F435152

General Info

Members Datasets Scaffolds Average Seq Length
402 263 804 306

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0002838|Ga0439449_0002838_1821_2744
Length 291
Sequence MTRLLRIATRKSPLALWQSEHVAAALRAAHSGLDVVLVPMSTRGDEVLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELEPGFALPAILQRADHADAFVSNRYDNIDALPLGAVVGTSSLRRQAQLRTRLAKLDAGEYDAIVLACAGLQRLGFDARIRSRMDAPQWLPAPAQGAIAIECRDDDADTRALCAKLDHTATRICVEAERAMNRTLHGSCHVPVAAFARLEGERLHLHGLVGSAADGRAIRAQAEGRGDAPESLGREVAQSLQQQGAGDLIAASGA

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
231 2643221559 Lysobacter sp. Root559 Isolate Unclassified
232 2643221573 Lysobacter sp. Root604 Isolate Unclassified
233 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
234 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
235 2643221586 Lysobacter sp. Root667 Isolate Unclassified
236 2643221612 Lysobacter sp. Root76 Isolate Unclassified
237 2643221695 Lysobacter sp. Root494 Isolate Unclassified
238 2643221720 Lysobacter sp. Root916 Isolate Unclassified
239 2643221727 Lysobacter sp. Root96 Isolate Unclassified
240 2643221728 Lysobacter sp. Root983 Isolate Unclassified
241 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
242 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
243 2818991457 Xanthomonas translucens 569 Isolate Unclassified
244 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
245 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
246 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
247 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
248 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
249 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
250 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
251 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
252 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
253 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
254 2919513703 Luteimonas sp. 3794 Isolate Unclassified
255 2919675420 Luteimonas terrae 4099 Isolate Unclassified
256 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
257 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
258 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
259 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
260 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
261 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
262 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
263 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.29
Metatranscriptomes 0.25
Isolates 8.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 0
Rhizoplane 2.24
Rhizosphere 68.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0002838 3300042007 Bacteria 6736
2 SwRhRL2b_contig_3470979 2162886007 Bacteria 1482
3 MBSR1b_contig_6401888 2162886012 Bacteria 2289
4 JGI24739J22299_10000087 3300001989 Bacteria 26642
5 JGI25157J39369_1001284 3300002741 Bacteria 10096
6 JGI25153J46596_10010132 3300003215 Bacteria 4293
7 rootH1_10097541 3300003316 Bacteria 1941
8 Ga0055527_1000140 3300003760 Bacteria 51402
9 Ga0055535_1000147 3300003761 Bacteria 74557
10 Ga0055535_1000278 3300003761 Bacteria 53724
11 Ga0055542_1000064 3300003762 Bacteria 159853
12 Ga0055542_1000308 3300003762 Bacteria 53724
13 Ga0055529_1000072 3300003763 Bacteria 159853
14 Ga0055524_1007011 3300003775 Bacteria 4840
15 Ga0055524_1010056 3300003775 Bacteria 3793
16 Ga0055536_1000759 3300003781 Bacteria 21507
17 Ga0055536_1005294 3300003781 Bacteria 6349
18 Ga0055536_1006701 3300003781 Bacteria 5295
19 Ga0055536_1014566 3300003781 Bacteria 2748
20 Ga0055530_10001396 3300003791 Bacteria 17854
21 Ga0055530_10003265 3300003791 Bacteria 9433
22 Ga0055531_10004504 3300003794 Bacteria 8459
23 Ga0055531_10006858 3300003794 Bacteria 6349
24 Ga0058692_1000028 3300003856 Bacteria 193757
25 Ga0065704_10072505 3300005289 Bacteria 8411
26 Ga0065704_10144331 3300005289 Bacteria 1482
27 Ga0065715_10094970 3300005293 Bacteria 4199
28 Ga0070690_100000679 3300005330 Bacteria 17392
29 Ga0070670_100009158 3300005331 Bacteria 8463
30 Ga0070670_100011348 3300005331 Bacteria 7614
31 Ga0070670_100073661 3300005331 Bacteria 2933
32 Ga0070670_100347405 3300005331 Bacteria 1303
33 Ga0070660_100044971 3300005339 Bacteria 3378
34 Ga0070687_100002156 3300005343 Bacteria 7279
35 Ga0070661_100033798 3300005344 Bacteria 3707
36 Ga0070669_100008308 3300005353 Bacteria 7414
37 Ga0070669_100058663 3300005353 Bacteria 2825
38 Ga0070675_100001328 3300005354 Bacteria 18093
39 Ga0070671_100018481 3300005355 Bacteria 5663
40 Ga0070671_100303541 3300005355 Bacteria 1359
41 Ga0070673_100001221 3300005364 Bacteria 14852
42 Ga0070688_100046229 3300005365 Bacteria 2695
43 Ga0070659_100124972 3300005366 Bacteria 2087
44 Ga0070667_100316753 3300005367 Bacteria 1407
45 Ga0070701_10018974 3300005438 Bacteria 3242
46 Ga0070705_100028884 3300005440 Bacteria 3043
47 Ga0070700_100002135 3300005441 Bacteria 10025
48 Ga0070663_100181746 3300005455 Bacteria 1632
49 Ga0070678_100030344 3300005456 Bacteria 3716
50 Ga0070662_100321378 3300005457 Bacteria 1262
51 Ga0070684_100000450 3300005535 Bacteria 28151
52 Ga0070672_100041648 3300005543 Bacteria 3532
53 Ga0070672_100106060 3300005543 Bacteria 2285
54 Ga0070686_100000933 3300005544 Bacteria 16821
55 Ga0070696_100176574 3300005546 Bacteria 1582
56 Ga0070693_100038696 3300005547 Bacteria 2667
57 Ga0070665_100015798 3300005548 Bacteria 7582
58 Ga0068855_100009026 3300005563 Bacteria 12046
59 Ga0068855_100092486 3300005563 Bacteria 3488
60 Ga0070664_100001964 3300005564 Bacteria 16503
61 Ga0068857_100001283 3300005577 Bacteria 19730
62 Ga0068854_100002940 3300005578 Bacteria 10567
63 Ga0068854_100038189 3300005578 Bacteria 3376
64 Ga0068856_100038861 3300005614 Bacteria 4672
65 Ga0070702_100054498 3300005615 Bacteria 2301
66 Ga0068852_100038796 3300005616 Bacteria 4006
67 Ga0068859_100006841 3300005617 Bacteria 11584
68 Ga0068864_100000569 3300005618 Bacteria 31341
69 Ga0068866_10042409 3300005718 Bacteria 2264
70 Ga0068861_100020202 3300005719 Bacteria 4766
71 Ga0068851_10000226 3300005834 Bacteria 27072
72 Ga0068863_100001625 3300005841 Bacteria 22204
73 Ga0068858_100054718 3300005842 Bacteria 3690
74 Ga0068862_100004773 3300005844 Bacteria 11408
75 Ga0075364_10000199 3300006051 Bacteria 27820
76 Ga0075434_100205832 3300006871 Bacteria 1988
77 Ga0068865_100035116 3300006881 Bacteria 3369
78 Ga0097620_100006841 3300006931 Bacteria 11584
79 Ga0105251_10000155 3300009011 Bacteria 69872
80 Ga0105251_10002607 3300009011 Bacteria 13945
81 Ga0105244_10020824 3300009036 Bacteria 3635
82 Ga0105240_10005933 3300009093 Bacteria 18089
83 Ga0105240_10030882 3300009093 Bacteria 6959
84 Ga0105240_10047398 3300009093 Bacteria 5438
85 Ga0105240_10051758 3300009093 Bacteria 5166
86 Ga0105243_10031039 3300009148 Bacteria 4119
87 Ga0105248_10001446 3300009177 Bacteria 26459
88 Ga0105248_10144138 3300009177 Bacteria 2688
89 Ga0105248_10350440 3300009177 Bacteria 1662
90 Ga0105248_10700582 3300009177 Bacteria 1143
91 Ga0105237_10000212 3300009545 Bacteria 82465
92 Ga0105237_10000387 3300009545 Bacteria 62716
93 Ga0105237_10097696 3300009545 Bacteria 2927
94 Ga0105249_10008733 3300009553 Bacteria 8839
95 Ga0105032_100139 3300009979 Bacteria 7657
96 Ga0105239_10013080 3300010375 Bacteria 9221
97 Ga0157314_1000003 3300012500 Bacteria 34099
98 Ga0157369_10047874 3300013105 Bacteria 4641
99 Ga0163162_10083756 3300013306 Bacteria 3263
100 Ga0157372_10056422 3300013307 Bacteria 4389
101 Ga0157375_10001177 3300013308 Bacteria 22597
102 Ga0157375_10255886 3300013308 Bacteria 1912
103 Ga0163163_10001913 3300014325 Bacteria 17623
104 Ga0157377_10018572 3300014745 Bacteria 3616
105 Ga0182006_1015236 3300015261 Bacteria 3298
106 Ga0182005_1000676 3300015265 Bacteria 16002
107 Ga0182005_1003051 3300015265 Bacteria 5778
108 Ga0163161_10008609 3300017792 Bacteria 7053
109 Ga0206353_10413103 3300020082 Bacteria 7123
110 Ga0213876_10052435 3300021384 Bacteria 2156
111 Ga0209674_100111 3300025226 Bacteria 143058
112 Ga0209672_100008 3300025228 Bacteria 946876
113 Ga0209258_100004 3300025242 Bacteria 1376422
114 Ga0209258_100008 3300025242 Bacteria 1009355
115 Ga0209258_100217 3300025242 Bacteria 110607
116 Ga0209026_1000384 3300025250 Bacteria 40186
117 Ga0209026_1000437 3300025250 Bacteria 34592
118 Ga0209677_105507 3300025253 Bacteria 3280
119 Ga0209148_1000041 3300025254 Bacteria 469323
120 Ga0209148_1000197 3300025254 Bacteria 109412
121 Ga0209759_1000164 3300025256 Bacteria 113141
122 Ga0209129_1002281 3300025258 Bacteria 9558
123 Ga0209455_1000007 3300025272 Bacteria 1157983
124 Ga0209673_1004308 3300025273 Bacteria 7688
125 Ga0209675_1007371 3300025291 Bacteria 4226
126 Ga0209676_1000018 3300025292 Bacteria 631385
127 Ga0209676_1000501 3300025292 Bacteria 62489
128 Ga0209676_1003012 3300025292 Bacteria 10956
129 Ga0209676_1006481 3300025292 Bacteria 5765
130 Ga0209676_1012381 3300025292 Bacteria 3356
131 Ga0209676_1012770 3300025292 Bacteria 3270
132 Ga0209025_1002579 3300025294 Bacteria 18798
133 Ga0209025_1003420 3300025294 Bacteria 15056
134 Ga0209025_1020582 3300025294 Bacteria 3600
135 Ga0209564_1008102 3300025295 Bacteria 5259
136 Ga0209758_1000408 3300025297 Bacteria 73642
137 Ga0209758_1030868 3300025297 Bacteria 2210
138 Ga0209050_1000424 3300025298 Bacteria 77803
139 Ga0209050_1002116 3300025298 Bacteria 18094
140 Ga0209256_1001986 3300025299 Bacteria 18396
141 Ga0209256_1002614 3300025299 Bacteria 14244
142 Ga0209256_1005972 3300025299 Bacteria 6693
143 Ga0209051_1000809 3300025303 Bacteria 32636
144 Ga0209051_1022773 3300025303 Bacteria 2626
145 Ga0209257_1000035 3300025304 Bacteria 631463
146 Ga0209257_1000414 3300025304 Bacteria 82489
147 Ga0209257_1001475 3300025304 Bacteria 27666
148 Ga0209257_1012708 3300025304 Bacteria 3850
149 Ga0209257_1017247 3300025304 Bacteria 2858
150 Ga0207655_1050401 3300025728 Bacteria 1693
151 Ga0207713_1001387 3300025735 Bacteria 19637
152 Ga0207713_1003492 3300025735 Bacteria 10675
153 Ga0207682_10039412 3300025893 Bacteria 1921
154 Ga0207647_10011817 3300025904 Bacteria 6102
155 Ga0207647_10021906 3300025904 Bacteria 4255
156 Ga0207695_10001617 3300025913 Bacteria 36534
157 Ga0207695_10009925 3300025913 Bacteria 11699
158 Ga0207695_10024489 3300025913 Bacteria 6789
159 Ga0207671_10000009 3300025914 Bacteria 724862
160 Ga0207671_10000327 3300025914 Bacteria 69712
161 Ga0207662_10005373 3300025918 Bacteria 6824
162 Ga0207657_10027100 3300025919 Bacteria 5254
163 Ga0207649_10124953 3300025920 Bacteria 1739
164 Ga0207681_10006279 3300025923 Bacteria 7297
165 Ga0207694_10035353 3300025924 Bacteria 3832
166 Ga0207650_10002717 3300025925 Bacteria 12212
167 Ga0207650_10107187 3300025925 Bacteria 2158
168 Ga0207650_10489729 3300025925 Bacteria 1027
169 Ga0207659_10031698 3300025926 Bacteria 3622
170 Ga0207687_10203985 3300025927 Bacteria 1547
171 Ga0207644_10072150 3300025931 Bacteria 2528
172 Ga0207706_10335702 3300025933 Bacteria 1315
173 Ga0207670_10024203 3300025936 Bacteria 3793
174 Ga0207691_10057156 3300025940 Bacteria 3552
175 Ga0207711_10005954 3300025941 Bacteria 10307
176 Ga0207711_10025341 3300025941 Bacteria 4976
177 Ga0207689_10159212 3300025942 Bacteria 1861
178 Ga0207679_10036818 3300025945 Bacteria 3473
179 Ga0207667_10000063 3300025949 Bacteria 188281
180 Ga0207667_10035763 3300025949 Bacteria 5327
181 Ga0207651_10030405 3300025960 Bacteria 3438
182 Ga0207712_10086311 3300025961 Bacteria 2299
183 Ga0207668_10007764 3300025972 Bacteria 6383
184 Ga0207640_10000746 3300025981 Bacteria 18703
185 Ga0207640_10072491 3300025981 Bacteria 2324
186 Ga0207658_10071560 3300025986 Bacteria 2626
187 Ga0207703_10105125 3300026035 Bacteria 2400
188 Ga0207678_10371963 3300026067 Bacteria 1235
189 Ga0207708_10003483 3300026075 Bacteria 11606
190 Ga0207702_10000985 3300026078 Bacteria 29150
191 Ga0207641_10031430 3300026088 Bacteria 4403
192 Ga0207641_10419153 3300026088 Bacteria 1289
193 Ga0207648_10010963 3300026089 Bacteria 8562
194 Ga0207676_10004368 3300026095 Bacteria 10000
195 Ga0207674_10000123 3300026116 Bacteria 89456
196 Ga0207674_10092901 3300026116 Bacteria 3006
197 Ga0207675_100071135 3300026118 Bacteria 3252
198 Ga0209371_1000025 3300027312 Bacteria 450640
199 Ga0209970_1004485 3300027614 Bacteria 2320
200 Ga0209983_1022754 3300027665 Bacteria 1315
201 Ga0209971_1001501 3300027682 Bacteria 5789
202 Ga0268265_10005173 3300028380 Bacteria 8939
203 Ga0268264_10012065 3300028381 Bacteria 7114
204 Ga0268256_1000027 3300030500 Bacteria 450640
205 Ga0307513_10313635 3300031456 Bacteria 1329
206 Ga0307410_10129331 3300031852 Bacteria 1853
207 Ga0307406_10004711 3300031901 Bacteria 7435
208 Ga0307416_100034678 3300032002 Bacteria 3844
209 Ga0307416_100250482 3300032002 Bacteria 1723
210 Ga0307414_10001239 3300032004 Bacteria 13148
211 Ga0307414_10004652 3300032004 Bacteria 7474
212 Ga0307414_10017956 3300032004 Bacteria 4339
213 Ga0307411_10114401 3300032005 Bacteria 1938
214 Ga0307411_10131552 3300032005 Bacteria 1829
215 Ga0316574_0168259 3300035398 Bacteria 1411
216 Ga0373931_0099822 3300035691 Bacteria 1631
217 Ga0316584_0084340 3300036712 Bacteria 2380
218 Ga0395899_0000057 3300037312 Bacteria 214710
219 Ga0395899_0019444 3300037312 Bacteria 5159
220 Ga0395899_0106379 3300037312 Bacteria 2020
221 Ga0395900_0000035 3300037418 Bacteria 254301
222 Ga0395900_0018823 3300037418 Bacteria 7043
223 Ga0395898_0000045 3300037466 Bacteria 297127
224 Ga0395898_0000150 3300037466 Bacteria 181023
225 Ga0395905_0004974 3300037471 Bacteria 13689
226 Ga0395901_0036036 3300038443 Bacteria 5112
227 Ga0395901_0087858 3300038443 Bacteria 3250
228 Ga0436365_1474399 3300039437 Bacteria 3424
229 Ga0439436_0001192 3300041404 Bacteria 7385
230 Ga0439436_0001844 3300041404 Bacteria 6256
231 Ga0439436_0014671 3300041404 Bacteria 2361
232 Ga0439436_0032814 3300041404 Bacteria 1505
233 Ga0439436_0054857 3300041404 Bacteria 1120
234 Ga0439465_0000271 3300041413 Bacteria 14513
235 Ga0439465_0019999 3300041413 Bacteria 2094
236 Ga0439465_0082944 3300041413 Bacteria 1089
237 Ga0451807_2042735 3300041486 Bacteria 1638
238 Ga0439445_0001921 3300042004 Bacteria 4584
239 Ga0439445_0002572 3300042004 Bacteria 4035
240 Ga0439445_0027085 3300042004 Bacteria 1471
241 Ga0439449_0000094 3300042007 Bacteria 28713
242 Ga0439449_0002733 3300042007 Bacteria 6866
243 Ga0451577_0007856 3300042876 Bacteria 10435
244 Ga0451577_0020907 3300042876 Bacteria 5999
245 Ga0451577_0193836 3300042876 Bacteria 1833
246 Ga0466969_0001986 3300044656 Bacteria 10937
247 Ga0466969_0081193 3300044656 Bacteria 1547
248 Ga0466972_0027472 3300044658 Bacteria 2814
249 Ga0466982_0000006 3300044672 Bacteria 333931
250 Ga0466966_0028677 3300044684 Bacteria 3623
251 Ga0466966_0075700 3300044684 Bacteria 2102
252 Ga0466961_0000201 3300044693 Bacteria 40285
253 Ga0466961_0000758 3300044693 Bacteria 20217
254 Ga0466961_0004623 3300044693 Bacteria 8638
255 Ga0466961_0126727 3300044693 Bacteria 1601
256 Ga0466964_0013641 3300044706 Bacteria 3083
257 Ga0466964_0032921 3300044706 Bacteria 2062
258 Ga0453684_0535231 3300044712 Bacteria 1292
259 Ga0466971_0000539 3300044719 Bacteria 15024
260 Ga0466970_0000399 3300044765 Bacteria 21121
261 Ga0466970_0054801 3300044765 Bacteria 2129
262 Ga0466957_0001246 3300044842 Bacteria 13275
263 Ga0466957_0055809 3300044842 Bacteria 2414
264 Ga0466959_0000038 3300045049 Bacteria 101314
265 Ga0466959_0002947 3300045049 Bacteria 10983
266 Ga0451576_0327842 3300045051 Bacteria 1602
267 Ga0466958_0031969 3300045836 Bacteria 3129
268 Ga0466967_0031492 3300045976 Bacteria 4465
269 Ga0495627_022468 3300046453 Bacteria 2076
270 Ga0495610_0002965 3300046512 Bacteria 13686
271 Ga0495616_0162253 3300046513 Bacteria 1004
272 Ga0495631_0010000 3300046518 Bacteria 4714
273 Ga0495598_0002801 3300046537 Bacteria 3627
274 Ga0495621_0000246 3300046539 Bacteria 12893
275 Ga0495621_0002002 3300046539 Bacteria 5370
276 Ga0495633_0006647 3300046558 Bacteria 6818
277 Ga0495656_0022257 3300046615 Bacteria 2480
278 Ga0495668_0032153 3300046616 Bacteria 2954
279 Ga0495671_0149951 3300046692 Bacteria 1135
280 Ga0495660_0035310 3300046810 Bacteria 2794
281 Ga0495636_0010028 3300047318 Bacteria 3735
282 Ga0495636_0028422 3300047318 Bacteria 2281
283 Ga0495672_0088360 3300047320 Bacteria 1708
284 Ga0495615_0032334 3300048090 Bacteria 1261
285 Ga0495615_0045625 3300048090 Bacteria 1111
286 Ga0496103_0188345 3300048906 Bacteria 1327
287 Ga0496106_0011188 3300048909 Bacteria 6640
288 Ga0496110_0098884 3300048913 Bacteria 2616
289 Ga0496112_0188638 3300048915 Bacteria 2024
290 Ga0496112_0248485 3300048915 Bacteria 1730
291 Ga0496112_0338677 3300048915 Bacteria 1448
292 Ga0496113_0151437 3300048916 Bacteria 1830
293 Ga0496114_0000853 3300048917 Bacteria 22815
294 Ga0496116_0015919 3300048919 Bacteria 5914
295 Ga0496116_0095167 3300048919 Bacteria 1798
296 Ga0496117_0001505 3300048920 Bacteria 33389
297 Ga0496117_0020497 3300048920 Bacteria 5386
298 Ga0496118_0104254 3300048921 Bacteria 1904
299 Ga0496118_0142476 3300048921 Bacteria 1516
300 Ga0496119_0000719 3300048922 Bacteria 44523
301 Ga0496119_0001745 3300048922 Bacteria 25344
302 Ga0496120_0000196 3300048923 Bacteria 103427
303 Ga0496120_0001466 3300048923 Bacteria 28121
304 Ga0496121_0018204 3300048924 Bacteria 7100
305 Ga0496121_0026151 3300048924 Bacteria 5511
306 Ga0496121_0048779 3300048924 Bacteria 3598
307 Ga0496122_0001011 3300048925 Bacteria 49773
308 Ga0496122_0006902 3300048925 Bacteria 12836
309 Ga0496122_0029410 3300048925 Bacteria 4635
310 Ga0496123_0002592 3300048926 Bacteria 21986
311 Ga0496123_0036981 3300048926 Bacteria 3453
312 Ga0496123_0037121 3300048926 Bacteria 3445
313 Ga0496124_0000219 3300048927 Bacteria 111562
314 Ga0496124_0000584 3300048927 Bacteria 61524
315 Ga0496124_0001337 3300048927 Bacteria 37033
316 Ga0496124_0007264 3300048927 Bacteria 11816
317 Ga0496124_0012154 3300048927 Bacteria 8525
318 Ga0496124_0253785 3300048927 Bacteria 1299
319 Ga0496125_0000251 3300048928 Bacteria 110300
320 Ga0496125_0000825 3300048928 Bacteria 49981
321 Ga0496125_0001438 3300048928 Bacteria 34681
322 Ga0496125_0088325 3300048928 Bacteria 2337
323 Ga0496126_0001087 3300048929 Bacteria 45711
324 Ga0496126_0006973 3300048929 Bacteria 12492
325 Ga0496126_0042046 3300048929 Bacteria 4224
326 Ga0501031_0027221 3300049568 Bacteria 3728
327 Ga0501031_0078274 3300049568 Bacteria 2154
328 Ga0501031_0106492 3300049568 Bacteria 1830
329 Ga0501032_0011165 3300049569 Bacteria 6453
330 Ga0501032_0075048 3300049569 Bacteria 2252
331 Ga0501032_0298275 3300049569 Bacteria 1042
332 Ga0501033_0010238 3300049570 Bacteria 7195
333 Ga0501033_0059658 3300049570 Bacteria 2817
334 Ga0501034_0002264 3300049571 Bacteria 23614
335 Ga0501034_0002403 3300049571 Bacteria 22668
336 Ga0501034_0087809 3300049571 Bacteria 3109
337 Ga0501034_0174456 3300049571 Bacteria 2116
338 Ga0501036_0025387 3300049572 Bacteria 4998
339 Ga0501037_0021686 3300049573 Bacteria 4750
340 Ga0501037_0120656 3300049573 Bacteria 1885
341 Ga0501038_0039625 3300049574 Bacteria 4120
342 Ga0501038_0087555 3300049574 Bacteria 2615
343 Ga0501038_0242562 3300049574 Bacteria 1430
344 Ga0501039_0019611 3300049575 Bacteria 5186
345 Ga0501039_0324751 3300049575 Bacteria 1209
346 Ga0501043_0039385 3300049579 Bacteria 3714
347 Ga0501043_0045757 3300049579 Bacteria 3441
348 Ga0501046_0324966 3300049580 Bacteria 1120
349 Ga0501047_0005616 3300049581 Bacteria 11816
350 Ga0501048_0016232 3300049582 Bacteria 5490
351 Ga0501048_0061216 3300049582 Bacteria 2666
352 Ga0501070_0038358 3300049586 Bacteria 3997
353 Ga0501080_0015725 3300049742 Bacteria 6979
354 Ga0501275_000137 3300049772 Bacteria 8171
355 Ga0501035_0006759 3300049822 Bacteria 10719
356 Ga0501035_0055813 3300049822 Bacteria 3526
357 Ga0501035_0080433 3300049822 Bacteria 2877
358 Ga0501035_0163554 3300049822 Bacteria 1925
359 Ga0501035_0234756 3300049822 Bacteria 1562
360 Ga0501044_0016710 3300049823 Bacteria 7878
361 Ga0501044_0059182 3300049823 Bacteria 3926
362 Ga0501044_0142000 3300049823 Bacteria 2389
363 nmdc:mga00v17_154784_c1 3300050491 Bacteria 1474
364 nmdc:mga00v17_574_c1 3300050491 Bacteria 20546
365 nmdc:mga00v17_86307_c1 3300050491 Bacteria 1967
366 Ga0500634_0004804 3300053161 Bacteria 6327
367 Ga0466962_0026292 3300061719 Bacteria 2794
368 Ga0466962_0158633 3300061719 Bacteria 1099
369 2578456872 2576861471 Bacteria 4648976
370 2643818209 2643221559 Bacteria 4424915
371 2643880397 2643221573 Bacteria 4784121
372 2643906663 2643221579 Bacteria 4443405
373 2643913836 2643221581 Bacteria 3893603
374 2643937877 2643221586 Bacteria 4446529
375 2644078786 2643221612 Bacteria 4361984
376 2644528122 2643221695 Bacteria 3441323
377 2644660972 2643221720 Bacteria 4694283
378 2644693563 2643221727 Bacteria 4415595
379 2644699054 2643221728 Bacteria 4797149
380 2687584969 2687453130 Bacteria 4227172
381 2748018757 2747842501 Bacteria 5293829
382 2819661379 2818991457 Bacteria 5323295
383 2842758894 2842757796 Bacteria 3981385
384 2852652028 2852649853 Bacteria 4036942
385 2852687249 2852684882 Bacteria 5463342
386 2857444288 2857442823 Bacteria 4562550
387 2894414329 2894414249 Bacteria 4405451
388 2895502852 2895498888 Bacteria 5283788
389 2895512894 2895511927 Bacteria 6802080
390 2895522902 2895522137 Bacteria 3284416
391 2895525326 2895525241 Bacteria 3388457
392 2919130994 2919130084 Bacteria 5301837
393 2919515553 2919513703 Bacteria 3844312
394 2919678443 2919675420 Bacteria 3969095
395 2923519746 2923516293 Bacteria 3716336
396 2929196231 2929195423 Bacteria 5325372
397 2941478651 2941475908 Bacteria 4145589
398 8002870908 8002869464 Bacteria 3588529
399 8003015509 8003014200 Bacteria 4059994
400 8021622525 8021622325 Bacteria 4844743
401 8021628665 8021626552 Bacteria 4665214
402 8021650851 8021648035 Bacteria 4772378
403 Ga0439449_0002838
404 SwRhRL2b_contig_3470979
405 MBSR1b_contig_6401888
406 JGI24739J22299_10000087
407 JGI25157J39369_1001284
408 JGI25153J46596_10010132
409 rootH1_10097541
410 Ga0055527_1000140
411 Ga0055535_1000147
412 Ga0055535_1000278
413 Ga0055542_1000064
414 Ga0055542_1000308
415 Ga0055529_1000072
416 Ga0055524_1007011
417 Ga0055524_1010056
418 Ga0055536_1000759
419 Ga0055536_1005294
420 Ga0055536_1006701
421 Ga0055536_1014566
422 Ga0055530_10001396
423 Ga0055530_10003265
424 Ga0055531_10004504
425 Ga0055531_10006858
426 Ga0058692_1000028
427 Ga0065704_10072505
428 Ga0065704_10144331
429 Ga0065715_10094970
430 Ga0070690_100000679
431 Ga0070670_100009158
432 Ga0070670_100011348
433 Ga0070670_100073661
434 Ga0070670_100347405
435 Ga0070660_100044971
436 Ga0070687_100002156
437 Ga0070661_100033798
438 Ga0070669_100008308
439 Ga0070669_100058663
440 Ga0070675_100001328
441 Ga0070671_100018481
442 Ga0070671_100303541
443 Ga0070673_100001221
444 Ga0070688_100046229
445 Ga0070659_100124972
446 Ga0070667_100316753
447 Ga0070701_10018974
448 Ga0070705_100028884
449 Ga0070700_100002135
450 Ga0070663_100181746
451 Ga0070678_100030344
452 Ga0070662_100321378
453 Ga0070684_100000450
454 Ga0070672_100041648
455 Ga0070672_100106060
456 Ga0070686_100000933
457 Ga0070696_100176574
458 Ga0070693_100038696
459 Ga0070665_100015798
460 Ga0068855_100009026
461 Ga0068855_100092486
462 Ga0070664_100001964
463 Ga0068857_100001283
464 Ga0068854_100002940
465 Ga0068854_100038189
466 Ga0068856_100038861
467 Ga0070702_100054498
468 Ga0068852_100038796
469 Ga0068859_100006841
470 Ga0068864_100000569
471 Ga0068866_10042409
472 Ga0068861_100020202
473 Ga0068851_10000226
474 Ga0068863_100001625
475 Ga0068858_100054718
476 Ga0068862_100004773
477 Ga0075364_10000199
478 Ga0075434_100205832
479 Ga0068865_100035116
480 Ga0097620_100006841
481 Ga0105251_10000155
482 Ga0105251_10002607
483 Ga0105244_10020824
484 Ga0105240_10005933
485 Ga0105240_10030882
486 Ga0105240_10047398
487 Ga0105240_10051758
488 Ga0105243_10031039
489 Ga0105248_10001446
490 Ga0105248_10144138
491 Ga0105248_10350440
492 Ga0105248_10700582
493 Ga0105237_10000212
494 Ga0105237_10000387
495 Ga0105237_10097696
496 Ga0105249_10008733
497 Ga0105032_100139
498 Ga0105239_10013080
499 Ga0157314_1000003
500 Ga0157369_10047874
501 Ga0163162_10083756
502 Ga0157372_10056422
503 Ga0157375_10001177
504 Ga0157375_10255886
505 Ga0163163_10001913
506 Ga0157377_10018572
507 Ga0182006_1015236
508 Ga0182005_1000676
509 Ga0182005_1003051
510 Ga0163161_10008609
511 Ga0206353_10413103
512 Ga0213876_10052435
513 Ga0209674_100111
514 Ga0209672_100008
515 Ga0209258_100004
516 Ga0209258_100008
517 Ga0209258_100217
518 Ga0209026_1000384
519 Ga0209026_1000437
520 Ga0209677_105507
521 Ga0209148_1000041
522 Ga0209148_1000197
523 Ga0209759_1000164
524 Ga0209129_1002281
525 Ga0209455_1000007
526 Ga0209673_1004308
527 Ga0209675_1007371
528 Ga0209676_1000018
529 Ga0209676_1000501
530 Ga0209676_1003012
531 Ga0209676_1006481
532 Ga0209676_1012381
533 Ga0209676_1012770
534 Ga0209025_1002579
535 Ga0209025_1003420
536 Ga0209025_1020582
537 Ga0209564_1008102
538 Ga0209758_1000408
539 Ga0209758_1030868
540 Ga0209050_1000424
541 Ga0209050_1002116
542 Ga0209256_1001986
543 Ga0209256_1002614
544 Ga0209256_1005972
545 Ga0209051_1000809
546 Ga0209051_1022773
547 Ga0209257_1000035
548 Ga0209257_1000414
549 Ga0209257_1001475
550 Ga0209257_1012708
551 Ga0209257_1017247
552 Ga0207655_1050401
553 Ga0207713_1001387
554 Ga0207713_1003492
555 Ga0207682_10039412
556 Ga0207647_10011817
557 Ga0207647_10021906
558 Ga0207695_10001617
559 Ga0207695_10009925
560 Ga0207695_10024489
561 Ga0207671_10000009
562 Ga0207671_10000327
563 Ga0207662_10005373
564 Ga0207657_10027100
565 Ga0207649_10124953
566 Ga0207681_10006279
567 Ga0207694_10035353
568 Ga0207650_10002717
569 Ga0207650_10107187
570 Ga0207650_10489729
571 Ga0207659_10031698
572 Ga0207687_10203985
573 Ga0207644_10072150
574 Ga0207706_10335702
575 Ga0207670_10024203
576 Ga0207691_10057156
577 Ga0207711_10005954
578 Ga0207711_10025341
579 Ga0207689_10159212
580 Ga0207679_10036818
581 Ga0207667_10000063
582 Ga0207667_10035763
583 Ga0207651_10030405
584 Ga0207712_10086311
585 Ga0207668_10007764
586 Ga0207640_10000746
587 Ga0207640_10072491
588 Ga0207658_10071560
589 Ga0207703_10105125
590 Ga0207678_10371963
591 Ga0207708_10003483
592 Ga0207702_10000985
593 Ga0207641_10031430
594 Ga0207641_10419153
595 Ga0207648_10010963
596 Ga0207676_10004368
597 Ga0207674_10000123
598 Ga0207674_10092901
599 Ga0207675_100071135
600 Ga0209371_1000025
601 Ga0209970_1004485
602 Ga0209983_1022754
603 Ga0209971_1001501
604 Ga0268265_10005173
605 Ga0268264_10012065
606 Ga0268256_1000027
607 Ga0307513_10313635
608 Ga0307410_10129331
609 Ga0307406_10004711
610 Ga0307416_100034678
611 Ga0307416_100250482
612 Ga0307414_10001239
613 Ga0307414_10004652
614 Ga0307414_10017956
615 Ga0307411_10114401
616 Ga0307411_10131552
617 Ga0316574_0168259
618 Ga0373931_0099822
619 Ga0316584_0084340
620 Ga0395899_0000057
621 Ga0395899_0019444
622 Ga0395899_0106379
623 Ga0395900_0000035
624 Ga0395900_0018823
625 Ga0395898_0000045
626 Ga0395898_0000150
627 Ga0395905_0004974
628 Ga0395901_0036036
629 Ga0395901_0087858
630 Ga0436365_1474399
631 Ga0439436_0001192
632 Ga0439436_0001844
633 Ga0439436_0014671
634 Ga0439436_0032814
635 Ga0439436_0054857
636 Ga0439465_0000271
637 Ga0439465_0019999
638 Ga0439465_0082944
639 Ga0451807_2042735
640 Ga0439445_0001921
641 Ga0439445_0002572
642 Ga0439445_0027085
643 Ga0439449_0000094
644 Ga0439449_0002733
645 Ga0451577_0007856
646 Ga0451577_0020907
647 Ga0451577_0193836
648 Ga0466969_0001986
649 Ga0466969_0081193
650 Ga0466972_0027472
651 Ga0466982_0000006
652 Ga0466966_0028677
653 Ga0466966_0075700
654 Ga0466961_0000201
655 Ga0466961_0000758
656 Ga0466961_0004623
657 Ga0466961_0126727
658 Ga0466964_0013641
659 Ga0466964_0032921
660 Ga0453684_0535231
661 Ga0466971_0000539
662 Ga0466970_0000399
663 Ga0466970_0054801
664 Ga0466957_0001246
665 Ga0466957_0055809
666 Ga0466959_0000038
667 Ga0466959_0002947
668 Ga0451576_0327842
669 Ga0466958_0031969
670 Ga0466967_0031492
671 Ga0495627_022468
672 Ga0495610_0002965
673 Ga0495616_0162253
674 Ga0495631_0010000
675 Ga0495598_0002801
676 Ga0495621_0000246
677 Ga0495621_0002002
678 Ga0495633_0006647
679 Ga0495656_0022257
680 Ga0495668_0032153
681 Ga0495671_0149951
682 Ga0495660_0035310
683 Ga0495636_0010028
684 Ga0495636_0028422
685 Ga0495672_0088360
686 Ga0495615_0032334
687 Ga0495615_0045625
688 Ga0496103_0188345
689 Ga0496106_0011188
690 Ga0496110_0098884
691 Ga0496112_0188638
692 Ga0496112_0248485
693 Ga0496112_0338677
694 Ga0496113_0151437
695 Ga0496114_0000853
696 Ga0496116_0015919
697 Ga0496116_0095167
698 Ga0496117_0001505
699 Ga0496117_0020497
700 Ga0496118_0104254
701 Ga0496118_0142476
702 Ga0496119_0000719
703 Ga0496119_0001745
704 Ga0496120_0000196
705 Ga0496120_0001466
706 Ga0496121_0018204
707 Ga0496121_0026151
708 Ga0496121_0048779
709 Ga0496122_0001011
710 Ga0496122_0006902
711 Ga0496122_0029410
712 Ga0496123_0002592
713 Ga0496123_0036981
714 Ga0496123_0037121
715 Ga0496124_0000219
716 Ga0496124_0000584
717 Ga0496124_0001337
718 Ga0496124_0007264
719 Ga0496124_0012154
720 Ga0496124_0253785
721 Ga0496125_0000251
722 Ga0496125_0000825
723 Ga0496125_0001438
724 Ga0496125_0088325
725 Ga0496126_0001087
726 Ga0496126_0006973
727 Ga0496126_0042046
728 Ga0501031_0027221
729 Ga0501031_0078274
730 Ga0501031_0106492
731 Ga0501032_0011165
732 Ga0501032_0075048
733 Ga0501032_0298275
734 Ga0501033_0010238
735 Ga0501033_0059658
736 Ga0501034_0002264
737 Ga0501034_0002403
738 Ga0501034_0087809
739 Ga0501034_0174456
740 Ga0501036_0025387
741 Ga0501037_0021686
742 Ga0501037_0120656
743 Ga0501038_0039625
744 Ga0501038_0087555
745 Ga0501038_0242562
746 Ga0501039_0019611
747 Ga0501039_0324751
748 Ga0501043_0039385
749 Ga0501043_0045757
750 Ga0501046_0324966
751 Ga0501047_0005616
752 Ga0501048_0016232
753 Ga0501048_0061216
754 Ga0501070_0038358
755 Ga0501080_0015725
756 Ga0501275_000137
757 Ga0501035_0006759
758 Ga0501035_0055813
759 Ga0501035_0080433
760 Ga0501035_0163554
761 Ga0501035_0234756
762 Ga0501044_0016710
763 Ga0501044_0059182
764 Ga0501044_0142000
765 nmdc:mga00v17_154784_c1
766 nmdc:mga00v17_574_c1
767 nmdc:mga00v17_86307_c1
768 Ga0500634_0004804
769 Ga0466962_0026292
770 Ga0466962_0158633
771 2578456872
772 2643818209
773 2643880397
774 2643906663
775 2643913836
776 2643937877
777 2644078786
778 2644528122
779 2644660972
780 2644693563
781 2644699054
782 2687584969
783 2748018757
784 2819661379
785 2842758894
786 2852652028
787 2852687249
788 2857444288
789 2894414329
790 2895502852
791 2895512894
792 2895522902
793 2895525326
794 2919130994
795 2919515553
796 2919678443
797 2923519746
798 2929196231
799 2941478651
800 8002870908
801 8003015509
802 8021622525
803 8021628665
804 8021650851

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

5

197

0.97

PF03900

Porphobil_deamC

Porphobilinogen deaminase, C-terminal domain

208

279

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.923 2 301
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.9199 2 301
1ypn-assembly1.cif.gz_A reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction 0.9118 3 301
2ypn-assembly1.cif.gz_A hydroxymethylbilane synthase 0.9105 1 301
4mlq-assembly1.cif.gz_A crystal structure of bacillus megaterium porphobilinogen deaminase 0.9103 1 302
ID Description Score Start End Superfamily
5m7fA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9634 4 95 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9518 99 197 3.40.190.10
af_Q54P93_232_322_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9465 222 301 3.30.160.40
af_F1R6A1_237_360_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9437 219 301 3.30.160.40
4fajA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9424 1 40 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A7V9IPV6-F1-model_v4 Hydroxymethylbilane synthase 0.9657 215 303 GO:0004418
GO:0033014
AF-A0A496W235-F1-model_v4 Hydroxymethylbilane synthase 0.9656 221 302 GO:0004418
GO:0005737
GO:0006783
AF-A0A7C7MUS1-F1-model_v4 Hydroxymethylbilane synthase 0.9628 217 301 GO:0004418
GO:0005737
GO:0006783
AF-A0A645FZN3-F1-model_v4 Porphobilinogen deaminase (EC 2.5.1.61) 0.9617 225 301 GO:0004418
GO:0005737
GO:0006783
AF-X1BBZ5-F1-model_v4 Porphobilinogen deaminase C-terminal domain-containing protein 0.9613 226 301 GO:0004418
GO:0005737
GO:0006783

Map