | 3300005295 | Bacteria | 7681 |
| 4 | Ga0070658_10002449 | 3300005327 | Bacteria | 15524 |
| 5 | Ga0070676_10004357 | 3300005328 | Bacteria | 7436 |
| 6 | Ga0070683_100165294 | 3300005329 | Bacteria | 2099 |
| 7 | Ga0070683_100323699 | 3300005329 | Bacteria | 1467 |
| 8 | Ga0070670_100007118 | 3300005331 | Bacteria | 9472 |
| 9 | Ga0070670_100009785 | 3300005331 | Bacteria | 8188 |
| 10 | Ga0068869_100020879 | 3300005334 | Bacteria | 4498 |
| 11 | Ga0070666_10011800 | 3300005335 | Bacteria | 5493 |
| 12 | Ga0070666_10027774 | 3300005335 | Bacteria | 3708 |
| 13 | Ga0070680_100034364 | 3300005336 | Bacteria | 4088 |
| 14 | Ga0070682_100014275 | 3300005337 | Bacteria | 4588 |
| 15 | Ga0070682_100125408 | 3300005337 | Bacteria | 1729 |
| 16 | Ga0068868_100024275 | 3300005338 | Bacteria | 4599 |
| 17 | Ga0068868_100028688 | 3300005338 | Bacteria | 4257 |
| 18 | Ga0070691_10041411 | 3300005341 | Bacteria | 2178 |
| 19 | Ga0070687_100064186 | 3300005343 | Unclassified | 1950 |
| 20 | Ga0070687_100076613 | 3300005343 | Bacteria | 1812 |
| 21 | Ga0070661_100009397 | 3300005344 | Bacteria | 6766 |
| 22 | Ga0070668_100006199 | 3300005347 | Bacteria | 8856 |
| 23 | Ga0070669_100145334 | 3300005353 | Unclassified | 1832 |
| 24 | Ga0070669_100176330 | 3300005353 | Bacteria | 1669 |
| 25 | Ga0070675_100003673 | 3300005354 | Bacteria | 11664 |
| 26 | Ga0070675_100030115 | 3300005354 | Bacteria | 4379 |
| 27 | Ga0070671_100001163 | 3300005355 | Bacteria | 19618 |
| 28 | Ga0070671_100143452 | 3300005355 | Bacteria | 2016 |
| 29 | Ga0070673_100003826 | 3300005364 | Bacteria | 9441 |
| 30 | Ga0070673_100028400 | 3300005364 | Bacteria | 4160 |
| 31 | Ga0070688_100046830 | 3300005365 | Unclassified | 2679 |
| 32 | Ga0070667_100015957 | 3300005367 | Bacteria | 6215 |
| 33 | Ga0070667_100017935 | 3300005367 | Bacteria | 5867 |
| 34 | Ga0070714_100271350 | 3300005435 | Unclassified | 1573 |
| 35 | Ga0070713_100052044 | 3300005436 | Unclassified | 3389 |
| 36 | Ga0070713_100082912 | 3300005436 | Bacteria | 2740 |
| 37 | Ga0070701_10026504 | 3300005438 | Bacteria | 2827 |
| 38 | Ga0070700_100060139 | 3300005441 | Bacteria | 2394 |
| 39 | Ga0070663_100000420 | 3300005455 | Bacteria | 22378 |
| 40 | Ga0070678_100093216 | 3300005456 | Bacteria | 2316 |
| 41 | Ga0070681_10016203 | 3300005458 | Bacteria | 7432 |
| 42 | Ga0070681_10283569 | 3300005458 | Unclassified | 1567 |
| 43 | Ga0068867_100029873 | 3300005459 | Bacteria | 3929 |
| 44 | Ga0068867_100147622 | 3300005459 | Bacteria | 1844 |
| 45 | Ga0070685_10013788 | 3300005466 | Bacteria | 4272 |
| 46 | Ga0070706_100118216 | 3300005467 | Bacteria | 2469 |
| 47 | Ga0070699_100114901 | 3300005518 | Bacteria | 2365 |
| 48 | Ga0070679_100003262 | 3300005530 | Bacteria | 14834 |
| 49 | Ga0070679_100056130 | 3300005530 | Bacteria | 3924 |
| 50 | Ga0070684_100025007 | 3300005535 | Bacteria | 5014 |
| 51 | Ga0070684_100027996 | 3300005535 | Bacteria | 4764 |
| 52 | Ga0068853_100292222 | 3300005539 | Bacteria | 1504 |
| 53 | Ga0070672_100006726 | 3300005543 | Bacteria | 7753 |
| 54 | Ga0070686_100053460 | 3300005544 | Bacteria | 2579 |
| 55 | Ga0070686_100155790 | 3300005544 | Unclassified | 1604 |
| 56 | Ga0070695_100080439 | 3300005545 | Unclassified | 2154 |
| 57 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 58 | Ga0070665_100011449 | 3300005548 | Bacteria | 8968 |
| 59 | Ga0068855_100062305 | 3300005563 | Bacteria | 4354 |
| 60 | Ga0068855_100101599 | 3300005563 | Bacteria | 3310 |
| 61 | Ga0068855_100238462 | 3300005563 | Bacteria | 2033 |
| 62 | Ga0070664_100005933 | 3300005564 | Bacteria | 9866 |
| 63 | Ga0070664_100009134 | 3300005564 | Bacteria | 8047 |
| 64 | Ga0068857_100011738 | 3300005577 | Bacteria | 7617 |
| 65 | Ga0068856_100115516 | 3300005614 | Unclassified | 2684 |
| 66 | Ga0068856_100167904 | 3300005614 | Bacteria | 2205 |
| 67 | Ga0068852_100070194 | 3300005616 | Unclassified | 3073 |
| 68 | Ga0068859_100028312 | 3300005617 | Bacteria | 5617 |
| 69 | Ga0068859_100064104 | 3300005617 | Bacteria | 3707 |
| 70 | Ga0068859_100136487 | 3300005617 | Bacteria | 2526 |
| 71 | Ga0068864_100009570 | 3300005618 | Bacteria | 7991 |
| 72 | Ga0068864_100028054 | 3300005618 | Bacteria | 4757 |
| 73 | Ga0068861_100020458 | 3300005719 | Bacteria | 4741 |
| 74 | Ga0068851_10025491 | 3300005834 | Bacteria | 2901 |
| 75 | Ga0068863_100000534 | 3300005841 | Bacteria | 38896 |
| 76 | Ga0068863_100016027 | 3300005841 | Bacteria | 7188 |
| 77 | Ga0068863_100024156 | 3300005841 | Bacteria | 5799 |
| 78 | Ga0068863_100087985 | 3300005841 | Bacteria | 2944 |
| 79 | Ga0068863_100252727 | 3300005841 | Bacteria | 1703 |
| 80 | Ga0068858_100004105 | 3300005842 | Bacteria | 14344 |
| 81 | Ga0068858_100012417 | 3300005842 | Bacteria | 8031 |
| 82 | Ga0068858_100133088 | 3300005842 | Bacteria | 2332 |
| 83 | Ga0068860_100011410 | 3300005843 | Bacteria | 8755 |
| 84 | Ga0068860_100017992 | 3300005843 | Bacteria | 6883 |
| 85 | Ga0068860_100035517 | 3300005843 | Bacteria | 4780 |
| 86 | Ga0068860_100092238 | 3300005843 | Bacteria | 2886 |
| 87 | Ga0068860_100227261 | 3300005843 | Bacteria | 1813 |
| 88 | Ga0068862_100092857 | 3300005844 | Bacteria | 2631 |
| 89 | Ga0070717_10011440 | 3300006028 | Bacteria | 6740 |
| 90 | Ga0097621_100016251 | 3300006237 | Bacteria | 5620 |
| 91 | Ga0097621_100023244 | 3300006237 | Bacteria | 4822 |
| 92 | Ga0068871_100007824 | 3300006358 | Bacteria | 7657 |
| 93 | Ga0068871_100137901 | 3300006358 | Unclassified | 2073 |
| 94 | Ga0068871_100163797 | 3300006358 | Bacteria | 1903 |
| 95 | Ga0075428_100073369 | 3300006844 | Unclassified | 3737 |
| 96 | Ga0075428_100195025 | 3300006844 | Bacteria | 2190 |
| 97 | Ga0075430_100083304 | 3300006846 | Bacteria | 2679 |
| 98 | Ga0075431_100001583 | 3300006847 | Bacteria | 21166 |
| 99 | Ga0075433_10134226 | 3300006852 | Bacteria | 2200 |
| 100 | Ga0075433_10170934 | 3300006852 | Bacteria | 1934 |
| 101 | Ga0075434_100059280 | 3300006871 | Bacteria | 3805 |
| 102 | Ga0075429_100083241 | 3300006880 | Bacteria | 2789 |
| 103 | Ga0075429_100224735 | 3300006880 | Unclassified | 1644 |
| 104 | Ga0075429_100306632 | 3300006880 | Unclassified | 1390 |
| 105 | Ga0068865_100328484 | 3300006881 | Bacteria | 1232 |
| 106 | Ga0097620_100028312 | 3300006931 | Bacteria | 5617 |
| 107 | Ga0097620_100064103 | 3300006931 | Bacteria | 3707 |
| 108 | Ga0097620_100136486 | 3300006931 | Bacteria | 2526 |
| 109 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 110 | Ga0099795_10049613 | 3300007788 | Bacteria | 1524 |
| 111 | Ga0105244_10000055 | 3300009036 | Bacteria | 130164 |
| 112 | Ga0105240_10003389 | 3300009093 | Bacteria | 24780 |
| 113 | Ga0105240_10018292 | 3300009093 | Bacteria | 9419 |
| 114 | Ga0105240_10040549 | 3300009093 | Bacteria | 5953 |
| 115 | Ga0105240_10044875 | 3300009093 | Bacteria | 5612 |
| 116 | Ga0105240_10140105 | 3300009093 | Unclassified | 2892 |
| 117 | Ga0105240_10198532 | 3300009093 | Bacteria | 2353 |
| 118 | Ga0105240_10269282 | 3300009093 | Bacteria | 1962 |
| 119 | Ga0111539_10000509 | 3300009094 | Bacteria | 49359 |
| 120 | Ga0111539_10011819 | 3300009094 | Bacteria | 10944 |
| 121 | Ga0111539_10087531 | 3300009094 | Bacteria | 3659 |
| 122 | Ga0111539_10373537 | 3300009094 | Bacteria | 1660 |
| 123 | Ga0105245_10010745 | 3300009098 | Bacteria | 7965 |
| 124 | Ga0105245_10018954 | 3300009098 | Bacteria | 6023 |
| 125 | Ga0105245_10033146 | 3300009098 | Bacteria | 4576 |
| 126 | Ga0105245_10040767 | 3300009098 | Bacteria | 4138 |
| 127 | Ga0105247_10012697 | 3300009101 | Bacteria | 5054 |
| 128 | Ga0114129_10670634 | 3300009147 | Unclassified | 1336 |
| 129 | Ga0105243_10392477 | 3300009148 | Bacteria | 1287 |
| 130 | Ga0105241_10020485 | 3300009174 | Bacteria | 4885 |
| 131 | Ga0105242_10024635 | 3300009176 | Bacteria | 4754 |
| 132 | Ga0105248_10011812 | 3300009177 | Bacteria | 9634 |
| 133 | Ga0105248_10023511 | 3300009177 | Bacteria | 6845 |
| 134 | Ga0105248_10578338 | 3300009177 | Bacteria | 1267 |
| 135 | Ga0105237_10027328 | 3300009545 | Bacteria | 5826 |
| 136 | Ga0105238_10025114 | 3300009551 | Bacteria | 6072 |
| 137 | Ga0105238_10031325 | 3300009551 | Bacteria | 5413 |
| 138 | Ga0105238_10060678 | 3300009551 | Unclassified | 3786 |
| 139 | Ga0105238_10078149 | 3300009551 | Bacteria | 3300 |
| 140 | Ga0105238_10165677 | 3300009551 | Bacteria | 2186 |
| 141 | Ga0105238_10257244 | 3300009551 | Bacteria | 1725 |
| 142 | Ga0105239_10019163 | 3300010375 | Bacteria | 7560 |
| 143 | Ga0105239_10073142 | 3300010375 | Bacteria | 3768 |
| 144 | Ga0105239_10374517 | 3300010375 | Bacteria | 1609 |
| 145 | Ga0105239_10399075 | 3300010375 | Bacteria | 1556 |
| 146 | Ga0105246_10003339 | 3300011119 | Bacteria | 9708 |
| 147 | Ga0157370_10013344 | 3300013104 | Bacteria | 8463 |
| 148 | Ga0157369_10034038 | 3300013105 | Bacteria | 5595 |
| 149 | Ga0157369_10045232 | 3300013105 | Bacteria | 4789 |
| 150 | Ga0157369_10064276 | 3300013105 | Bacteria | 3952 |
| 151 | Ga0157374_10016788 | 3300013296 | Bacteria | 6441 |
| 152 | Ga0163162_10016185 | 3300013306 | Bacteria | 7293 |
| 153 | Ga0163162_10119234 | 3300013306 | Bacteria | 2741 |
| 154 | Ga0157372_10028281 | 3300013307 | Bacteria | 6119 |
| 155 | Ga0157372_10218635 | 3300013307 | Bacteria | 2208 |
| 156 | Ga0157372_10288627 | 3300013307 | Unclassified | 1908 |
| 157 | Ga0157375_10010310 | 3300013308 | Bacteria | 8225 |
| 158 | Ga0163163_10006452 | 3300014325 | Bacteria | 10260 |
| 159 | Ga0163163_10014187 | 3300014325 | Bacteria | 7318 |
| 160 | Ga0163163_10019887 | 3300014325 | Bacteria | 6314 |
| 161 | Ga0163163_10239767 | 3300014325 | Bacteria | 1863 |
| 162 | Ga0157380_10002109 | 3300014326 | Bacteria | 13335 |
| 163 | Ga0157380_10152912 | 3300014326 | Bacteria | 1997 |
| 164 | Ga0157379_10010874 | 3300014968 | Bacteria | 7932 |
| 165 | Ga0157379_10031297 | 3300014968 | Bacteria | 4739 |
| 166 | Ga0209025_1006935 | 3300025294 | Bacteria | 8620 |
| 167 | Ga0209050_1025558 | 3300025298 | Bacteria | 2002 |
| 168 | Ga0207697_10045680 | 3300025315 | Bacteria | 1803 |
| 169 | Ga0207656_10016079 | 3300025321 | Bacteria | 2907 |
| 170 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 171 | Ga0207682_10033296 | 3300025893 | Bacteria | 2074 |
| 172 | Ga0207680_10015649 | 3300025903 | Bacteria | 3965 |
| 173 | Ga0207643_10073591 | 3300025908 | Bacteria | 1970 |
| 174 | Ga0207705_10000890 | 3300025909 | Bacteria | 24460 |
| 175 | Ga0207684_10113865 | 3300025910 | Bacteria | 2316 |
| 176 | Ga0207707_10058583 | 3300025912 | Bacteria | 3352 |
| 177 | Ga0207695_10039731 | 3300025913 | Bacteria | 5054 |
| 178 | Ga0207695_10055995 | 3300025913 | Bacteria | 4106 |
| 179 | Ga0207695_10094912 | 3300025913 | Bacteria | 2989 |
| 180 | Ga0207671_10016410 | 3300025914 | Bacteria | 5757 |
| 181 | Ga0207671_10038320 | 3300025914 | Bacteria | 3552 |
| 182 | Ga0207662_10083283 | 3300025918 | Unclassified | 1955 |
| 183 | Ga0207662_10149119 | 3300025918 | Bacteria | 1486 |
| 184 | Ga0207662_10168126 | 3300025918 | Bacteria | 1405 |
| 185 | Ga0207649_10018164 | 3300025920 | Bacteria | 3994 |
| 186 | Ga0207652_10070036 | 3300025921 | Bacteria | 3046 |
| 187 | Ga0207652_10076496 | 3300025921 | Unclassified | 2919 |
| 188 | Ga0207652_10083918 | 3300025921 | Bacteria | 2790 |
| 189 | Ga0207694_10015983 | 3300025924 | Bacteria | 5664 |
| 190 | Ga0207694_10018700 | 3300025924 | Bacteria | 5237 |
| 191 | Ga0207694_10026609 | 3300025924 | Bacteria | 4402 |
| 192 | Ga0207694_10154515 | 3300025924 | Bacteria | 1850 |
| 193 | Ga0207694_10197209 | 3300025924 | Bacteria | 1637 |
| 194 | Ga0207650_10005888 | 3300025925 | Bacteria | 8368 |
| 195 | Ga0207650_10016546 | 3300025925 | Bacteria | 5158 |
| 196 | Ga0207659_10007137 | 3300025926 | Bacteria | 6858 |
| 197 | Ga0207659_10010426 | 3300025926 | Bacteria | 5841 |
| 198 | Ga0207687_10006980 | 3300025927 | Bacteria | 7440 |
| 199 | Ga0207687_10017055 | 3300025927 | Bacteria | 4774 |
| 200 | Ga0207687_10167585 | 3300025927 | Bacteria | 1691 |
| 201 | Ga0207700_10013828 | 3300025928 | Bacteria | 5268 |
| 202 | Ga0207700_10262126 | 3300025928 | Bacteria | 1480 |
| 203 | Ga0207644_10119094 | 3300025931 | Bacteria | 2007 |
| 204 | Ga0207686_10017266 | 3300025934 | Bacteria | 4064 |
| 205 | Ga0207686_10120443 | 3300025934 | Bacteria | 1785 |
| 206 | Ga0207686_10150362 | 3300025934 | Bacteria | 1620 |
| 207 | Ga0207686_10164085 | 3300025934 | Bacteria | 1560 |
| 208 | Ga0207670_10111157 | 3300025936 | Bacteria | 1975 |
| 209 | Ga0207704_10101111 | 3300025938 | Bacteria | 1922 |
| 210 | Ga0207704_10107606 | 3300025938 | Bacteria | 1876 |
| 211 | Ga0207691_10010581 | 3300025940 | Bacteria | 8849 |
| 212 | Ga0207691_10015959 | 3300025940 | Bacteria | 7135 |
| 213 | Ga0207691_10178136 | 3300025940 | Bacteria | 1858 |
| 214 | Ga0207711_10014014 | 3300025941 | Bacteria | 6660 |
| 215 | Ga0207711_10450733 | 3300025941 | Bacteria | 1198 |
| 216 | Ga0207689_10088654 | 3300025942 | Bacteria | 2541 |
| 217 | Ga0207679_10028937 | 3300025945 | Bacteria | 3852 |
| 218 | Ga0207679_10041387 | 3300025945 | Bacteria | 3304 |
| 219 | Ga0207667_10022329 | 3300025949 | Bacteria | 6992 |
| 220 | Ga0207667_10046106 | 3300025949 | Bacteria | 4615 |
| 221 | Ga0207667_10202184 | 3300025949 | Bacteria | 2038 |
| 222 | Ga0207667_10247172 | 3300025949 | Bacteria | 1825 |
| 223 | Ga0207667_10313124 | 3300025949 | Bacteria | 1603 |
| 224 | Ga0207651_10063710 | 3300025960 | Bacteria | 2576 |
| 225 | Ga0207651_10069635 | 3300025960 | Bacteria | 2485 |
| 226 | Ga0207668_10051590 | 3300025972 | Bacteria | 2841 |
| 227 | Ga0207668_10379410 | 3300025972 | Bacteria | 1190 |
| 228 | Ga0207658_10021249 | 3300025986 | Bacteria | 4503 |
| 229 | Ga0207703_10037117 | 3300026035 | Bacteria | 3881 |
| 230 | Ga0207703_10038475 | 3300026035 | Bacteria | 3817 |
| 231 | Ga0207639_10037317 | 3300026041 | Bacteria | 3609 |
| 232 | Ga0207678_10000514 | 3300026067 | Bacteria | 35082 |
| 233 | Ga0207678_10021134 | 3300026067 | Bacteria | 5704 |
| 234 | Ga0207678_10163485 | 3300026067 | Bacteria | 1901 |
| 235 | Ga0207708_10004413 | 3300026075 | Bacteria | 10368 |
| 236 | Ga0207708_10236397 | 3300026075 | Unclassified | 1468 |
| 237 | Ga0207641_10000047 | 3300026088 | Bacteria | 179977 |
| 238 | Ga0207641_10034421 | 3300026088 | Bacteria | 4214 |
| 239 | Ga0207641_10068714 | 3300026088 | Unclassified | 3038 |
| 240 | Ga0207641_10142261 | 3300026088 | Bacteria | 2166 |
| 241 | Ga0207641_10194427 | 3300026088 | Bacteria | 1866 |
| 242 | Ga0207648_10000163 | 3300026089 | Bacteria | 68352 |
| 243 | Ga0207648_10007528 | 3300026089 | Bacteria | 10690 |
| 244 | Ga0207648_10020631 | 3300026089 | Bacteria | 5932 |
| 245 | Ga0207648_10160874 | 3300026089 | Bacteria | 1983 |
| 246 | Ga0207676_10003712 | 3300026095 | Bacteria | 10798 |
| 247 | Ga0207676_10007400 | 3300026095 | Bacteria | 7786 |
| 248 | Ga0207676_10108145 | 3300026095 | Bacteria | 2321 |
| 249 | Ga0207674_10013533 | 3300026116 | Bacteria | 9045 |
| 250 | Ga0207674_10118700 | 3300026116 | Bacteria | 2615 |
| 251 | Ga0207675_100243305 | 3300026118 | Bacteria | 1739 |
| 252 | Ga0207683_10135940 | 3300026121 | Unclassified | 2213 |
| 253 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 254 | Ga0207428_10000236 | 3300027907 | Bacteria | 75764 |
| 255 | Ga0207428_10013853 | 3300027907 | Bacteria | 7025 |
| 256 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 257 | Ga0268266_10002110 | 3300028379 | Bacteria | 21956 |
| 258 | Ga0268265_10145558 | 3300028380 | Bacteria | 1990 |
| 259 | Ga0268264_10104480 | 3300028381 | Bacteria | 2469 |
| 260 | Ga0268264_10185733 | 3300028381 | Bacteria | 1891 |
| 261 | Ga0268264_10259479 | 3300028381 | Bacteria | 1618 |
| 262 | Ga0265334_10051338 | 3300028573 | Bacteria | 1581 |
| 263 | Ga0265338_10003114 | 3300028800 | Bacteria | 23744 |
| 264 | Ga0265338_10013194 | 3300028800 | Bacteria | 9351 |
| 265 | Ga0265338_10193483 | 3300028800 | Bacteria | 1539 |
| 266 | Ga0265320_10026255 | 3300031240 | Bacteria | 3051 |
| 267 | Ga0307509_10000177 | 3300031507 | Bacteria | 100248 |
| 268 | Ga0307509_10019902 | 3300031507 | Bacteria | 7634 |
| 269 | Ga0307408_100003770 | 3300031548 | Bacteria | 10322 |
| 270 | Ga0265314_10000723 | 3300031711 | Bacteria | 39953 |
| 271 | Ga0307405_10272463 | 3300031731 | Bacteria | 1270 |
| 272 | Ga0307410_10004781 | 3300031852 | Bacteria | 7067 |
| 273 | Ga0307410_10017215 | 3300031852 | Bacteria | 4334 |
| 274 | Ga0307412_10006138 | 3300031911 | Bacteria | 6771 |
| 275 | Ga0307409_100148699 | 3300031995 | Bacteria | 2030 |
| 276 | Ga0307416_100011157 | 3300032002 | Bacteria | 5975 |
| 277 | Ga0307414_10003031 | 3300032004 | Bacteria | 8906 |
| 278 | Ga0307411_10001140 | 3300032005 | Bacteria | 10411 |
| 279 | Ga0307411_10002736 | 3300032005 | Bacteria | 7919 |
| 280 | Ga0307411_10004799 | 3300032005 | Bacteria | 6550 |
| 281 | Ga0307411_10007613 | 3300032005 | Bacteria | 5539 |
| 282 | Ga0307411_10053099 | 3300032005 | Bacteria | 2653 |
| 283 | Ga0307507_10135975 | 3300033179 | Bacteria | 1903 |
| 284 | Ga0373923_0017209 | 3300035111 | Bacteria | 2761 |
| 285 | Ga0373923_0089820 | 3300035111 | Bacteria | 1342 |
| 286 | Ga0373954_0108064 | 3300035118 | Bacteria | 1345 |
| 287 | Ga0373935_0044718 | 3300035692 | Bacteria | 2792 |
| 288 | Ga0373947_0013053 | 3300035725 | Bacteria | 4763 |
| 289 | Ga0373937_0000854 | 3300036401 | Bacteria | 26110 |
| 290 | Ga0373937_0039412 | 3300036401 | Bacteria | 4306 |
| 291 | Ga0373937_0085911 | 3300036401 | Bacteria | 2911 |
| 292 | Ga0373937_0214270 | 3300036401 | Bacteria | 1812 |
| 293 | Ga0373937_0439307 | 3300036401 | Unclassified | 1239 |
| 294 | Ga0373937_0570391 | 3300036401 | Unclassified | 1075 |
| 295 | Ga0373925_0316642 | 3300037068 | Bacteria | 1262 |
| 296 | Ga0395898_0002294 | 3300037466 | Bacteria | 22975 |
| 297 | Ga0436365_0439305 | 3300039437 | Bacteria | 1356 |
| 298 | Ga0436363_0069527 | 3300039450 | Bacteria | 3132 |
| 299 | Ga0439462_0014781 | 3300042015 | Bacteria | 2008 |
| 300 | Ga0450898_017538 | 3300042134 | Bacteria | 1232 |
| 301 | Ga0439434_0003730 | 3300042435 | Bacteria | 4450 |
| 302 | Ga0439435_0000942 | 3300042436 | Bacteria | 5058 |
| 303 | Ga0466969_0006141 | 3300044656 | Bacteria | 6396 |
| 304 | Ga0466972_0038922 | 3300044658 | Bacteria | 2322 |
| 305 | Ga0453683_0000336 | 3300044673 | Bacteria | 57199 |
| 306 | Ga0466965_0171467 | 3300044683 | Bacteria | 1142 |
| 307 | Ga0466966_0028225 | 3300044684 | Bacteria | 3657 |
| 308 | Ga0466968_0089647 | 3300044735 | Bacteria | 1361 |
| 309 | Ga0466970_0070616 | 3300044765 | Bacteria | 1878 |
| 310 | Ga0466957_0142732 | 3300044842 | Bacteria | 1544 |
| 311 | Ga0466959_0006916 | 3300045049 | Bacteria | 7923 |
| 312 | Ga0451576_0058363 | 3300045051 | Bacteria | 4033 |
| 313 | Ga0495592_0074702 | 3300046454 | Bacteria | 2462 |
| 314 | Ga0495651_0000170 | 3300046462 | Bacteria | 48007 |
| 315 | Ga0495651_0004635 | 3300046462 | Bacteria | 10513 |
| 316 | Ga0495651_0010586 | 3300046462 | Bacteria | 7091 |
| 317 | Ga0495653_0004599 | 3300046463 | Bacteria | 11160 |
| 318 | Ga0495653_0006517 | 3300046463 | Bacteria | 9579 |
| 319 | Ga0495650_0045592 | 3300046471 | Unclassified | 1845 |
| 320 | Ga0495580_0160967 | 3300046472 | Unclassified | 1553 |
| 321 | Ga0495664_0020007 | 3300046477 | Unclassified | 3856 |
| 322 | Ga0495664_0049118 | 3300046477 | Bacteria | 2505 |
| 323 | Ga0495608_0039297 | 3300046511 | Unclassified | 3172 |
| 324 | Ga0495608_0101927 | 3300046511 | Unclassified | 1850 |
| 325 | Ga0495618_0003670 | 3300046514 | Bacteria | 9518 |
| 326 | Ga0495628_0007934 | 3300046516 | Bacteria | 9147 |
| 327 | Ga0495628_0136369 | 3300046516 | Unclassified | 1875 |
| 328 | Ga0495630_0041509 | 3300046517 | Unclassified | 3435 |
| 329 | Ga0495643_0003908 | 3300046522 | Bacteria | 10693 |
| 330 | Ga0495642_0018441 | 3300046528 | Bacteria | 2732 |
| 331 | Ga0495652_0007088 | 3300046529 | Bacteria | 10346 |
| 332 | Ga0495652_0009036 | 3300046529 | Bacteria | 9066 |
| 333 | Ga0495640_0150790 | 3300046533 | Bacteria | 1494 |
| 334 | Ga0495586_0012021 | 3300046535 | Bacteria | 4598 |
| 335 | Ga0495587_0000436 | 3300046536 | Bacteria | 29259 |
| 336 | Ga0495645_0046580 | 3300046543 | Bacteria | 3160 |
| 337 | Ga0495645_0057765 | 3300046543 | Unclassified | 2815 |
| 338 | Ga0495633_0025796 | 3300046558 | Bacteria | 2891 |
| 339 | Ga0495667_0000964 | 3300046559 | Bacteria | 18622 |
| 340 | Ga0495667_0006587 | 3300046559 | Bacteria | 7884 |
| 341 | Ga0495635_0094015 | 3300046663 | Unclassified | 2050 |
| 342 | Ga0495635_0192767 | 3300046663 | Unclassified | 1383 |
| 343 | Ga0495657_0004381 | 3300046675 | Bacteria | 11265 |
| 344 | Ga0495657_0020238 | 3300046675 | Bacteria | 4786 |
| 345 | Ga0495599_0019438 | 3300046678 | Unclassified | 4234 |
| 346 | Ga0495623_0009634 | 3300046679 | Bacteria | 6270 |
| 347 | Ga0495624_0033200 | 3300046690 | Bacteria | 3343 |
| 348 | Ga0495671_0014646 | 3300046692 | Bacteria | 4215 |
| 349 | Ga0495600_0005825 | 3300046809 | Bacteria | 7450 |
| 350 | Ga0495600_0014915 | 3300046809 | Bacteria | 4905 |
| 351 | Ga0495604_0000750 | 3300047317 | Bacteria | 27284 |
| 352 | Ga0495674_0001869 | 3300047319 | Bacteria | 20745 |
| 353 | Ga0495680_0002401 | 3300047322 | Bacteria | 19217 |
| 354 | Ga0495675_0000237 | 3300047444 | Bacteria | 39871 |
| 355 | Ga0495675_0008651 | 3300047444 | Bacteria | 6313 |
| 356 | Ga0495684_0004533 | 3300047471 | Bacteria | 10853 |
| 357 | Ga0495602_0034103 | 3300048088 | Bacteria | 4766 |
| 358 | Ga0495602_0060138 | 3300048088 | Unclassified | 3313 |
| 359 | Ga0495614_0000732 | 3300048089 | Bacteria | 13880 |
| 360 | Ga0495615_0003905 | 3300048090 | Bacteria | 2546 |
| 361 | Ga0496100_0061807 | 3300048903 | Bacteria | 2469 |
| 362 | Ga0496105_0316056 | 3300048908 | Bacteria | 1253 |
| 363 | Ga0496106_0108454 | 3300048909 | Unclassified | 2160 |
| 364 | Ga0496109_0101518 | 3300048912 | Unclassified | 2670 |
| 365 | Ga0496112_0021098 | 3300048915 | Bacteria | 6188 |
| 366 | Ga0496113_0077150 | 3300048916 | Unclassified | 2547 |
| 367 | Ga0496114_0004968 | 3300048917 | Bacteria | 10372 |
| 368 | Ga0496114_0419139 | 3300048917 | Bacteria | 1186 |
| 369 | Ga0496119_0001382 | 3300048922 | Bacteria | 29525 |
| 370 | Ga0496120_0000197 | 3300048923 | Bacteria | 103378 |
| 371 | Ga0496120_0013276 | 3300048923 | Bacteria | 5555 |
| 372 | Ga0496121_0057500 | 3300048924 | Bacteria | 3223 |
| 373 | Ga0496121_0172523 | 3300048924 | Bacteria | 1569 |
| 374 | Ga0501034_0007394 | 3300049571 | Bacteria | 11698 |
| 375 | Ga0501034_0067714 | 3300049571 | Bacteria | 3582 |
| 376 | Ga0501036_0179037 | 3300049572 | Bacteria | 1785 |
| 377 | Ga0501038_0183775 | 3300049574 | Bacteria | 1686 |
| 378 | Ga0501042_0155245 | 3300049578 | Unclassified | 1651 |
| 379 | nmdc:mga09592_284218_c1 | 3300050508 | Unclassified | 1435 |
| 380 | nmdc:mga0qj67_64595_c1 | 3300050509 | Bacteria | 2912 |
| 381 | nmdc:mga08y16_17995_c1 | 3300050511 | Bacteria | 7443 |
| 382 | nmdc:mga08y16_243098_c1 | 3300050511 | Bacteria | 1860 |
| 383 | nmdc:mga08y16_464627_c1 | 3300050511 | Bacteria | 1289 |
| 384 | nmdc:mga08y16_51555_c1 | 3300050511 | Unclassified | 4305 |
| 385 | nmdc:mga0a205_185375_c1 | 3300050515 | Bacteria | 1974 |
| 386 | nmdc:mga0a205_475508_c1 | 3300050515 | Bacteria | 1108 |
| 387 | Ga0500643_003430 | 3300053087 | Bacteria | 7640 |
| 388 | Ga0500641_0066899 | 3300053096 | Bacteria | 1505 |
| 389 | Ga0500608_002331 | 3300053122 | Bacteria | 6892 |
| 390 | Ga0500573_0177332 | 3300053140 | Bacteria | 1148 |
| 391 | Ga0500585_011589 | 3300053144 | Bacteria | 2615 |
| 392 | Ga0500616_0001042 | 3300053153 | Bacteria | 29312 |
| 393 | Ga0500627_0027533 | 3300053158 | Bacteria | 2353 |
| 394 | Ga0500637_0085766 | 3300053178 | Bacteria | 1821 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005341 | Ga0070691_10041411 | Ga0070691_100414113 | 282 |
| 2 | 3300005545 | Ga0070695_100080439 | Ga0070695_1000804392 | 282 |
| 3 | 3300005617 | Ga0068859_100064104 | Ga0068859_1000641042 | 282 |
| 4 | 3300006844 | Ga0075428_100073369 | Ga0075428_1000733692 | 282 |
| 5 | 3300006880 | Ga0075429_100306632 | Ga0075429_1003066322 | 282 |
| 6 | 3300006931 | Ga0097620_100064103 | Ga0097620_1000641034 | 282 |
| 7 | 3300009094 | Ga0111539_10087531 | Ga0111539_100875313 | 282 |
| 8 | 3300009147 | Ga0114129_10670634 | Ga0114129_106706341 | 282 |
| 9 | 3300026089 | Ga0207648_10160874 | Ga0207648_101608742 | 282 |
| 10 | 3300028380 | Ga0268265_10145558 | Ga0268265_101455583 | 282 |
| 11 | 3300046472 | Ga0495580_0160967 | Ga0495580_0160967_638_1516 | 282 |
| 12 | 3300046663 | Ga0495635_0192767 | Ga0495635_0192767_483_1361 | 282 |
| 13 | 3300050508 | nmdc:mga09592_284218_c1 | nmdc:mga09592_284218_c1_182_1246 | 282 |
| 14 | 3300050511 | nmdc:mga08y16_51555_c1 | nmdc:mga08y16_51555_c1_2798_3862 | 282 |
| 15 | 3300006852 | Ga0075433_10170934 | Ga0075433_101709342 | 283 |
| 16 | 3300050515 | nmdc:mga0a205_185375_c1 | nmdc:mga0a205_185375_c1_174_1271 | 283 |
| 17 | 3300005544 | Ga0070686_100155790 | Ga0070686_1001557901 | 292 |
| 18 | 3300010375 | Ga0105239_10073142 | Ga0105239_100731423 | 292 |
| 19 | 3300037068 | Ga0373925_0316642 | Ga0373925_0316642_38_949 | 292 |
| 20 | 3300005331 | Ga0070670_100009785 | Ga0070670_1000097855 | 295 |
| 21 | 3300005335 | Ga0070666_10011800 | Ga0070666_100118003 | 295 |
| 22 | 3300005338 | Ga0068868_100024275 | Ga0068868_1000242755 | 295 |
| 23 | 3300005343 | Ga0070687_100064186 | Ga0070687_1000641862 | 295 |
| 24 | 3300005344 | Ga0070661_100009397 | Ga0070661_1000093975 | 295 |
| 25 | 3300005355 | Ga0070671_100001163 | Ga0070671_1000011638 | 295 |
| 26 | 3300005367 | Ga0070667_100017935 | Ga0070667_1000179355 | 295 |
| 27 | 3300005535 | Ga0070684_100027996 | Ga0070684_1000279964 | 295 |
| 28 | 3300005564 | Ga0070664_100009134 | Ga0070664_1000091345 | 295 |
| 29 | 3300005614 | Ga0068856_100115516 | Ga0068856_1001155163 | 295 |
| 30 | 3300005616 | Ga0068852_100070194 | Ga0068852_1000701943 | 295 |
| 31 | 3300005617 | Ga0068859_100028312 | Ga0068859_1000283123 | 295 |
| 32 | 3300005618 | Ga0068864_100009570 | Ga0068864_1000095706 | 295 |
| 33 | 3300005841 | Ga0068863_100016027 | Ga0068863_1000160276 | 295 |
| 34 | 3300005842 | Ga0068858_100004105 | Ga0068858_10000410514 | 295 |
| 35 | 3300006358 | Ga0068871_100137901 | Ga0068871_1001379012 | 295 |
| 36 | 3300006931 | Ga0097620_100028312 | Ga0097620_1000283123 | 295 |
| 37 | 3300009093 | Ga0105240_10140105 | Ga0105240_101401053 | 295 |
| 38 | 3300009101 | Ga0105247_10012697 | Ga0105247_100126975 | 295 |
| 39 | 3300011119 | Ga0105246_10003339 | Ga0105246_100033394 | 295 |
| 40 | 3300013296 | Ga0157374_10016788 | Ga0157374_100167886 | 295 |
| 41 | 3300013306 | Ga0163162_10016185 | Ga0163162_100161855 | 295 |
| 42 | 3300013308 | Ga0157375_10010310 | Ga0157375_100103103 | 295 |
| 43 | 3300014968 | Ga0157379_10010874 | Ga0157379_100108743 | 295 |
| 44 | 3300025918 | Ga0207662_10083283 | Ga0207662_100832831 | 295 |
| 45 | 3300025920 | Ga0207649_10018164 | Ga0207649_100181643 | 295 |
| 46 | 3300025927 | Ga0207687_10017055 | Ga0207687_100170553 | 295 |
| 47 | 3300025945 | Ga0207679_10028937 | Ga0207679_100289373 | 295 |
| 48 | 3300026088 | Ga0207641_10068714 | Ga0207641_100687142 | 295 |
| 49 | 3300026095 | Ga0207676_10003712 | Ga0207676_100037122 | 295 |
| 50 | 3300045051 | Ga0451576_0058363 | Ga0451576_0058363_283_1356 | 295 |
| 51 | 3300048912 | Ga0496109_0101518 | Ga0496109_0101518_1424_2497 | 295 |
| 52 | 3300048915 | Ga0496112_0021098 | Ga0496112_0021098_402_1475 | 295 |
| 53 | 3300048916 | Ga0496113_0077150 | Ga0496113_0077150_1135_2208 | 295 |
| 54 | 3300005843 | Ga0068860_100035517 | Ga0068860_1000355172 | 296 |
| 55 | 3300009098 | Ga0105245_10033146 | Ga0105245_100331465 | 296 |
| 56 | 3300009551 | Ga0105238_10060678 | Ga0105238_100606783 | 296 |
| 57 | 3300046533 | Ga0495640_0150790 | Ga0495640_0150790_546_1469 | 296 |
| 58 | 3300048903 | Ga0496100_0061807 | Ga0496100_0061807_787_1860 | 296 |
| 59 | 3300048908 | Ga0496105_0316056 | Ga0496105_0316056_32_1105 | 296 |
| 60 | 3300048909 | Ga0496106_0108454 | Ga0496106_0108454_805_1878 | 296 |
| 61 | 3300048917 | Ga0496114_0004968 | Ga0496114_0004968_145_1218 | 296 |
| 62 | 3300036401 | Ga0373937_0439307 | Ga0373937_0439307_291_1214 | 298 |
| 63 | 3300053096 | Ga0500641_0066899 | Ga0500641_0066899_285_1307 | 308 |
| 64 | 3300014326 | Ga0157380_10002109 | Ga0157380_1000210911 | 309 |
| 65 | 3300031240 | Ga0265320_10026255 | Ga0265320_100262551 | 309 |
| 66 | 3300039450 | Ga0436363_0069527 | Ga0436363_0069527_1578_2582 | 310 |
| 67 | 3300006847 | Ga0075431_100001583 | Ga0075431_1000015834 | 311 |
| 68 | 3300006880 | Ga0075429_100083241 | Ga0075429_1000832415 | 311 |
| 69 | 3300036401 | Ga0373937_0039412 | Ga0373937_0039412_1108_2226 | 312 |
| 70 | 3300046543 | Ga0495645_0057765 | Ga0495645_0057765_1816_2784 | 312 |
| 71 | 3300048923 | Ga0496120_0013276 | Ga0496120_0013276_724_1695 | 312 |
| 72 | 3300005455 | Ga0070663_100000420 | Ga0070663_1000004205 | 313 |
| 73 | 3300026067 | Ga0207678_10000514 | Ga0207678_1000051414 | 313 |
| 74 | 3300005347 | Ga0070668_100006199 | Ga0070668_1000061996 | 314 |
| 75 | 3300025972 | Ga0207668_10379410 | Ga0207668_103794101 | 314 |
| 76 | iso_pu_bacteria | 8003314358 | 8003320704 | 317 |
| 77 | 3300036401 | Ga0373937_0214270 | Ga0373937_0214270_249_1367 | 318 |
| 78 | 3300048924 | Ga0496121_0172523 | Ga0496121_0172523_141_1151 | 318 |
| 79 | iso_pu_bacteria | 2924762789 | 2924766023 | 318 |
| 80 | 3300005337 | Ga0070682_100014275 | Ga0070682_1000142754 | 319 |
| 81 | 3300009098 | Ga0105245_10040767 | Ga0105245_100407671 | 319 |
| 82 | 3300053140 | Ga0500573_0177332 | Ga0500573_0177332_28_1026 | 319 |
| 83 | 3300005548 | Ga0070665_100000011 | Ga0070665_10000001159 | 320 |
| 84 | 3300005841 | Ga0068863_100024156 | Ga0068863_1000241563 | 320 |
| 85 | 3300006871 | Ga0075434_100059280 | Ga0075434_1000592803 | 320 |
| 86 | 3300025927 | Ga0207687_10167585 | Ga0207687_101675851 | 320 |
| 87 | 3300026088 | Ga0207641_10034421 | Ga0207641_100344213 | 320 |
| 88 | 3300028379 | Ga0268266_10000063 | Ga0268266_1000006356 | 320 |
| 89 | 3300039437 | Ga0436365_0439305 | Ga0436365_0439305_178_1182 | 320 |
| 90 | 3300046528 | Ga0495642_0018441 | Ga0495642_0018441_1120_2124 | 320 |
| 91 | iso_pu_bacteria | 2919138771 | 2919140768 | 320 |
| 92 | 3300025294 | Ga0209025_1006935 | Ga0209025_10069355 | 321 |
| 93 | 3300025298 | Ga0209050_1025558 | Ga0209050_10255582 | 321 |
| 94 | 3300025972 | Ga0207668_10051590 | Ga0207668_100515903 | 321 |
| 95 | 3300033179 | Ga0307507_10135975 | Ga0307507_101359752 | 321 |
| 96 | 3300044658 | Ga0466972_0038922 | Ga0466972_0038922_597_1598 | 321 |
| 97 | 3300044683 | Ga0466965_0171467 | Ga0466965_0171467_44_1045 | 321 |
| 98 | 3300044735 | Ga0466968_0089647 | Ga0466968_0089647_142_1143 | 321 |
| 99 | 3300044765 | Ga0466970_0070616 | Ga0466970_0070616_157_1158 | 321 |
| 100 | 3300053153 | Ga0500616_0001042 | Ga0500616_0001042_180_1190 | 321 |
| 101 | 3300005327 | Ga0070658_10002449 | Ga0070658_1000244911 | 322 |
| 102 | 3300009093 | Ga0105240_10269282 | Ga0105240_102692822 | 322 |
| 103 | 3300010375 | Ga0105239_10019163 | Ga0105239_100191635 | 322 |
| 104 | 3300025909 | Ga0207705_10000890 | Ga0207705_1000089014 | 322 |
| 105 | 3300025949 | Ga0207667_10313124 | Ga0207667_103131242 | 322 |
| 106 | 3300026067 | Ga0207678_10163485 | Ga0207678_101634852 | 322 |
| 107 | 3300031507 | Ga0307509_10000177 | Ga0307509_1000017743 | 322 |
| 108 | 3300031507 | Ga0307509_10019902 | Ga0307509_100199028 | 322 |
| 109 | 3300053144 | Ga0500585_011589 | Ga0500585_011589_1267_2316 | 322 |
| 110 | iso_pu_bacteria | 2886627955 | 2886630619 | 322 |
| 111 | 3300005436 | Ga0070713_100052044 | Ga0070713_1000520443 | 323 |
| 112 | 3300005563 | Ga0068855_100238462 | Ga0068855_1002384622 | 323 |
| 113 | 3300006946 | Ga0079104_1000014 | Ga0079104_1000014162 | 323 |
| 114 | 3300025949 | Ga0207667_10202184 | Ga0207667_102021842 | 323 |
| 115 | 3300027111 | Ga0209281_1000032 | Ga0209281_1000032162 | 323 |
| 116 | 3300028800 | Ga0265338_10193483 | Ga0265338_101934831 | 323 |
| 117 | 3300032004 | Ga0307414_10003031 | Ga0307414_100030317 | 323 |
| 118 | 3300046471 | Ga0495650_0045592 | Ga0495650_0045592_55_1056 | 323 |
| 119 | 3300053087 | Ga0500643_003430 | Ga0500643_003430_3775_4788 | 323 |
| 120 | iso_pu_bacteria | 2617270889 | 2617918848 | 323 |
| 121 | iso_pu_bacteria | 2913912277 | 2913916593 | 323 |
| 122 | iso_pu_bacteria | 2913939268 | 2913940661 | 323 |
| 123 | iso_pu_bacteria | 642555144 | 642601612 | 323 |
| 124 | 3300005289 | Ga0065704_10074622 | Ga0065704_100746222 | 324 |
| 125 | 3300005295 | Ga0065707_10084107 | Ga0065707_100841071 | 324 |
| 126 | 3300005335 | Ga0070666_10027774 | Ga0070666_100277744 | 324 |
| 127 | 3300005338 | Ga0068868_100028688 | Ga0068868_1000286883 | 324 |
| 128 | 3300005367 | Ga0070667_100015957 | Ga0070667_1000159576 | 324 |
| 129 | 3300005458 | Ga0070681_10016203 | Ga0070681_100162035 | 324 |
| 130 | 3300005458 | Ga0070681_10283569 | Ga0070681_102835691 | 324 |
| 131 | 3300005459 | Ga0068867_100029873 | Ga0068867_1000298732 | 324 |
| 132 | 3300005539 | Ga0068853_100292222 | Ga0068853_1002922221 | 324 |
| 133 | 3300005563 | Ga0068855_100062305 | Ga0068855_1000623052 | 324 |
| 134 | 3300005577 | Ga0068857_100011738 | Ga0068857_1000117385 | 324 |
| 135 | 3300005614 | Ga0068856_100167904 | Ga0068856_1001679042 | 324 |
| 136 | 3300005617 | Ga0068859_100136487 | Ga0068859_1001364872 | 324 |
| 137 | 3300005841 | Ga0068863_100087985 | Ga0068863_1000879852 | 324 |
| 138 | 3300005841 | Ga0068863_100252727 | Ga0068863_1002527273 | 324 |
| 139 | 3300005842 | Ga0068858_100133088 | Ga0068858_1001330884 | 324 |
| 140 | 3300005843 | Ga0068860_100017992 | Ga0068860_1000179927 | 324 |
| 141 | 3300006028 | Ga0070717_10011440 | Ga0070717_100114402 | 324 |
| 142 | 3300006237 | Ga0097621_100016251 | Ga0097621_1000162517 | 324 |
| 143 | 3300006237 | Ga0097621_100023244 | Ga0097621_1000232442 | 324 |
| 144 | 3300006358 | Ga0068871_100007824 | Ga0068871_1000078245 | 324 |
| 145 | 3300006358 | Ga0068871_100163797 | Ga0068871_1001637971 | 324 |
| 146 | 3300006844 | Ga0075428_100195025 | Ga0075428_1001950252 | 324 |
| 147 | 3300006846 | Ga0075430_100083304 | Ga0075430_1000833043 | 324 |
| 148 | 3300006852 | Ga0075433_10134226 | Ga0075433_101342261 | 324 |
| 149 | 3300006881 | Ga0068865_100328484 | Ga0068865_1003284842 | 324 |
| 150 | 3300006931 | Ga0097620_100136486 | Ga0097620_1001364862 | 324 |
| 151 | 3300007788 | Ga0099795_10049613 | Ga0099795_100496132 | 324 |
| 152 | 3300009036 | Ga0105244_10000055 | Ga0105244_1000005568 | 324 |
| 153 | 3300009093 | Ga0105240_10003389 | Ga0105240_1000338911 | 324 |
| 154 | 3300009093 | Ga0105240_10198532 | Ga0105240_101985323 | 324 |
| 155 | 3300009094 | Ga0111539_10011819 | Ga0111539_100118196 | 324 |
| 156 | 3300009098 | Ga0105245_10010745 | Ga0105245_100107455 | 324 |
| 157 | 3300009098 | Ga0105245_10018954 | Ga0105245_100189542 | 324 |
| 158 | 3300009174 | Ga0105241_10020485 | Ga0105241_100204856 | 324 |
| 159 | 3300009176 | Ga0105242_10024635 | Ga0105242_100246355 | 324 |
| 160 | 3300009177 | Ga0105248_10011812 | Ga0105248_100118122 | 324 |
| 161 | 3300009177 | Ga0105248_10023511 | Ga0105248_100235114 | 324 |
| 162 | 3300009177 | Ga0105248_10578338 | Ga0105248_105783382 | 324 |
| 163 | 3300009551 | Ga0105238_10078149 | Ga0105238_100781495 | 324 |
| 164 | 3300010375 | Ga0105239_10399075 | Ga0105239_103990752 | 324 |
| 165 | 3300013104 | Ga0157370_10013344 | Ga0157370_100133442 | 324 |
| 166 | 3300013105 | Ga0157369_10034038 | Ga0157369_100340386 | 324 |
| 167 | 3300013306 | Ga0163162_10119234 | Ga0163162_101192343 | 324 |
| 168 | 3300013307 | Ga0157372_10288627 | Ga0157372_102886272 | 324 |
| 169 | 3300014325 | Ga0163163_10014187 | Ga0163163_100141873 | 324 |
| 170 | 3300014325 | Ga0163163_10019887 | Ga0163163_100198877 | 324 |
| 171 | 3300014968 | Ga0157379_10031297 | Ga0157379_100312975 | 324 |
| 172 | 3300025728 | Ga0207655_1000004 | Ga0207655_1000004831 | 324 |
| 173 | 3300025903 | Ga0207680_10015649 | Ga0207680_100156493 | 324 |
| 174 | 3300025912 | Ga0207707_10058583 | Ga0207707_100585834 | 324 |
| 175 | 3300025913 | Ga0207695_10055995 | Ga0207695_100559952 | 324 |
| 176 | 3300025914 | Ga0207671_10016410 | Ga0207671_100164103 | 324 |
| 177 | 3300025921 | Ga0207652_10070036 | Ga0207652_100700362 | 324 |
| 178 | 3300025924 | Ga0207694_10015983 | Ga0207694_100159834 | 324 |
| 179 | 3300025927 | Ga0207687_10006980 | Ga0207687_100069807 | 324 |
| 180 | 3300025934 | Ga0207686_10017266 | Ga0207686_100172662 | 324 |
| 181 | 3300025934 | Ga0207686_10120443 | Ga0207686_101204433 | 324 |
| 182 | 3300025934 | Ga0207686_10150362 | Ga0207686_101503622 | 324 |
| 183 | 3300025938 | Ga0207704_10107606 | Ga0207704_101076062 | 324 |
| 184 | 3300025941 | Ga0207711_10014014 | Ga0207711_100140146 | 324 |
| 185 | 3300025941 | Ga0207711_10450733 | Ga0207711_104507331 | 324 |
| 186 | 3300025949 | Ga0207667_10046106 | Ga0207667_100461062 | 324 |
| 187 | 3300025949 | Ga0207667_10247172 | Ga0207667_102471722 | 324 |
| 188 | 3300025986 | Ga0207658_10021249 | Ga0207658_100212494 | 324 |
| 189 | 3300026035 | Ga0207703_10037117 | Ga0207703_100371174 | 324 |
| 190 | 3300026041 | Ga0207639_10037317 | Ga0207639_100373173 | 324 |
| 191 | 3300026088 | Ga0207641_10194427 | Ga0207641_101944273 | 324 |
| 192 | 3300026089 | Ga0207648_10007528 | Ga0207648_100075286 | 324 |
| 193 | 3300026089 | Ga0207648_10020631 | Ga0207648_100206312 | 324 |
| 194 | 3300026095 | Ga0207676_10108145 | Ga0207676_101081454 | 324 |
| 195 | 3300026116 | Ga0207674_10013533 | Ga0207674_100135337 | 324 |
| 196 | 3300026116 | Ga0207674_10118700 | Ga0207674_101187002 | 324 |
| 197 | 3300027907 | Ga0207428_10000236 | Ga0207428_1000023633 | 324 |
| 198 | 3300028381 | Ga0268264_10259479 | Ga0268264_102594792 | 324 |
| 199 | 3300031711 | Ga0265314_10000723 | Ga0265314_1000072334 | 324 |
| 200 | 3300035692 | Ga0373935_0044718 | Ga0373935_0044718_1178_2185 | 324 |
| 201 | 3300035725 | Ga0373947_0013053 | Ga0373947_0013053_323_1330 | 324 |
| 202 | 3300036401 | Ga0373937_0000854 | Ga0373937_0000854_15855_16862 | 324 |
| 203 | 3300036401 | Ga0373937_0570391 | Ga0373937_0570391_15_1022 | 324 |
| 204 | 3300044842 | Ga0466957_0142732 | Ga0466957_0142732_81_1094 | 324 |
| 205 | 3300046454 | Ga0495592_0074702 | Ga0495592_0074702_190_1197 | 324 |
| 206 | 3300046462 | Ga0495651_0000170 | Ga0495651_0000170_12835_13842 | 324 |
| 207 | 3300046462 | Ga0495651_0004635 | Ga0495651_0004635_2948_3955 | 324 |
| 208 | 3300046462 | Ga0495651_0010586 | Ga0495651_0010586_2625_3632 | 324 |
| 209 | 3300046463 | Ga0495653_0004599 | Ga0495653_0004599_4559_5566 | 324 |
| 210 | 3300046463 | Ga0495653_0006517 | Ga0495653_0006517_2831_3838 | 324 |
| 211 | 3300046477 | Ga0495664_0020007 | Ga0495664_0020007_670_1677 | 324 |
| 212 | 3300046477 | Ga0495664_0049118 | Ga0495664_0049118_769_1776 | 324 |
| 213 | 3300046511 | Ga0495608_0039297 | Ga0495608_0039297_135_1142 | 324 |
| 214 | 3300046511 | Ga0495608_0101927 | Ga0495608_0101927_463_1470 | 324 |
| 215 | 3300046514 | Ga0495618_0003670 | Ga0495618_0003670_7705_8712 | 324 |
| 216 | 3300046516 | Ga0495628_0007934 | Ga0495628_0007934_2558_3565 | 324 |
| 217 | 3300046516 | Ga0495628_0136369 | Ga0495628_0136369_83_1090 | 324 |
| 218 | 3300046517 | Ga0495630_0041509 | Ga0495630_0041509_2258_3265 | 324 |
| 219 | 3300046529 | Ga0495652_0007088 | Ga0495652_0007088_1588_2595 | 324 |
| 220 | 3300046529 | Ga0495652_0009036 | Ga0495652_0009036_1685_2692 | 324 |
| 221 | 3300046535 | Ga0495586_0012021 | Ga0495586_0012021_432_1439 | 324 |
| 222 | 3300046536 | Ga0495587_0000436 | Ga0495587_0000436_14228_15235 | 324 |
| 223 | 3300046543 | Ga0495645_0046580 | Ga0495645_0046580_18_1025 | 324 |
| 224 | 3300046559 | Ga0495667_0000964 | Ga0495667_0000964_8398_9405 | 324 |
| 225 | 3300046559 | Ga0495667_0006587 | Ga0495667_0006587_6024_7031 | 324 |
| 226 | 3300046663 | Ga0495635_0094015 | Ga0495635_0094015_145_1152 | 324 |
| 227 | 3300046675 | Ga0495657_0004381 | Ga0495657_0004381_6276_7283 | 324 |
| 228 | 3300046675 | Ga0495657_0020238 | Ga0495657_0020238_710_1717 | 324 |
| 229 | 3300046678 | Ga0495599_0019438 | Ga0495599_0019438_3102_4109 | 324 |
| 230 | 3300046679 | Ga0495623_0009634 | Ga0495623_0009634_3242_4249 | 324 |
| 231 | 3300046690 | Ga0495624_0033200 | Ga0495624_0033200_1178_2185 | 324 |
| 232 | 3300046692 | Ga0495671_0014646 | Ga0495671_0014646_2585_3601 | 324 |
| 233 | 3300046809 | Ga0495600_0005825 | Ga0495600_0005825_3611_4618 | 324 |
| 234 | 3300046809 | Ga0495600_0014915 | Ga0495600_0014915_3736_4743 | 324 |
| 235 | 3300047317 | Ga0495604_0000750 | Ga0495604_0000750_6265_7272 | 324 |
| 236 | 3300047319 | Ga0495674_0001869 | Ga0495674_0001869_5788_6795 | 324 |
| 237 | 3300047322 | Ga0495680_0002401 | Ga0495680_0002401_13341_14348 | 324 |
| 238 | 3300047444 | Ga0495675_0000237 | Ga0495675_0000237_6288_7295 | 324 |
| 239 | 3300047444 | Ga0495675_0008651 | Ga0495675_0008651_1024_2031 | 324 |
| 240 | 3300047471 | Ga0495684_0004533 | Ga0495684_0004533_4237_5244 | 324 |
| 241 | 3300048088 | Ga0495602_0034103 | Ga0495602_0034103_2353_3360 | 324 |
| 242 | 3300048088 | Ga0495602_0060138 | Ga0495602_0060138_86_1093 | 324 |
| 243 | 3300048089 | Ga0495614_0000732 | Ga0495614_0000732_11635_12642 | 324 |
| 244 | 3300048090 | Ga0495615_0003905 | Ga0495615_0003905_37_1044 | 324 |
| 245 | 3300048917 | Ga0496114_0419139 | Ga0496114_0419139_113_1126 | 324 |
| 246 | 3300048924 | Ga0496121_0057500 | Ga0496121_0057500_2038_3051 | 324 |
| 247 | 3300049571 | Ga0501034_0007394 | Ga0501034_0007394_4406_5428 | 324 |
| 248 | 3300050509 | nmdc:mga0qj67_64595_c1 | nmdc:mga0qj67_64595_c1_1767_2780 | 324 |
| 249 | 3300050515 | nmdc:mga0a205_475508_c1 | nmdc:mga0a205_475508_c1_48_1061 | 324 |
| 250 | 3300053122 | Ga0500608_002331 | Ga0500608_002331_578_1585 | 324 |
| 251 | 3300053158 | Ga0500627_0027533 | Ga0500627_0027533_1191_2228 | 324 |
| 252 | 3300005328 | Ga0070676_10004357 | Ga0070676_100043576 | 325 |
| 253 | 3300005331 | Ga0070670_100007118 | Ga0070670_1000071183 | 325 |
| 254 | 3300005334 | Ga0068869_100020879 | Ga0068869_1000208793 | 325 |
| 255 | 3300005337 | Ga0070682_100125408 | Ga0070682_1001254082 | 325 |
| 256 | 3300005353 | Ga0070669_100145334 | Ga0070669_1001453341 | 325 |
| 257 | 3300005353 | Ga0070669_100176330 | Ga0070669_1001763301 | 325 |
| 258 | 3300005354 | Ga0070675_100003673 | Ga0070675_1000036737 | 325 |
| 259 | 3300005354 | Ga0070675_100030115 | Ga0070675_1000301152 | 325 |
| 260 | 3300005355 | Ga0070671_100143452 | Ga0070671_1001434521 | 325 |
| 261 | 3300005364 | Ga0070673_100003826 | Ga0070673_1000038264 | 325 |
| 262 | 3300005438 | Ga0070701_10026504 | Ga0070701_100265043 | 325 |
| 263 | 3300005456 | Ga0070678_100093216 | Ga0070678_1000932164 | 325 |
| 264 | 3300005459 | Ga0068867_100147622 | Ga0068867_1001476222 | 325 |
| 265 | 3300005466 | Ga0070685_10013788 | Ga0070685_100137884 | 325 |
| 266 | 3300005543 | Ga0070672_100006726 | Ga0070672_1000067265 | 325 |
| 267 | 3300005719 | Ga0068861_100020458 | Ga0068861_1000204582 | 325 |
| 268 | 3300005834 | Ga0068851_10025491 | Ga0068851_100254914 | 325 |
| 269 | 3300005841 | Ga0068863_100000534 | Ga0068863_10000053416 | 325 |
| 270 | 3300005842 | Ga0068858_100012417 | Ga0068858_1000124178 | 325 |
| 271 | 3300005843 | Ga0068860_100011410 | Ga0068860_1000114109 | 325 |
| 272 | 3300005843 | Ga0068860_100092238 | Ga0068860_1000922383 | 325 |
| 273 | 3300009093 | Ga0105240_10018292 | Ga0105240_100182923 | 325 |
| 274 | 3300009094 | Ga0111539_10373537 | Ga0111539_103735372 | 325 |
| 275 | 3300009148 | Ga0105243_10392477 | Ga0105243_103924771 | 325 |
| 276 | 3300009551 | Ga0105238_10025114 | Ga0105238_100251142 | 325 |
| 277 | 3300014325 | Ga0163163_10006452 | Ga0163163_100064523 | 325 |
| 278 | 3300014325 | Ga0163163_10239767 | Ga0163163_102397672 | 325 |
| 279 | 3300014326 | Ga0157380_10152912 | Ga0157380_101529123 | 325 |
| 280 | 3300025315 | Ga0207697_10045680 | Ga0207697_100456802 | 325 |
| 281 | 3300025321 | Ga0207656_10016079 | Ga0207656_100160792 | 325 |
| 282 | 3300025893 | Ga0207682_10033296 | Ga0207682_100332962 | 325 |
| 283 | 3300025908 | Ga0207643_10073591 | Ga0207643_100735912 | 325 |
| 284 | 3300025913 | Ga0207695_10094912 | Ga0207695_100949123 | 325 |
| 285 | 3300025918 | Ga0207662_10149119 | Ga0207662_101491192 | 325 |
| 286 | 3300025924 | Ga0207694_10018700 | Ga0207694_100187002 | 325 |
| 287 | 3300025924 | Ga0207694_10154515 | Ga0207694_101545151 | 325 |
| 288 | 3300025925 | Ga0207650_10016546 | Ga0207650_100165463 | 325 |
| 289 | 3300025926 | Ga0207659_10007137 | Ga0207659_100071376 | 325 |
| 290 | 3300025926 | Ga0207659_10010426 | Ga0207659_100104264 | 325 |
| 291 | 3300025931 | Ga0207644_10119094 | Ga0207644_101190943 | 325 |
| 292 | 3300025934 | Ga0207686_10164085 | Ga0207686_101640851 | 325 |
| 293 | 3300025936 | Ga0207670_10111157 | Ga0207670_101111571 | 325 |
| 294 | 3300025938 | Ga0207704_10101111 | Ga0207704_101011112 | 325 |
| 295 | 3300025940 | Ga0207691_10010581 | Ga0207691_100105813 | 325 |
| 296 | 3300025940 | Ga0207691_10178136 | Ga0207691_101781361 | 325 |
| 297 | 3300025942 | Ga0207689_10088654 | Ga0207689_100886542 | 325 |
| 298 | 3300025945 | Ga0207679_10041387 | Ga0207679_100413874 | 325 |
| 299 | 3300025960 | Ga0207651_10069635 | Ga0207651_100696351 | 325 |
| 300 | 3300026035 | Ga0207703_10038475 | Ga0207703_100384755 | 325 |
| 301 | 3300026067 | Ga0207678_10021134 | Ga0207678_100211344 | 325 |
| 302 | 3300026075 | Ga0207708_10004413 | Ga0207708_1000441311 | 325 |
| 303 | 3300026088 | Ga0207641_10000047 | Ga0207641_1000004794 | 325 |
| 304 | 3300026088 | Ga0207641_10142261 | Ga0207641_101422611 | 325 |
| 305 | 3300026089 | Ga0207648_10000163 | Ga0207648_1000016316 | 325 |
| 306 | 3300026118 | Ga0207675_100243305 | Ga0207675_1002433052 | 325 |
| 307 | 3300026121 | Ga0207683_10135940 | Ga0207683_101359402 | 325 |
| 308 | 3300028381 | Ga0268264_10104480 | Ga0268264_101044802 | 325 |
| 309 | 3300028800 | Ga0265338_10003114 | Ga0265338_100031147 | 325 |
| 310 | 3300031548 | Ga0307408_100003770 | Ga0307408_1000037707 | 325 |
| 311 | 3300031731 | Ga0307405_10272463 | Ga0307405_102724631 | 325 |
| 312 | 3300031852 | Ga0307410_10004781 | Ga0307410_100047812 | 325 |
| 313 | 3300031995 | Ga0307409_100148699 | Ga0307409_1001486993 | 325 |
| 314 | 3300032002 | Ga0307416_100011157 | Ga0307416_1000111574 | 325 |
| 315 | 3300032005 | Ga0307411_10001140 | Ga0307411_100011409 | 325 |
| 316 | 3300032005 | Ga0307411_10004799 | Ga0307411_100047999 | 325 |
| 317 | 3300032005 | Ga0307411_10053099 | Ga0307411_100530993 | 325 |
| 318 | 3300042015 | Ga0439462_0014781 | Ga0439462_0014781_644_1768 | 325 |
| 319 | 3300042134 | Ga0450898_017538 | Ga0450898_017538_37_1161 | 325 |
| 320 | 3300042435 | Ga0439434_0003730 | Ga0439434_0003730_1494_2618 | 325 |
| 321 | 3300042436 | Ga0439435_0000942 | Ga0439435_0000942_2141_3265 | 325 |
| 322 | 3300046522 | Ga0495643_0003908 | Ga0495643_0003908_6163_7266 | 325 |
| 323 | 3300048922 | Ga0496119_0001382 | Ga0496119_0001382_1053_2081 | 325 |
| 324 | 3300048923 | Ga0496120_0000197 | Ga0496120_0000197_99561_100589 | 325 |
| 325 | 3300049571 | Ga0501034_0067714 | Ga0501034_0067714_1429_2460 | 325 |
| 326 | 3300049572 | Ga0501036_0179037 | Ga0501036_0179037_16_1047 | 325 |
| 327 | 3300049574 | Ga0501038_0183775 | Ga0501038_0183775_60_1181 | 325 |
| 328 | 3300049578 | Ga0501042_0155245 | Ga0501042_0155245_171_1274 | 325 |
| 329 | 3300005329 | Ga0070683_100165294 | Ga0070683_1001652942 | 326 |
| 330 | 3300005329 | Ga0070683_100323699 | Ga0070683_1003236992 | 326 |
| 331 | 3300005336 | Ga0070680_100034364 | Ga0070680_1000343641 | 326 |
| 332 | 3300005343 | Ga0070687_100076613 | Ga0070687_1000766132 | 326 |
| 333 | 3300005364 | Ga0070673_100028400 | Ga0070673_1000284003 | 326 |
| 334 | 3300005365 | Ga0070688_100046830 | Ga0070688_1000468302 | 326 |
| 335 | 3300005436 | Ga0070713_100082912 | Ga0070713_1000829122 | 326 |
| 336 | 3300005441 | Ga0070700_100060139 | Ga0070700_1000601393 | 326 |
| 337 | 3300005518 | Ga0070699_100114901 | Ga0070699_1001149011 | 326 |
| 338 | 3300005530 | Ga0070679_100003262 | Ga0070679_1000032622 | 326 |
| 339 | 3300005530 | Ga0070679_100056130 | Ga0070679_1000561303 | 326 |
| 340 | 3300005535 | Ga0070684_100025007 | Ga0070684_1000250075 | 326 |
| 341 | 3300005544 | Ga0070686_100053460 | Ga0070686_1000534602 | 326 |
| 342 | 3300005548 | Ga0070665_100011449 | Ga0070665_1000114498 | 326 |
| 343 | 3300005563 | Ga0068855_100101599 | Ga0068855_1001015992 | 326 |
| 344 | 3300005564 | Ga0070664_100005933 | Ga0070664_1000059333 | 326 |
| 345 | 3300005618 | Ga0068864_100028054 | Ga0068864_1000280543 | 326 |
| 346 | 3300005843 | Ga0068860_100227261 | Ga0068860_1002272612 | 326 |
| 347 | 3300005844 | Ga0068862_100092857 | Ga0068862_1000928573 | 326 |
| 348 | 3300006880 | Ga0075429_100224735 | Ga0075429_1002247351 | 326 |
| 349 | 3300009093 | Ga0105240_10040549 | Ga0105240_100405494 | 326 |
| 350 | 3300009094 | Ga0111539_10000509 | Ga0111539_1000050913 | 326 |
| 351 | 3300009545 | Ga0105237_10027328 | Ga0105237_100273284 | 326 |
| 352 | 3300009551 | Ga0105238_10031325 | Ga0105238_100313255 | 326 |
| 353 | 3300009551 | Ga0105238_10165677 | Ga0105238_101656772 | 326 |
| 354 | 3300009551 | Ga0105238_10257244 | Ga0105238_102572442 | 326 |
| 355 | 3300013105 | Ga0157369_10045232 | Ga0157369_100452323 | 326 |
| 356 | 3300013105 | Ga0157369_10064276 | Ga0157369_100642761 | 326 |
| 357 | 3300013307 | Ga0157372_10028281 | Ga0157372_100282814 | 326 |
| 358 | 3300013307 | Ga0157372_10218635 | Ga0157372_102186352 | 326 |
| 359 | 3300025913 | Ga0207695_10039731 | Ga0207695_100397312 | 326 |
| 360 | 3300025914 | Ga0207671_10038320 | Ga0207671_100383202 | 326 |
| 361 | 3300025918 | Ga0207662_10168126 | Ga0207662_101681262 | 326 |
| 362 | 3300025921 | Ga0207652_10076496 | Ga0207652_100764962 | 326 |
| 363 | 3300025921 | Ga0207652_10083918 | Ga0207652_100839182 | 326 |
| 364 | 3300025924 | Ga0207694_10026609 | Ga0207694_100266095 | 326 |
| 365 | 3300025924 | Ga0207694_10197209 | Ga0207694_101972091 | 326 |
| 366 | 3300025925 | Ga0207650_10005888 | Ga0207650_100058884 | 326 |
| 367 | 3300025928 | Ga0207700_10013828 | Ga0207700_100138283 | 326 |
| 368 | 3300025928 | Ga0207700_10262126 | Ga0207700_102621261 | 326 |
| 369 | 3300025940 | Ga0207691_10015959 | Ga0207691_100159592 | 326 |
| 370 | 3300025949 | Ga0207667_10022329 | Ga0207667_100223292 | 326 |
| 371 | 3300025960 | Ga0207651_10063710 | Ga0207651_100637103 | 326 |
| 372 | 3300026075 | Ga0207708_10236397 | Ga0207708_102363971 | 326 |
| 373 | 3300026095 | Ga0207676_10007400 | Ga0207676_100074005 | 326 |
| 374 | 3300027907 | Ga0207428_10013853 | Ga0207428_100138538 | 326 |
| 375 | 3300028379 | Ga0268266_10002110 | Ga0268266_1000211011 | 326 |
| 376 | 3300028381 | Ga0268264_10185733 | Ga0268264_101857332 | 326 |
| 377 | 3300031852 | Ga0307410_10017215 | Ga0307410_100172152 | 326 |
| 378 | 3300031911 | Ga0307412_10006138 | Ga0307412_100061385 | 326 |
| 379 | 3300032005 | Ga0307411_10002736 | Ga0307411_100027362 | 326 |
| 380 | 3300032005 | Ga0307411_10007613 | Ga0307411_100076132 | 326 |
| 381 | 3300037466 | Ga0395898_0002294 | Ga0395898_0002294_10278_11291 | 326 |
| 382 | 3300044656 | Ga0466969_0006141 | Ga0466969_0006141_567_1718 | 326 |
| 383 | 3300044673 | Ga0453683_0000336 | Ga0453683_0000336_30030_31046 | 326 |
| 384 | 3300044684 | Ga0466966_0028225 | Ga0466966_0028225_700_1851 | 326 |
| 385 | 3300045049 | Ga0466959_0006916 | Ga0466959_0006916_4628_5779 | 326 |
| 386 | 3300046558 | Ga0495633_0025796 | Ga0495633_0025796_196_1314 | 326 |
| 387 | 3300050511 | nmdc:mga08y16_17995_c1 | nmdc:mga08y16_17995_c1_688_1797 | 326 |
| 388 | 3300050511 | nmdc:mga08y16_243098_c1 | nmdc:mga08y16_243098_c1_150_1268 | 326 |
| 389 | 3300050511 | nmdc:mga08y16_464627_c1 | nmdc:mga08y16_464627_c1_154_1263 | 326 |
| 390 | 3300053178 | Ga0500637_0085766 | Ga0500637_0085766_311_1492 | 326 |
| 391 | 3300005435 | Ga0070714_100271350 | Ga0070714_1002713501 | 327 |
| 392 | 3300005467 | Ga0070706_100118216 | Ga0070706_1001182162 | 327 |
| 393 | 3300025910 | Ga0207684_10113865 | Ga0207684_101138652 | 327 |
| 394 | 3300028573 | Ga0265334_10051338 | Ga0265334_100513382 | 327 |
| 395 | 3300028800 | Ga0265338_10013194 | Ga0265338_100131943 | 327 |
| 396 | 3300035111 | Ga0373923_0017209 | Ga0373923_0017209_939_1952 | 327 |
| 397 | 3300035111 | Ga0373923_0089820 | Ga0373923_0089820_16_1029 | 327 |
| 398 | 3300035118 | Ga0373954_0108064 | Ga0373954_0108064_284_1297 | 327 |
| 399 | 3300036401 | Ga0373937_0085911 | Ga0373937_0085911_836_1849 | 327 |
| 400 | 3300009093 | Ga0105240_10044875 | Ga0105240_100448753 | 328 |
| 401 | 3300010375 | Ga0105239_10374517 | Ga0105239_103745171 | 328 |
| 402 | 3300003323 | rootH1_10178630 | rootH1_101786303 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b27-assembly1.cif.gz_A | dihydroprecondylocarpine acetate synthase from catharanthus roseus | 0.9146 | 2 | 326 |
| 7vem-assembly1.cif.gz_B | the nadph-assisted quinone oxidoreductase from phytophthora capsici | 0.9089 | 2 | 326 |
| 7vem-assembly1.cif.gz_B | the nadph-assisted quinone oxidoreductase from phytophthora capsici | 0.8982 | 2 | 326 |
| 3uog-assembly1.cif.gz_A | crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021 | 0.8932 | 2 | 326 |
| 2eih-assembly1.cif.gz_A | crystal structure of nad-dependent alcohol dehydrogenase | 0.8902 | 1 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54UL7_143_287_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9493 | 133 | 273 | 3.40.50.720 |
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9381 | 137 | 273 | 3.40.50.720 |
| af_P72043_133_294_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9356 | 146 | 273 | 3.40.50.720 |
| 3uogB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9311 | 133 | 274 | 3.40.50.720 |
| af_O65423_126_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9305 | 138 | 273 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A142HFC5-F1-model_v4 | deleted | 0.9745 | 152 | 327 |
|
| AF-A0A356CKQ3-F1-model_v4 | NAD(P)-dependent alcohol dehydrogenase | 0.9674 | 133 | 328 |
GO:0016491
|
| AF-A0A142HFC5-F1-model_v4 | deleted | 0.9637 | 152 | 327 |
|
| AF-A0A440IWI4-F1-model_v4 | deleted | 0.963 | 181 | 328 |
|
| AF-A0A356CKQ3-F1-model_v4 | NAD(P)-dependent alcohol dehydrogenase | 0.9532 | 133 | 328 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar