F435116

General Info

Members Datasets Scaffolds Average Seq Length
402 310 804 338

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10001049|Ga0307515_1000104950
Length 331
Sequence MRGISLIFATAMAALSPVLASAQTLTIYTYESFTSEWGPGPKVKAAFEKTCGCTVEYVSLADGVALLTRLKMEGGATKADIVLGLDTNLIEEAKATNLFAEHGIDTSGVTVPGGFSDPVFVPYDYGHFAVIYDTQAIKNPPKSLKELVDGNPDEKIVIEDPRTSTPGLGFIYWMRAVYGDQTPEAWKKLSRRILTVTPGWSEAYGLFTKGEAPMVLSYTTSPAYHMIAEKNDRYQAAEFSEGHPIQIEVAAMTRTENEELARSFLKFMISPDFQDIIPENNWMMPVAKTSTPLNPVFDKLVHPKITLSMAPDESAKVRKAYVDEWLAASGK

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
138 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
139 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
150 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
151 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
152 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
153 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
154 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
155 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
156 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
157 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
158 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
159 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
160 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
161 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
162 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
163 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
164 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
165 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
166 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
167 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
168 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
169 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
170 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
171 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
172 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
173 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
174 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
175 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
176 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
177 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
178 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
179 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
180 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
181 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
182 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
183 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
184 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
185 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
186 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
187 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
188 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
189 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
190 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
191 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
192 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
193 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
194 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
195 2643221557 Ensifer sp. Root558 Isolate Unclassified
196 2643221558 Rhizobium sp. Root149 Isolate Unclassified
197 2643221568 Rhizobium sp. Root564 Isolate Unclassified
198 2643221582 Rhizobium sp. Root651 Isolate Unclassified
199 2643221599 Rhizobium sp. Root708 Isolate Unclassified
200 2643221607 Rhizobium sp. Root73 Isolate Unclassified
201 2643221610 Ensifer sp. Root74 Isolate Unclassified
202 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
203 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
204 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
205 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
206 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
207 2643221668 Ensifer sp. Root423 Isolate Unclassified
208 2643221675 Ensifer sp. Root1298 Isolate Unclassified
209 2643221680 Ensifer sp. Root1312 Isolate Unclassified
210 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
211 2643221688 Rhizobium sp. Root482 Isolate Unclassified
212 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
213 2643221693 Rhizobium sp. Root491 Isolate Unclassified
214 2643221718 Rhizobium sp. Root268 Isolate Unclassified
215 2643221719 Rhizobium sp. Root274 Isolate Unclassified
216 2643221726 Ensifer sp. Root954 Isolate Unclassified
217 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
218 2738541293 Rhizobium sp. GV031 Isolate Unclassified
219 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
220 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
221 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
222 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
223 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
224 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
225 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
226 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
227 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
228 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
229 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
230 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
231 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
232 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
233 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
234 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
235 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
236 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
237 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
238 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
239 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
240 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
241 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
242 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
243 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
244 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
245 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
246 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
247 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
248 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
249 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
250 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
251 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
252 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
253 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
254 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
255 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
256 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
257 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
258 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
259 2854911287 Brucella lupini LUP21 Isolate Unclassified
260 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
261 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
262 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
263 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
264 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
265 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
266 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
267 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
268 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
269 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
270 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
271 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
272 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
273 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
274 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
275 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
276 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
277 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
278 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
279 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
280 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
281 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
282 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
283 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
284 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
285 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
286 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
287 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
288 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
289 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
290 2996887358 Rhizobium sp. R711 Isolate Nodule
291 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
292 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
293 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
294 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
295 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
296 8005258706 Rhizobium sp. R693 Isolate Nodule
297 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
298 8005321885 Rhizobium sp. R72 Isolate Nodule
299 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
300 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
301 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
302 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
303 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
304 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
305 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
306 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
307 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
308 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
309 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
310 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.7
Metatranscriptomes 0
Isolates 40.3

Biome Distribution

Category Percentage (%)
Aerial Root 1.24
Bulb 0
Endosphere 23.63
Nodule 13.93
Rhizoplane 1.99
Rhizosphere 29.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10001049 3300028794 Bacteria 63286
2 JGI24740J21852_10000313 3300001979 Bacteria 20685
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1000654 3300002737 Bacteria 24456
6 JGI25154J39366_1000026 3300002738 Bacteria 200613
7 JGI25157J39369_1000005 3300002741 Bacteria 269089
8 JGI25152J39213_1001057 3300002773 Bacteria 13057
9 JGI25152J39213_1007744 3300002773 Bacteria 2749
10 JGI25150J39212_1000171 3300002774 Bacteria 36637
11 JGI25159J45721_1000318 3300002987 Bacteria 22509
12 JGI25151J46595_10000034 3300003187 Bacteria 192271
13 JGI25165J46597_1000633 3300003214 Bacteria 29109
14 JGI25165J46597_1000642 3300003214 Bacteria 28950
15 JGI25160J50197_1000022 3300003354 Bacteria 201071
16 JGI25161J50226_1000024 3300003374 Bacteria 152176
17 Ga0055524_1002973 3300003775 Bacteria 8439
18 Ga0055524_1004004 3300003775 Bacteria 6949
19 Ga0055536_1009566 3300003781 Bacteria 3986
20 Ga0055528_1006677 3300003790 Bacteria 5205
21 Ga0055531_10002501 3300003794 Bacteria 12246
22 Ga0058692_1001310 3300003856 Bacteria 9377
23 Ga0058692_1001508 3300003856 Bacteria 8513
24 Ga0055543_1000025 3300004625 Bacteria 137886
25 Ga0065165_1000200 3300005262 Bacteria 103564
26 Ga0065165_1003096 3300005262 Bacteria 12393
27 Ga0065165_1016471 3300005262 Bacteria 2766
28 Ga0070670_100000061 3300005331 Bacteria 113254
29 Ga0070671_100090201 3300005355 Bacteria 2566
30 Ga0070667_100250557 3300005367 Bacteria 1583
31 Ga0070665_100025557 3300005548 Bacteria 5949
32 Ga0070665_100062765 3300005548 Bacteria 3725
33 Ga0070665_100067083 3300005548 Bacteria 3599
34 Ga0068854_100260198 3300005578 Bacteria 1389
35 Ga0075365_10007391 3300006038 Bacteria 6146
36 Ga0075368_10000185 3300006042 Bacteria 17037
37 Ga0075364_10000198 3300006051 Bacteria 27838
38 Ga0075364_10126777 3300006051 Bacteria 1712
39 Ga0075364_10151973 3300006051 Bacteria 1560
40 Ga0075362_10017092 3300006177 Bacteria 2984
41 Ga0075367_10002264 3300006178 Bacteria 8713
42 Ga0075367_10003376 3300006178 Bacteria 7598
43 Ga0075367_10012239 3300006178 Bacteria 4566
44 Ga0075369_10007413 3300006186 Bacteria 4176
45 Ga0075370_10071943 3300006353 Bacteria 1979
46 Ga0079104_1000103 3300006946 Bacteria 124578
47 Ga0099826_10010747 3300006948 Bacteria 6868
48 Ga0099826_10017530 3300006948 Bacteria 5409
49 Ga0105250_10009162 3300009092 Bacteria 4176
50 Ga0105240_10000013 3300009093 Bacteria 483458
51 Ga0105243_10312490 3300009148 Bacteria 1428
52 Ga0105237_10000949 3300009545 Bacteria 38978
53 Ga0123340_1045984 3300009763 Bacteria 1786
54 Ga0123342_1006949 3300009766 Bacteria 15314
55 Ga0105239_10000768 3300010375 Bacteria 45353
56 Ga0157373_10011948 3300013100 Bacteria 6380
57 Ga0157371_10000108 3300013102 Bacteria 126288
58 Ga0157370_10000324 3300013104 Bacteria 59791
59 Ga0157370_10001544 3300013104 Bacteria 28489
60 Ga0157369_10102357 3300013105 Bacteria 3052
61 Ga0171463_1004 3300013249 Bacteria 437207
62 Ga0182008_10013007 3300014497 Bacteria 4379
63 Ga0182007_10003039 3300015262 Bacteria 8093
64 Ga0182005_1004814 3300015265 Bacteria 4298
65 Ga0209435_100009 3300025206 Bacteria 476614
66 Ga0209672_103610 3300025228 Bacteria 3134
67 Ga0209437_100182 3300025233 Bacteria 130514
68 Ga0209437_100204 3300025233 Bacteria 115781
69 Ga0207425_1000035 3300025245 Bacteria 225942
70 Ga0209646_1000018 3300025246 Bacteria 476716
71 Ga0209646_1006863 3300025246 Bacteria 1892
72 Ga0209026_1000043 3300025250 Bacteria 269142
73 Ga0209677_100265 3300025253 Bacteria 35526
74 Ga0209148_1005718 3300025254 Bacteria 2797
75 Ga0209759_1000007 3300025256 Bacteria 476614
76 Ga0209129_1000029 3300025258 Bacteria 401149
77 Ga0209129_1000050 3300025258 Bacteria 267408
78 Ga0209129_1015007 3300025258 Bacteria 1616
79 Ga0209233_1000130 3300025261 Bacteria 205687
80 Ga0209233_1000255 3300025261 Bacteria 82230
81 Ga0209233_1000332 3300025261 Bacteria 48225
82 Ga0209673_1000033 3300025273 Bacteria 335369
83 Ga0209673_1002417 3300025273 Bacteria 13009
84 Ga0209673_1003527 3300025273 Bacteria 9155
85 Ga0209673_1041956 3300025273 Bacteria 1292
86 Ga0209130_1000164 3300025284 Bacteria 97595
87 Ga0209676_1007670 3300025292 Bacteria 4999
88 Ga0209025_1000132 3300025294 Bacteria 197432
89 Ga0209025_1000487 3300025294 Bacteria 76541
90 Ga0209025_1001669 3300025294 Bacteria 27204
91 Ga0209025_1006647 3300025294 Bacteria 8892
92 Ga0209025_1062570 3300025294 Bacteria 1379
93 Ga0209564_1008343 3300025295 Bacteria 5126
94 Ga0209564_1038672 3300025295 Bacteria 1323
95 Ga0209758_1000255 3300025297 Bacteria 106892
96 Ga0209758_1008564 3300025297 Bacteria 6586
97 Ga0209758_1022795 3300025297 Bacteria 2855
98 Ga0209050_1002627 3300025298 Bacteria 14778
99 Ga0209256_1001847 3300025299 Bacteria 19634
100 Ga0209256_1002258 3300025299 Bacteria 16350
101 Ga0209256_1003193 3300025299 Bacteria 11858
102 Ga0209256_1022917 3300025299 Bacteria 1877
103 Ga0207426_1000082 3300025302 Bacteria 298939
104 Ga0207426_1001684 3300025302 Bacteria 17081
105 Ga0209051_1008488 3300025303 Bacteria 5427
106 Ga0209051_1020588 3300025303 Bacteria 2836
107 Ga0209051_1022966 3300025303 Bacteria 2607
108 Ga0209257_1001584 3300025304 Bacteria 26149
109 Ga0207695_10000044 3300025913 Bacteria 440819
110 Ga0207671_10000043 3300025914 Bacteria 206915
111 Ga0207650_10000630 3300025925 Bacteria 28133
112 Ga0207644_10259089 3300025931 Bacteria 1390
113 Ga0207711_10118618 3300025941 Bacteria 2361
114 Ga0207668_10040102 3300025972 Bacteria 3157
115 Ga0207640_10067927 3300025981 Bacteria 2387
116 Ga0207658_10218355 3300025986 Bacteria 1602
117 Ga0207698_10016871 3300026142 Bacteria 4937
118 Ga0209281_1000362 3300027111 Bacteria 74146
119 Ga0209371_1000037 3300027312 Bacteria 367074
120 Ga0209371_1004261 3300027312 Bacteria 6355
121 Ga0209282_1000337 3300027666 Bacteria 23250
122 Ga0209813_10000576 3300027866 Bacteria 8589
123 Ga0268266_10032155 3300028379 Bacteria 4458
124 Ga0268266_10035743 3300028379 Bacteria 4225
125 Ga0268266_10060083 3300028379 Bacteria 3276
126 Ga0268256_1000039 3300030500 Bacteria 354969
127 Ga0268256_1004689 3300030500 Bacteria 5580
128 Ga0307513_10134492 3300031456 Bacteria 2410
129 Ga0307405_10000501 3300031731 Bacteria 14748
130 Ga0307412_10018437 3300031911 Bacteria 4199
131 Ga0307409_100019105 3300031995 Bacteria 4630
132 Ga0373927_0003743 3300035695 Bacteria 10800
133 Ga0373947_0118252 3300035725 Bacteria 1682
134 Ga0373925_0000830 3300037068 Bacteria 28511
135 Ga0495592_0169352 3300046454 Bacteria 1497
136 Ga0495638_0000257 3300046460 Bacteria 71780
137 Ga0495638_0023781 3300046460 Bacteria 4002
138 Ga0495605_0052091 3300046474 Bacteria 1990
139 Ga0495662_0031825 3300046476 Bacteria 2548
140 Ga0495585_0025619 3300046492 Bacteria 3376
141 Ga0495585_0061343 3300046492 Bacteria 2068
142 Ga0495607_0052212 3300046501 Bacteria 2369
143 Ga0495583_0003365 3300046506 Bacteria 12292
144 Ga0495606_0012611 3300046507 Bacteria 6758
145 Ga0495606_0025666 3300046507 Bacteria 4215
146 Ga0495610_0000530 3300046512 Bacteria 38418
147 Ga0495631_0005873 3300046518 Bacteria 6394
148 Ga0495632_0001108 3300046519 Bacteria 23100
149 Ga0495652_0129721 3300046529 Bacteria 1998
150 Ga0495654_0000231 3300046530 Bacteria 52162
151 Ga0495633_0038625 3300046558 Bacteria 2279
152 Ga0495633_0107615 3300046558 Bacteria 1293
153 Ga0495633_0119115 3300046558 Bacteria 1223
154 Ga0495625_0001681 3300046660 Bacteria 25798
155 Ga0495588_0004263 3300046674 Bacteria 6307
156 Ga0495624_0073124 3300046690 Bacteria 2132
157 Ga0495600_0065664 3300046809 Bacteria 2372
158 Ga0495604_0133425 3300047317 Bacteria 1782
159 Ga0495681_0014481 3300047470 Bacteria 4516
160 Ga0495686_0003017 3300047472 Bacteria 14953
161 Ga0495686_0098365 3300047472 Bacteria 1768
162 Ga0496104_0031403 3300048907 Bacteria 4940
163 Ga0496116_0000057 3300048919 Bacteria 281652
164 Ga0496116_0001796 3300048919 Bacteria 23307
165 Ga0496116_0005541 3300048919 Bacteria 11645
166 Ga0496116_0016730 3300048919 Bacteria 5724
167 Ga0496117_0000031 3300048920 Bacteria 381048
168 Ga0496117_0007061 3300048920 Bacteria 11107
169 Ga0496117_0032606 3300048920 Bacteria 3954
170 Ga0496118_0000899 3300048921 Bacteria 46663
171 Ga0496118_0005464 3300048921 Bacteria 14437
172 Ga0496118_0026142 3300048921 Bacteria 4981
173 Ga0496118_0037866 3300048921 Bacteria 3874
174 Ga0496119_0025819 3300048922 Bacteria 4092
175 Ga0496119_0041228 3300048922 Bacteria 2943
176 Ga0496120_0000337 3300048923 Bacteria 78140
177 Ga0496120_0005215 3300048923 Bacteria 10469
178 Ga0496120_0010167 3300048923 Bacteria 6589
179 Ga0496121_0000034 3300048924 Bacteria 377095
180 Ga0496121_0003869 3300048924 Bacteria 20809
181 Ga0496121_0008732 3300048924 Bacteria 11826
182 Ga0496121_0009632 3300048924 Bacteria 11066
183 Ga0496121_0016891 3300048924 Bacteria 7502
184 Ga0496121_0025056 3300048924 Bacteria 5678
185 Ga0496121_0101455 3300048924 Bacteria 2219
186 Ga0496121_0175306 3300048924 Bacteria 1553
187 Ga0496121_0283649 3300048924 Bacteria 1131
188 Ga0496122_0000023 3300048925 Bacteria 381035
189 Ga0496122_0000074 3300048925 Bacteria 219900
190 Ga0496122_0013876 3300048925 Bacteria 7844
191 Ga0496122_0033037 3300048925 Bacteria 4263
192 Ga0496122_0044788 3300048925 Bacteria 3448
193 Ga0496122_0062303 3300048925 Bacteria 2731
194 Ga0496122_0067244 3300048925 Bacteria 2582
195 Ga0496123_0000027 3300048926 Bacteria 306773
196 Ga0496123_0000062 3300048926 Bacteria 219882
197 Ga0496123_0017954 3300048926 Bacteria 5663
198 Ga0496123_0046869 3300048926 Bacteria 2926
199 Ga0496124_0000174 3300048927 Bacteria 129228
200 Ga0496124_0004778 3300048927 Bacteria 15594
201 Ga0496124_0005476 3300048927 Bacteria 14261
202 Ga0496124_0011303 3300048927 Bacteria 8936
203 Ga0496124_0028583 3300048927 Bacteria 4986
204 Ga0496124_0030494 3300048927 Bacteria 4785
205 Ga0496124_0071193 3300048927 Bacteria 2883
206 Ga0496125_0000030 3300048928 Bacteria 375023
207 Ga0496125_0002335 3300048928 Bacteria 24935
208 Ga0496125_0008694 3300048928 Bacteria 10574
209 Ga0496126_0026700 3300048929 Bacteria 5529
210 Ga0496126_0242131 3300048929 Bacteria 1506
211 Ga0495678_020113 3300049459 Bacteria 2963
212 Ga0501032_0050847 3300049569 Bacteria 2795
213 Ga0501033_0000456 3300049570 Bacteria 38936
214 Ga0501035_0000551 3300049822 Bacteria 41644
215 Ga0501035_0043094 3300049822 Bacteria 4068
216 nmdc:mga03683_5353_c1 3300050489 Bacteria 4330
217 nmdc:mga00v17_10_c2 3300050491 Bacteria 136802
218 nmdc:mga00v17_118647_c1 3300050491 Bacteria 1683
219 nmdc:mga00v17_75948_c1 3300050491 Bacteria 2090
220 nmdc:mga0yw44_22840_c1 3300050492 Bacteria 3515
221 nmdc:mga06z11_1448_c1 3300050494 Bacteria 8825
222 nmdc:mga07m45_7031_c1 3300050496 Bacteria 5727
223 nmdc:mga0sz30_3682_c1 3300050516 Bacteria 2512
224 Ga0500610_0072306 3300053079 Bacteria 1798
225 Ga0500557_012795 3300053105 Bacteria 2187
226 Ga0500569_005101 3300053109 Bacteria 2805
227 Ga0500594_0009128 3300053118 Bacteria 2277
228 Ga0500618_000232 3300053125 Bacteria 43742
229 Ga0500618_002663 3300053125 Bacteria 6557
230 Ga0500618_006463 3300053125 Bacteria 3436
231 Ga0500561_0001235 3300053137 Bacteria 4159
232 Ga0500568_0001327 3300053139 Bacteria 16220
233 Ga0500573_0004688 3300053140 Bacteria 7235
234 Ga0500577_0043402 3300053142 Bacteria 1652
235 Ga0500616_0000441 3300053153 Bacteria 54819
236 Ga0500616_0000536 3300053153 Bacteria 47507
237 Ga0500616_0036855 3300053153 Bacteria 2652
238 Ga0500624_000542 3300053157 Bacteria 10625
239 Ga0500636_0000025 3300053177 Bacteria 86697
240 Ga0500636_0003177 3300053177 Bacteria 9198
241 2510843708 2510461069 Bacteria 5505000
242 2511133129 2510917022 Bacteria 6504556
243 2511174309 2510917026 Bacteria 7046020
244 2511184086 2510917028 Bacteria 6185411
245 2511388818 2511231027 Bacteria 5013807
246 2513596883 2513237088 Bacteria 6927906
247 2513865261 2513237138 Bacteria 7368160
248 2513912705 2513237144 Bacteria 7530820
249 2513928561 2513237146 Bacteria 7166346
250 2524458650 2524023209 Bacteria 6679728
251 2535519091 2534681796 Bacteria 7146037
252 2537873664 2537561587 Bacteria 5425293
253 2554248878 2554235003 Bacteria 5877155
254 2559295966 2558860242 Bacteria 5568029
255 2561467123 2558860983 Bacteria 4133860
256 2585166763 2582581283 Bacteria 6030556
257 2585201669 2582581294 Bacteria 6626667
258 2585228677 2582581299 Bacteria 6518058
259 2585257290 2582581304 Bacteria 5831370
260 2585266890 2582581306 Bacteria 6450535
261 2585271869 2582581307 Bacteria 6597605
262 2585279769 2582581308 Bacteria 7413247
263 2585326692 2582581315 Bacteria 7318924
264 2585333854 2582581316 Bacteria 7774528
265 2585387933 2582581865 Bacteria 6644329
266 2585396026 2582581866 Bacteria 6859583
267 2585399816 2582581867 Bacteria 7184437
268 2585531828 2585427527 Bacteria 7273426
269 2585551225 2585427530 Bacteria 7383882
270 2585563768 2585427531 Bacteria 6992870
271 2585820904 2585427590 Bacteria 6824633
272 2585844953 2585427594 Bacteria 6180594
273 2585897035 2585427608 Bacteria 6544331
274 2585907107 2585427609 Bacteria 6667127
275 2585997820 2585427633 Bacteria 6413184
276 2586002406 2585427634 Bacteria 6455027
277 2587982899 2585428125 Bacteria 6662905
278 2599420088 2599185170 Bacteria 7295545
279 2599603242 2599185210 Bacteria 5624189
280 2599720369 2599185236 Bacteria 6875203
281 2600373207 2600254933 Bacteria 4750527
282 2601610853 2600255279 Bacteria 5605316
283 2601747627 2600255308 Bacteria 5611129
284 2616306559 2615840626 Bacteria 7921970
285 2616551198 2615840698 Bacteria 7319877
286 2617382944 2617270742 Bacteria 6808054
287 2643808028 2643221557 Bacteria 7184309
288 2643813812 2643221558 Bacteria 5460675
289 2643855090 2643221568 Bacteria 5187270
290 2643921490 2643221582 Bacteria 5804683
291 2644002546 2643221599 Bacteria 6292121
292 2644052002 2643221607 Bacteria 6314006
293 2644068783 2643221610 Bacteria 7480339
294 2644194764 2643221634 Bacteria 6705461
295 2644201442 2643221636 Bacteria 6583769
296 2644209432 2643221637 Bacteria 5345260
297 2644240443 2643221643 Bacteria 5749658
298 2644299745 2643221653 Bacteria 4569637
299 2644379462 2643221668 Bacteria 7306521
300 2644419853 2643221675 Bacteria 7473456
301 2644453210 2643221680 Bacteria 7473610
302 2644484454 2643221686 Bacteria 6310811
303 2644492463 2643221688 Bacteria 5260751
304 2644499250 2643221689 Bacteria 6042950
305 2644521544 2643221693 Bacteria 5513853
306 2644652960 2643221718 Bacteria 5345506
307 2644657972 2643221719 Bacteria 4568197
308 2644688762 2643221726 Bacteria 7455827
309 2671113321 2667528174 Bacteria 6435400
310 2738801133 2738541293 Bacteria 7065685
311 2738947000 2738541317 Bacteria 5340176
312 2776915558 2775507049 Bacteria 6284736
313 2778179072 2775507266 Bacteria 7392367
314 2808988209 2808606387 Bacteria 5697198
315 2819244534 2818991272 Bacteria 4622173
316 2819560975 2818991439 Bacteria 6907412
317 2819611666 2818991448 Bacteria 6772224
318 2819638656 2818991453 Bacteria 7181617
319 2819686965 2818991461 Bacteria 7026071
320 2821128759 2821123053 Bacteria 7836056
321 2838031096 2838029111 Bacteria 6603031
322 2838040296 2838035591 Bacteria 7166484
323 2838667111 2838661181 Bacteria 7385261
324 2838678659 2838675328 Bacteria 4909118
325 2838718253 2838714209 Bacteria 5525906
326 2838722955 2838719591 Bacteria 5523910
327 2838728319 2838724970 Bacteria 4908691
328 2838741963 2838736955 Bacteria 5760694
329 2841845908 2841840854 Bacteria 5761912
330 2841850511 2841846520 Bacteria 5345850
331 2841863237 2841859092 Bacteria 5436171
332 2842128979 2842124991 Bacteria 5346824
333 2842133551 2842130223 Bacteria 4909145
334 2842145612 2842140634 Bacteria 5759631
335 2842155537 2842152218 Bacteria 4908957
336 2842174505 2842170452 Bacteria 5525737
337 2842179165 2842175837 Bacteria 4908771
338 2842190677 2842187318 Bacteria 5524014
339 2842214999 2842211629 Bacteria 5523832
340 2842227720 2842224351 Bacteria 5524473
341 2842300087 2842298080 Bacteria 6123127
342 2842358998 2842357229 Bacteria 6485165
343 2842477828 2842475841 Bacteria 6603183
344 2842485126 2842482326 Bacteria 7212537
345 2842504300 2842502639 Bacteria 6604161
346 2842511519 2842509118 Bacteria 6850950
347 2842520026 2842515876 Bacteria 5436280
348 2842874885 2842871566 Bacteria 4827117
349 2852391940 2852387548 Bacteria 8025568
350 2854901687 2854896431 Bacteria 5869725
351 2854913025 2854911287 Bacteria 5582813
352 2854920072 2854916844 Bacteria 5725939
353 2857534088 2857531043 Bacteria 6754041
354 2894653961 2894652903 Bacteria 4587256
355 2899795334 2899792073 Bacteria 4926588
356 2899808002 2899803654 Bacteria 5577784
357 2899849314 2899845264 Bacteria 5672268
358 2913312175 2913308742 Bacteria 5350706
359 2915654262 2915650412 Bacteria 4288180
360 2919118489 2919114240 Bacteria 5700270
361 2919170576 2919166419 Bacteria 4952238
362 2919175744 2919171160 Bacteria 6499771
363 2919411226 2919408235 Bacteria 6149349
364 2923560594 2923556063 Bacteria 6793593
365 2926755019 2926754445 Bacteria 5964435
366 2926762181 2926760298 Bacteria 5505990
367 2929141933 2929138655 Bacteria 5810547
368 2933010612 2933006813 Bacteria 4912075
369 2933015716 2933011516 Bacteria 5439334
370 2933016812 2933016740 Bacteria 6355406
371 2933597546 2933594066 Bacteria 5594265
372 2978972621 2978969890 Bacteria 5400756
373 2979092549 2979089926 Bacteria 5670289
374 2979100060 2979095461 Bacteria 5669583
375 2979104520 2979100975 Bacteria 5423623
376 2984513685 2984509177 Bacteria 5274802
377 2984522736 2984518228 Bacteria 5277463
378 2984542042 2984537506 Bacteria 5277481
379 2984590873 2984587000 Bacteria 5263363
380 2984601472 2984601300 Bacteria 5455244
381 2989780212 2989776772 Bacteria 4843317
382 2996890312 2996887358 Bacteria 5795980
383 3005415855 3005409236 Bacteria 7188837
384 3005421457 3005416602 Bacteria 7064308
385 650741182 650716007 Bacteria 5573770
386 8003573761 8003570095 Bacteria 5747666
387 8005249350 8005246636 Bacteria 4933972
388 8005262495 8005258706 Bacteria 6184835
389 8005319838 8005314921 Bacteria 7072929
390 8005324839 8005321885 Bacteria 5795980
391 8005490464 8005484373 Bacteria 6297373
392 8005546742 8005542996 Bacteria 7077758
393 8005647107 8005645114 Bacteria 6950293
394 8005660838 8005658619 Bacteria 4500593
395 8005687036 8005682033 Bacteria 6726518
396 8018153411 8018150411 Bacteria 5549903
397 8024490906 8024486573 Bacteria 6540512
398 8046767433 8046767195 Bacteria 7547379
399 8054463752 8054460903 Bacteria 4872905
400 8055435533 8055431914 Bacteria 4551896
401 8056878282 8056875544 Bacteria 4355797
402 8057580321 8057575449 Bacteria 7367519
403 Ga0307515_10001049
404 JGI24740J21852_10000313
405 JGI25156J39149_1000014
406 JGI25156J39149_1000015
407 JGI25162J39368_1000654
408 JGI25154J39366_1000026
409 JGI25157J39369_1000005
410 JGI25152J39213_1001057
411 JGI25152J39213_1007744
412 JGI25150J39212_1000171
413 JGI25159J45721_1000318
414 JGI25151J46595_10000034
415 JGI25165J46597_1000633
416 JGI25165J46597_1000642
417 JGI25160J50197_1000022
418 JGI25161J50226_1000024
419 Ga0055524_1002973
420 Ga0055524_1004004
421 Ga0055536_1009566
422 Ga0055528_1006677
423 Ga0055531_10002501
424 Ga0058692_1001310
425 Ga0058692_1001508
426 Ga0055543_1000025
427 Ga0065165_1000200
428 Ga0065165_1003096
429 Ga0065165_1016471
430 Ga0070670_100000061
431 Ga0070671_100090201
432 Ga0070667_100250557
433 Ga0070665_100025557
434 Ga0070665_100062765
435 Ga0070665_100067083
436 Ga0068854_100260198
437 Ga0075365_10007391
438 Ga0075368_10000185
439 Ga0075364_10000198
440 Ga0075364_10126777
441 Ga0075364_10151973
442 Ga0075362_10017092
443 Ga0075367_10002264
444 Ga0075367_10003376
445 Ga0075367_10012239
446 Ga0075369_10007413
447 Ga0075370_10071943
448 Ga0079104_1000103
449 Ga0099826_10010747
450 Ga0099826_10017530
451 Ga0105250_10009162
452 Ga0105240_10000013
453 Ga0105243_10312490
454 Ga0105237_10000949
455 Ga0123340_1045984
456 Ga0123342_1006949
457 Ga0105239_10000768
458 Ga0157373_10011948
459 Ga0157371_10000108
460 Ga0157370_10000324
461 Ga0157370_10001544
462 Ga0157369_10102357
463 Ga0171463_1004
464 Ga0182008_10013007
465 Ga0182007_10003039
466 Ga0182005_1004814
467 Ga0209435_100009
468 Ga0209672_103610
469 Ga0209437_100182
470 Ga0209437_100204
471 Ga0207425_1000035
472 Ga0209646_1000018
473 Ga0209646_1006863
474 Ga0209026_1000043
475 Ga0209677_100265
476 Ga0209148_1005718
477 Ga0209759_1000007
478 Ga0209129_1000029
479 Ga0209129_1000050
480 Ga0209129_1015007
481 Ga0209233_1000130
482 Ga0209233_1000255
483 Ga0209233_1000332
484 Ga0209673_1000033
485 Ga0209673_1002417
486 Ga0209673_1003527
487 Ga0209673_1041956
488 Ga0209130_1000164
489 Ga0209676_1007670
490 Ga0209025_1000132
491 Ga0209025_1000487
492 Ga0209025_1001669
493 Ga0209025_1006647
494 Ga0209025_1062570
495 Ga0209564_1008343
496 Ga0209564_1038672
497 Ga0209758_1000255
498 Ga0209758_1008564
499 Ga0209758_1022795
500 Ga0209050_1002627
501 Ga0209256_1001847
502 Ga0209256_1002258
503 Ga0209256_1003193
504 Ga0209256_1022917
505 Ga0207426_1000082
506 Ga0207426_1001684
507 Ga0209051_1008488
508 Ga0209051_1020588
509 Ga0209051_1022966
510 Ga0209257_1001584
511 Ga0207695_10000044
512 Ga0207671_10000043
513 Ga0207650_10000630
514 Ga0207644_10259089
515 Ga0207711_10118618
516 Ga0207668_10040102
517 Ga0207640_10067927
518 Ga0207658_10218355
519 Ga0207698_10016871
520 Ga0209281_1000362
521 Ga0209371_1000037
522 Ga0209371_1004261
523 Ga0209282_1000337
524 Ga0209813_10000576
525 Ga0268266_10032155
526 Ga0268266_10035743
527 Ga0268266_10060083
528 Ga0268256_1000039
529 Ga0268256_1004689
530 Ga0307513_10134492
531 Ga0307405_10000501
532 Ga0307412_10018437
533 Ga0307409_100019105
534 Ga0373927_0003743
535 Ga0373947_0118252
536 Ga0373925_0000830
537 Ga0495592_0169352
538 Ga0495638_0000257
539 Ga0495638_0023781
540 Ga0495605_0052091
541 Ga0495662_0031825
542 Ga0495585_0025619
543 Ga0495585_0061343
544 Ga0495607_0052212
545 Ga0495583_0003365
546 Ga0495606_0012611
547 Ga0495606_0025666
548 Ga0495610_0000530
549 Ga0495631_0005873
550 Ga0495632_0001108
551 Ga0495652_0129721
552 Ga0495654_0000231
553 Ga0495633_0038625
554 Ga0495633_0107615
555 Ga0495633_0119115
556 Ga0495625_0001681
557 Ga0495588_0004263
558 Ga0495624_0073124
559 Ga0495600_0065664
560 Ga0495604_0133425
561 Ga0495681_0014481
562 Ga0495686_0003017
563 Ga0495686_0098365
564 Ga0496104_0031403
565 Ga0496116_0000057
566 Ga0496116_0001796
567 Ga0496116_0005541
568 Ga0496116_0016730
569 Ga0496117_0000031
570 Ga0496117_0007061
571 Ga0496117_0032606
572 Ga0496118_0000899
573 Ga0496118_0005464
574 Ga0496118_0026142
575 Ga0496118_0037866
576 Ga0496119_0025819
577 Ga0496119_0041228
578 Ga0496120_0000337
579 Ga0496120_0005215
580 Ga0496120_0010167
581 Ga0496121_0000034
582 Ga0496121_0003869
583 Ga0496121_0008732
584 Ga0496121_0009632
585 Ga0496121_0016891
586 Ga0496121_0025056
587 Ga0496121_0101455
588 Ga0496121_0175306
589 Ga0496121_0283649
590 Ga0496122_0000023
591 Ga0496122_0000074
592 Ga0496122_0013876
593 Ga0496122_0033037
594 Ga0496122_0044788
595 Ga0496122_0062303
596 Ga0496122_0067244
597 Ga0496123_0000027
598 Ga0496123_0000062
599 Ga0496123_0017954
600 Ga0496123_0046869
601 Ga0496124_0000174
602 Ga0496124_0004778
603 Ga0496124_0005476
604 Ga0496124_0011303
605 Ga0496124_0028583
606 Ga0496124_0030494
607 Ga0496124_0071193
608 Ga0496125_0000030
609 Ga0496125_0002335
610 Ga0496125_0008694
611 Ga0496126_0026700
612 Ga0496126_0242131
613 Ga0495678_020113
614 Ga0501032_0050847
615 Ga0501033_0000456
616 Ga0501035_0000551
617 Ga0501035_0043094
618 nmdc:mga03683_5353_c1
619 nmdc:mga00v17_10_c2
620 nmdc:mga00v17_118647_c1
621 nmdc:mga00v17_75948_c1
622 nmdc:mga0yw44_22840_c1
623 nmdc:mga06z11_1448_c1
624 nmdc:mga07m45_7031_c1
625 nmdc:mga0sz30_3682_c1
626 Ga0500610_0072306
627 Ga0500557_012795
628 Ga0500569_005101
629 Ga0500594_0009128
630 Ga0500618_000232
631 Ga0500618_002663
632 Ga0500618_006463
633 Ga0500561_0001235
634 Ga0500568_0001327
635 Ga0500573_0004688
636 Ga0500577_0043402
637 Ga0500616_0000441
638 Ga0500616_0000536
639 Ga0500616_0036855
640 Ga0500624_000542
641 Ga0500636_0000025
642 Ga0500636_0003177
643 2510843708
644 2511133129
645 2511174309
646 2511184086
647 2511388818
648 2513596883
649 2513865261
650 2513912705
651 2513928561
652 2524458650
653 2535519091
654 2537873664
655 2554248878
656 2559295966
657 2561467123
658 2585166763
659 2585201669
660 2585228677
661 2585257290
662 2585266890
663 2585271869
664 2585279769
665 2585326692
666 2585333854
667 2585387933
668 2585396026
669 2585399816
670 2585531828
671 2585551225
672 2585563768
673 2585820904
674 2585844953
675 2585897035
676 2585907107
677 2585997820
678 2586002406
679 2587982899
680 2599420088
681 2599603242
682 2599720369
683 2600373207
684 2601610853
685 2601747627
686 2616306559
687 2616551198
688 2617382944
689 2643808028
690 2643813812
691 2643855090
692 2643921490
693 2644002546
694 2644052002
695 2644068783
696 2644194764
697 2644201442
698 2644209432
699 2644240443
700 2644299745
701 2644379462
702 2644419853
703 2644453210
704 2644484454
705 2644492463
706 2644499250
707 2644521544
708 2644652960
709 2644657972
710 2644688762
711 2671113321
712 2738801133
713 2738947000
714 2776915558
715 2778179072
716 2808988209
717 2819244534
718 2819560975
719 2819611666
720 2819638656
721 2819686965
722 2821128759
723 2838031096
724 2838040296
725 2838667111
726 2838678659
727 2838718253
728 2838722955
729 2838728319
730 2838741963
731 2841845908
732 2841850511
733 2841863237
734 2842128979
735 2842133551
736 2842145612
737 2842155537
738 2842174505
739 2842179165
740 2842190677
741 2842214999
742 2842227720
743 2842300087
744 2842358998
745 2842477828
746 2842485126
747 2842504300
748 2842511519
749 2842520026
750 2842874885
751 2852391940
752 2854901687
753 2854913025
754 2854920072
755 2857534088
756 2894653961
757 2899795334
758 2899808002
759 2899849314
760 2913312175
761 2915654262
762 2919118489
763 2919170576
764 2919175744
765 2919411226
766 2923560594
767 2926755019
768 2926762181
769 2929141933
770 2933010612
771 2933015716
772 2933016812
773 2933597546
774 2978972621
775 2979092549
776 2979100060
777 2979104520
778 2984513685
779 2984522736
780 2984542042
781 2984590873
782 2984601472
783 2989780212
784 2996890312
785 3005415855
786 3005421457
787 650741182
788 8003573761
789 8005249350
790 8005262495
791 8005319838
792 8005324839
793 8005490464
794 8005546742
795 8005647107
796 8005660838
797 8005687036
798 8018153411
799 8024490906
800 8046767433
801 8054463752
802 8055435533
803 8056878282
804 8057580321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

39

275

0.85

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

39

281

0.85

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

76

315

0.8

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

42

297

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qry-assembly1.cif.gz_A periplasmic thiamin binding protein 0.9763 33 338
2qry-assembly1.cif.gz_A periplasmic thiamin binding protein 0.9639 33 338
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8537 31 340
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.8432 32 341
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.834 31 340
ID Description Score Start End Superfamily
af_P31550_123_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.974 135 338 3.40.190.10
2qryD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9651 135 338 3.40.190.10
af_P31550_123_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9646 135 338 3.40.190.10
2qryD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9636 33 310 3.40.190.10
2qryD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9461 135 338 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A327K2G4-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9968 130 217 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A529NIY0-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9862 168 339 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A3B8WU22-F1-model_v4 Thiamine-binding periplasmic protein 0.9857 34 340 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A528THB7-F1-model_v4 Thiamine ABC transporter substrate-binding protein 0.9852 138 245 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A2A4XW95-F1-model_v4 deleted 0.9839 107 338

Map