F435152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 402 | 263 | 804 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0002838|Ga0439449_0002838_1821_2744 |
| Length | 291 |
| Sequence | MTRLLRIATRKSPLALWQSEHVAAALRAAHSGLDVVLVPMSTRGDEVLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELEPGFALPAILQRADHADAFVSNRYDNIDALPLGAVVGTSSLRRQAQLRTRLAKLDAGEYDAIVLACAGLQRLGFDARIRSRMDAPQWLPAPAQGAIAIECRDDDADTRALCAKLDHTATRICVEAERAMNRTLHGSCHVPVAAFARLEGERLHLHGLVGSAADGRAIRAQAEGRGDAPESLGREVAQSLQQQGAGDLIAASGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 161 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 162 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 163 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 203 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 204 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 228 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 231 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 232 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 233 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 234 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 235 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 236 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 237 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 238 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 239 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 240 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 241 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 242 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 243 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 244 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 245 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 246 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 247 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 248 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 249 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 250 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 251 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 252 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 253 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 254 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 255 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 256 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 257 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 258 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 259 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 260 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 261 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 262 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 263 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.29 |
| Metatranscriptomes | 0.25 |
| Isolates | 8.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.43 |
| Nodule | 0 |
| Rhizoplane | 2.24 |
| Rhizosphere | 68.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439449_0002838 | 3300042007 | Bacteria | 6736 |
| 2 | SwRhRL2b_contig_3470979 | 2162886007 | Bacteria | 1482 |
| 3 | MBSR1b_contig_6401888 | 2162886012 | Bacteria | 2289 |
| 4 | JGI24739J22299_10000087 | 3300001989 | Bacteria | 26642 |
| 5 | JGI25157J39369_1001284 | 3300002741 | Bacteria | 10096 |
| 6 | JGI25153J46596_10010132 | 3300003215 | Bacteria | 4293 |
| 7 | rootH1_10097541 | 3300003316 | Bacteria | 1941 |
| 8 | Ga0055527_1000140 | 3300003760 | Bacteria | 51402 |
| 9 | Ga0055535_1000147 | 3300003761 | Bacteria | 74557 |
| 10 | Ga0055535_1000278 | 3300003761 | Bacteria | 53724 |
| 11 | Ga0055542_1000064 | 3300003762 | Bacteria | 159853 |
| 12 | Ga0055542_1000308 | 3300003762 | Bacteria | 53724 |
| 13 | Ga0055529_1000072 | 3300003763 | Bacteria | 159853 |
| 14 | Ga0055524_1007011 | 3300003775 | Bacteria | 4840 |
| 15 | Ga0055524_1010056 | 3300003775 | Bacteria | 3793 |
| 16 | Ga0055536_1000759 | 3300003781 | Bacteria | 21507 |
| 17 | Ga0055536_1005294 | 3300003781 | Bacteria | 6349 |
| 18 | Ga0055536_1006701 | 3300003781 | Bacteria | 5295 |
| 19 | Ga0055536_1014566 | 3300003781 | Bacteria | 2748 |
| 20 | Ga0055530_10001396 | 3300003791 | Bacteria | 17854 |
| 21 | Ga0055530_10003265 | 3300003791 | Bacteria | 9433 |
| 22 | Ga0055531_10004504 | 3300003794 | Bacteria | 8459 |
| 23 | Ga0055531_10006858 | 3300003794 | Bacteria | 6349 |
| 24 | Ga0058692_1000028 | 3300003856 | Bacteria | 193757 |
| 25 | Ga0065704_10072505 | 3300005289 | Bacteria | 8411 |
| 26 | Ga0065704_10144331 | 3300005289 | Bacteria | 1482 |
| 27 | Ga0065715_10094970 | 3300005293 | Bacteria | 4199 |
| 28 | Ga0070690_100000679 | 3300005330 | Bacteria | 17392 |
| 29 | Ga0070670_100009158 | 3300005331 | Bacteria | 8463 |
| 30 | Ga0070670_100011348 | 3300005331 | Bacteria | 7614 |
| 31 | Ga0070670_100073661 | 3300005331 | Bacteria | 2933 |
| 32 | Ga0070670_100347405 | 3300005331 | Bacteria | 1303 |
| 33 | Ga0070660_100044971 | 3300005339 | Bacteria | 3378 |
| 34 | Ga0070687_100002156 | 3300005343 | Bacteria | 7279 |
| 35 | Ga0070661_100033798 | 3300005344 | Bacteria | 3707 |
| 36 | Ga0070669_100008308 | 3300005353 | Bacteria | 7414 |
| 37 | Ga0070669_100058663 | 3300005353 | Bacteria | 2825 |
| 38 | Ga0070675_100001328 | 3300005354 | Bacteria | 18093 |
| 39 | Ga0070671_100018481 | 3300005355 | Bacteria | 5663 |
| 40 | Ga0070671_100303541 | 3300005355 | Bacteria | 1359 |
| 41 | Ga0070673_100001221 | 3300005364 | Bacteria | 14852 |
| 42 | Ga0070688_100046229 | 3300005365 | Bacteria | 2695 |
| 43 | Ga0070659_100124972 | 3300005366 | Bacteria | 2087 |
| 44 | Ga0070667_100316753 | 3300005367 | Bacteria | 1407 |
| 45 | Ga0070701_10018974 | 3300005438 | Bacteria | 3242 |
| 46 | Ga0070705_100028884 | 3300005440 | Bacteria | 3043 |
| 47 | Ga0070700_100002135 | 3300005441 | Bacteria | 10025 |
| 48 | Ga0070663_100181746 | 3300005455 | Bacteria | 1632 |
| 49 | Ga0070678_100030344 | 3300005456 | Bacteria | 3716 |
| 50 | Ga0070662_100321378 | 3300005457 | Bacteria | 1262 |
| 51 | Ga0070684_100000450 | 3300005535 | Bacteria | 28151 |
| 52 | Ga0070672_100041648 | 3300005543 | Bacteria | 3532 |
| 53 | Ga0070672_100106060 | 3300005543 | Bacteria | 2285 |
| 54 | Ga0070686_100000933 | 3300005544 | Bacteria | 16821 |
| 55 | Ga0070696_100176574 | 3300005546 | Bacteria | 1582 |
| 56 | Ga0070693_100038696 | 3300005547 | Bacteria | 2667 |
| 57 | Ga0070665_100015798 | 3300005548 | Bacteria | 7582 |
| 58 | Ga0068855_100009026 | 3300005563 | Bacteria | 12046 |
| 59 | Ga0068855_100092486 | 3300005563 | Bacteria | 3488 |
| 60 | Ga0070664_100001964 | 3300005564 | Bacteria | 16503 |
| 61 | Ga0068857_100001283 | 3300005577 | Bacteria | 19730 |
| 62 | Ga0068854_100002940 | 3300005578 | Bacteria | 10567 |
| 63 | Ga0068854_100038189 | 3300005578 | Bacteria | 3376 |
| 64 | Ga0068856_100038861 | 3300005614 | Bacteria | 4672 |
| 65 | Ga0070702_100054498 | 3300005615 | Bacteria | 2301 |
| 66 | Ga0068852_100038796 | 3300005616 | Bacteria | 4006 |
| 67 | Ga0068859_100006841 | 3300005617 | Bacteria | 11584 |
| 68 | Ga0068864_100000569 | 3300005618 | Bacteria | 31341 |
| 69 | Ga0068866_10042409 | 3300005718 | Bacteria | 2264 |
| 70 | Ga0068861_100020202 | 3300005719 | Bacteria | 4766 |
| 71 | Ga0068851_10000226 | 3300005834 | Bacteria | 27072 |
| 72 | Ga0068863_100001625 | 3300005841 | Bacteria | 22204 |
| 73 | Ga0068858_100054718 | 3300005842 | Bacteria | 3690 |
| 74 | Ga0068862_100004773 | 3300005844 | Bacteria | 11408 |
| 75 | Ga0075364_10000199 | 3300006051 | Bacteria | 27820 |
| 76 | Ga0075434_100205832 | 3300006871 | Bacteria | 1988 |
| 77 | Ga0068865_100035116 | 3300006881 | Bacteria | 3369 |
| 78 | Ga0097620_100006841 | 3300006931 | Bacteria | 11584 |
| 79 | Ga0105251_10000155 | 3300009011 | Bacteria | 69872 |
| 80 | Ga0105251_10002607 | 3300009011 | Bacteria | 13945 |
| 81 | Ga0105244_10020824 | 3300009036 | Bacteria | 3635 |
| 82 | Ga0105240_10005933 | 3300009093 | Bacteria | 18089 |
| 83 | Ga0105240_10030882 | 3300009093 | Bacteria | 6959 |
| 84 | Ga0105240_10047398 | 3300009093 | Bacteria | 5438 |
| 85 | Ga0105240_10051758 | 3300009093 | Bacteria | 5166 |
| 86 | Ga0105243_10031039 | 3300009148 | Bacteria | 4119 |
| 87 | Ga0105248_10001446 | 3300009177 | Bacteria | 26459 |
| 88 | Ga0105248_10144138 | 3300009177 | Bacteria | 2688 |
| 89 | Ga0105248_10350440 | 3300009177 | Bacteria | 1662 |
| 90 | Ga0105248_10700582 | 3300009177 | Bacteria | 1143 |
| 91 | Ga0105237_10000212 | 3300009545 | Bacteria | 82465 |
| 92 | Ga0105237_10000387 | 3300009545 | Bacteria | 62716 |
| 93 | Ga0105237_10097696 | 3300009545 | Bacteria | 2927 |
| 94 | Ga0105249_10008733 | 3300009553 | Bacteria | 8839 |
| 95 | Ga0105032_100139 | 3300009979 | Bacteria | 7657 |
| 96 | Ga0105239_10013080 | 3300010375 | Bacteria | 9221 |
| 97 | Ga0157314_1000003 | 3300012500 | Bacteria | 34099 |
| 98 | Ga0157369_10047874 | 3300013105 | Bacteria | 4641 |
| 99 | Ga0163162_10083756 | 3300013306 | Bacteria | 3263 |
| 100 | Ga0157372_10056422 | 3300013307 | Bacteria | 4389 |
| 101 | Ga0157375_10001177 | 3300013308 | Bacteria | 22597 |
| 102 | Ga0157375_10255886 | 3300013308 | Bacteria | 1912 |
| 103 | Ga0163163_10001913 | 3300014325 | Bacteria | 17623 |
| 104 | Ga0157377_10018572 | 3300014745 | Bacteria | 3616 |
| 105 | Ga0182006_1015236 | 3300015261 | Bacteria | 3298 |
| 106 | Ga0182005_1000676 | 3300015265 | Bacteria | 16002 |
| 107 | Ga0182005_1003051 | 3300015265 | Bacteria | 5778 |
| 108 | Ga0163161_10008609 | 3300017792 | Bacteria | 7053 |
| 109 | Ga0206353_10413103 | 3300020082 | Bacteria | 7123 |
| 110 | Ga0213876_10052435 | 3300021384 | Bacteria | 2156 |
| 111 | Ga0209674_100111 | 3300025226 | Bacteria | 143058 |
| 112 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 113 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 114 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 115 | Ga0209258_100217 | 3300025242 | Bacteria | 110607 |
| 116 | Ga0209026_1000384 | 3300025250 | Bacteria | 40186 |
| 117 | Ga0209026_1000437 | 3300025250 | Bacteria | 34592 |
| 118 | Ga0209677_105507 | 3300025253 | Bacteria | 3280 |
| 119 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 120 | Ga0209148_1000197 | 3300025254 | Bacteria | 109412 |
| 121 | Ga0209759_1000164 | 3300025256 | Bacteria | 113141 |
| 122 | Ga0209129_1002281 | 3300025258 | Bacteria | 9558 |
| 123 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 124 | Ga0209673_1004308 | 3300025273 | Bacteria | 7688 |
| 125 | Ga0209675_1007371 | 3300025291 | Bacteria | 4226 |
| 126 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 127 | Ga0209676_1000501 | 3300025292 | Bacteria | 62489 |
| 128 | Ga0209676_1003012 | 3300025292 | Bacteria | 10956 |
| 129 | Ga0209676_1006481 | 3300025292 | Bacteria | 5765 |
| 130 | Ga0209676_1012381 | 3300025292 | Bacteria | 3356 |
| 131 | Ga0209676_1012770 | 3300025292 | Bacteria | 3270 |
| 132 | Ga0209025_1002579 | 3300025294 | Bacteria | 18798 |
| 133 | Ga0209025_1003420 | 3300025294 | Bacteria | 15056 |
| 134 | Ga0209025_1020582 | 3300025294 | Bacteria | 3600 |
| 135 | Ga0209564_1008102 | 3300025295 | Bacteria | 5259 |
| 136 | Ga0209758_1000408 | 3300025297 | Bacteria | 73642 |
| 137 | Ga0209758_1030868 | 3300025297 | Bacteria | 2210 |
| 138 | Ga0209050_1000424 | 3300025298 | Bacteria | 77803 |
| 139 | Ga0209050_1002116 | 3300025298 | Bacteria | 18094 |
| 140 | Ga0209256_1001986 | 3300025299 | Bacteria | 18396 |
| 141 | Ga0209256_1002614 | 3300025299 | Bacteria | 14244 |
| 142 | Ga0209256_1005972 | 3300025299 | Bacteria | 6693 |
| 143 | Ga0209051_1000809 | 3300025303 | Bacteria | 32636 |
| 144 | Ga0209051_1022773 | 3300025303 | Bacteria | 2626 |
| 145 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 146 | Ga0209257_1000414 | 3300025304 | Bacteria | 82489 |
| 147 | Ga0209257_1001475 | 3300025304 | Bacteria | 27666 |
| 148 | Ga0209257_1012708 | 3300025304 | Bacteria | 3850 |
| 149 | Ga0209257_1017247 | 3300025304 | Bacteria | 2858 |
| 150 | Ga0207655_1050401 | 3300025728 | Bacteria | 1693 |
| 151 | Ga0207713_1001387 | 3300025735 | Bacteria | 19637 |
| 152 | Ga0207713_1003492 | 3300025735 | Bacteria | 10675 |
| 153 | Ga0207682_10039412 | 3300025893 | Bacteria | 1921 |
| 154 | Ga0207647_10011817 | 3300025904 | Bacteria | 6102 |
| 155 | Ga0207647_10021906 | 3300025904 | Bacteria | 4255 |
| 156 | Ga0207695_10001617 | 3300025913 | Bacteria | 36534 |
| 157 | Ga0207695_10009925 | 3300025913 | Bacteria | 11699 |
| 158 | Ga0207695_10024489 | 3300025913 | Bacteria | 6789 |
| 159 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 160 | Ga0207671_10000327 | 3300025914 | Bacteria | 69712 |
| 161 | Ga0207662_10005373 | 3300025918 | Bacteria | 6824 |
| 162 | Ga0207657_10027100 | 3300025919 | Bacteria | 5254 |
| 163 | Ga0207649_10124953 | 3300025920 | Bacteria | 1739 |
| 164 | Ga0207681_10006279 | 3300025923 | Bacteria | 7297 |
| 165 | Ga0207694_10035353 | 3300025924 | Bacteria | 3832 |
| 166 | Ga0207650_10002717 | 3300025925 | Bacteria | 12212 |
| 167 | Ga0207650_10107187 | 3300025925 | Bacteria | 2158 |
| 168 | Ga0207650_10489729 | 3300025925 | Bacteria | 1027 |
| 169 | Ga0207659_10031698 | 3300025926 | Bacteria | 3622 |
| 170 | Ga0207687_10203985 | 3300025927 | Bacteria | 1547 |
| 171 | Ga0207644_10072150 | 3300025931 | Bacteria | 2528 |
| 172 | Ga0207706_10335702 | 3300025933 | Bacteria | 1315 |
| 173 | Ga0207670_10024203 | 3300025936 | Bacteria | 3793 |
| 174 | Ga0207691_10057156 | 3300025940 | Bacteria | 3552 |
| 175 | Ga0207711_10005954 | 3300025941 | Bacteria | 10307 |
| 176 | Ga0207711_10025341 | 3300025941 | Bacteria | 4976 |
| 177 | Ga0207689_10159212 | 3300025942 | Bacteria | 1861 |
| 178 | Ga0207679_10036818 | 3300025945 | Bacteria | 3473 |
| 179 | Ga0207667_10000063 | 3300025949 | Bacteria | 188281 |
| 180 | Ga0207667_10035763 | 3300025949 | Bacteria | 5327 |
| 181 | Ga0207651_10030405 | 3300025960 | Bacteria | 3438 |
| 182 | Ga0207712_10086311 | 3300025961 | Bacteria | 2299 |
| 183 | Ga0207668_10007764 | 3300025972 | Bacteria | 6383 |
| 184 | Ga0207640_10000746 | 3300025981 | Bacteria | 18703 |
| 185 | Ga0207640_10072491 | 3300025981 | Bacteria | 2324 |
| 186 | Ga0207658_10071560 | 3300025986 | Bacteria | 2626 |
| 187 | Ga0207703_10105125 | 3300026035 | Bacteria | 2400 |
| 188 | Ga0207678_10371963 | 3300026067 | Bacteria | 1235 |
| 189 | Ga0207708_10003483 | 3300026075 | Bacteria | 11606 |
| 190 | Ga0207702_10000985 | 3300026078 | Bacteria | 29150 |
| 191 | Ga0207641_10031430 | 3300026088 | Bacteria | 4403 |
| 192 | Ga0207641_10419153 | 3300026088 | Bacteria | 1289 |
| 193 | Ga0207648_10010963 | 3300026089 | Bacteria | 8562 |
| 194 | Ga0207676_10004368 | 3300026095 | Bacteria | 10000 |
| 195 | Ga0207674_10000123 | 3300026116 | Bacteria | 89456 |
| 196 | Ga0207674_10092901 | 3300026116 | Bacteria | 3006 |
| 197 | Ga0207675_100071135 | 3300026118 | Bacteria | 3252 |
| 198 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 199 | Ga0209970_1004485 | 3300027614 | Bacteria | 2320 |
| 200 | Ga0209983_1022754 | 3300027665 | Bacteria | 1315 |
| 201 | Ga0209971_1001501 | 3300027682 | Bacteria | 5789 |
| 202 | Ga0268265_10005173 | 3300028380 | Bacteria | 8939 |
| 203 | Ga0268264_10012065 | 3300028381 | Bacteria | 7114 |
| 204 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 205 | Ga0307513_10313635 | 3300031456 | Bacteria | 1329 |
| 206 | Ga0307410_10129331 | 3300031852 | Bacteria | 1853 |
| 207 | Ga0307406_10004711 | 3300031901 | Bacteria | 7435 |
| 208 | Ga0307416_100034678 | 3300032002 | Bacteria | 3844 |
| 209 | Ga0307416_100250482 | 3300032002 | Bacteria | 1723 |
| 210 | Ga0307414_10001239 | 3300032004 | Bacteria | 13148 |
| 211 | Ga0307414_10004652 | 3300032004 | Bacteria | 7474 |
| 212 | Ga0307414_10017956 | 3300032004 | Bacteria | 4339 |
| 213 | Ga0307411_10114401 | 3300032005 | Bacteria | 1938 |
| 214 | Ga0307411_10131552 | 3300032005 | Bacteria | 1829 |
| 215 | Ga0316574_0168259 | 3300035398 | Bacteria | 1411 |
| 216 | Ga0373931_0099822 | 3300035691 | Bacteria | 1631 |
| 217 | Ga0316584_0084340 | 3300036712 | Bacteria | 2380 |
| 218 | Ga0395899_0000057 | 3300037312 | Bacteria | 214710 |
| 219 | Ga0395899_0019444 | 3300037312 | Bacteria | 5159 |
| 220 | Ga0395899_0106379 | 3300037312 | Bacteria | 2020 |
| 221 | Ga0395900_0000035 | 3300037418 | Bacteria | 254301 |
| 222 | Ga0395900_0018823 | 3300037418 | Bacteria | 7043 |
| 223 | Ga0395898_0000045 | 3300037466 | Bacteria | 297127 |
| 224 | Ga0395898_0000150 | 3300037466 | Bacteria | 181023 |
| 225 | Ga0395905_0004974 | 3300037471 | Bacteria | 13689 |
| 226 | Ga0395901_0036036 | 3300038443 | Bacteria | 5112 |
| 227 | Ga0395901_0087858 | 3300038443 | Bacteria | 3250 |
| 228 | Ga0436365_1474399 | 3300039437 | Bacteria | 3424 |
| 229 | Ga0439436_0001192 | 3300041404 | Bacteria | 7385 |
| 230 | Ga0439436_0001844 | 3300041404 | Bacteria | 6256 |
| 231 | Ga0439436_0014671 | 3300041404 | Bacteria | 2361 |
| 232 | Ga0439436_0032814 | 3300041404 | Bacteria | 1505 |
| 233 | Ga0439436_0054857 | 3300041404 | Bacteria | 1120 |
| 234 | Ga0439465_0000271 | 3300041413 | Bacteria | 14513 |
| 235 | Ga0439465_0019999 | 3300041413 | Bacteria | 2094 |
| 236 | Ga0439465_0082944 | 3300041413 | Bacteria | 1089 |
| 237 | Ga0451807_2042735 | 3300041486 | Bacteria | 1638 |
| 238 | Ga0439445_0001921 | 3300042004 | Bacteria | 4584 |
| 239 | Ga0439445_0002572 | 3300042004 | Bacteria | 4035 |
| 240 | Ga0439445_0027085 | 3300042004 | Bacteria | 1471 |
| 241 | Ga0439449_0000094 | 3300042007 | Bacteria | 28713 |
| 242 | Ga0439449_0002733 | 3300042007 | Bacteria | 6866 |
| 243 | Ga0451577_0007856 | 3300042876 | Bacteria | 10435 |
| 244 | Ga0451577_0020907 | 3300042876 | Bacteria | 5999 |
| 245 | Ga0451577_0193836 | 3300042876 | Bacteria | 1833 |
| 246 | Ga0466969_0001986 | 3300044656 | Bacteria | 10937 |
| 247 | Ga0466969_0081193 | 3300044656 | Bacteria | 1547 |
| 248 | Ga0466972_0027472 | 3300044658 | Bacteria | 2814 |
| 249 | Ga0466982_0000006 | 3300044672 | Bacteria | 333931 |
| 250 | Ga0466966_0028677 | 3300044684 | Bacteria | 3623 |
| 251 | Ga0466966_0075700 | 3300044684 | Bacteria | 2102 |
| 252 | Ga0466961_0000201 | 3300044693 | Bacteria | 40285 |
| 253 | Ga0466961_0000758 | 3300044693 | Bacteria | 20217 |
| 254 | Ga0466961_0004623 | 3300044693 | Bacteria | 8638 |
| 255 | Ga0466961_0126727 | 3300044693 | Bacteria | 1601 |
| 256 | Ga0466964_0013641 | 3300044706 | Bacteria | 3083 |
| 257 | Ga0466964_0032921 | 3300044706 | Bacteria | 2062 |
| 258 | Ga0453684_0535231 | 3300044712 | Bacteria | 1292 |
| 259 | Ga0466971_0000539 | 3300044719 | Bacteria | 15024 |
| 260 | Ga0466970_0000399 | 3300044765 | Bacteria | 21121 |
| 261 | Ga0466970_0054801 | 3300044765 | Bacteria | 2129 |
| 262 | Ga0466957_0001246 | 3300044842 | Bacteria | 13275 |
| 263 | Ga0466957_0055809 | 3300044842 | Bacteria | 2414 |
| 264 | Ga0466959_0000038 | 3300045049 | Bacteria | 101314 |
| 265 | Ga0466959_0002947 | 3300045049 | Bacteria | 10983 |
| 266 | Ga0451576_0327842 | 3300045051 | Bacteria | 1602 |
| 267 | Ga0466958_0031969 | 3300045836 | Bacteria | 3129 |
| 268 | Ga0466967_0031492 | 3300045976 | Bacteria | 4465 |
| 269 | Ga0495627_022468 | 3300046453 | Bacteria | 2076 |
| 270 | Ga0495610_0002965 | 3300046512 | Bacteria | 13686 |
| 271 | Ga0495616_0162253 | 3300046513 | Bacteria | 1004 |
| 272 | Ga0495631_0010000 | 3300046518 | Bacteria | 4714 |
| 273 | Ga0495598_0002801 | 3300046537 | Bacteria | 3627 |
| 274 | Ga0495621_0000246 | 3300046539 | Bacteria | 12893 |
| 275 | Ga0495621_0002002 | 3300046539 | Bacteria | 5370 |
| 276 | Ga0495633_0006647 | 3300046558 | Bacteria | 6818 |
| 277 | Ga0495656_0022257 | 3300046615 | Bacteria | 2480 |
| 278 | Ga0495668_0032153 | 3300046616 | Bacteria | 2954 |
| 279 | Ga0495671_0149951 | 3300046692 | Bacteria | 1135 |
| 280 | Ga0495660_0035310 | 3300046810 | Bacteria | 2794 |
| 281 | Ga0495636_0010028 | 3300047318 | Bacteria | 3735 |
| 282 | Ga0495636_0028422 | 3300047318 | Bacteria | 2281 |
| 283 | Ga0495672_0088360 | 3300047320 | Bacteria | 1708 |
| 284 | Ga0495615_0032334 | 3300048090 | Bacteria | 1261 |
| 285 | Ga0495615_0045625 | 3300048090 | Bacteria | 1111 |
| 286 | Ga0496103_0188345 | 3300048906 | Bacteria | 1327 |
| 287 | Ga0496106_0011188 | 3300048909 | Bacteria | 6640 |
| 288 | Ga0496110_0098884 | 3300048913 | Bacteria | 2616 |
| 289 | Ga0496112_0188638 | 3300048915 | Bacteria | 2024 |
| 290 | Ga0496112_0248485 | 3300048915 | Bacteria | 1730 |
| 291 | Ga0496112_0338677 | 3300048915 | Bacteria | 1448 |
| 292 | Ga0496113_0151437 | 3300048916 | Bacteria | 1830 |
| 293 | Ga0496114_0000853 | 3300048917 | Bacteria | 22815 |
| 294 | Ga0496116_0015919 | 3300048919 | Bacteria | 5914 |
| 295 | Ga0496116_0095167 | 3300048919 | Bacteria | 1798 |
| 296 | Ga0496117_0001505 | 3300048920 | Bacteria | 33389 |
| 297 | Ga0496117_0020497 | 3300048920 | Bacteria | 5386 |
| 298 | Ga0496118_0104254 | 3300048921 | Bacteria | 1904 |
| 299 | Ga0496118_0142476 | 3300048921 | Bacteria | 1516 |
| 300 | Ga0496119_0000719 | 3300048922 | Bacteria | 44523 |
| 301 | Ga0496119_0001745 | 3300048922 | Bacteria | 25344 |
| 302 | Ga0496120_0000196 | 3300048923 | Bacteria | 103427 |
| 303 | Ga0496120_0001466 | 3300048923 | Bacteria | 28121 |
| 304 | Ga0496121_0018204 | 3300048924 | Bacteria | 7100 |
| 305 | Ga0496121_0026151 | 3300048924 | Bacteria | 5511 |
| 306 | Ga0496121_0048779 | 3300048924 | Bacteria | 3598 |
| 307 | Ga0496122_0001011 | 3300048925 | Bacteria | 49773 |
| 308 | Ga0496122_0006902 | 3300048925 | Bacteria | 12836 |
| 309 | Ga0496122_0029410 | 3300048925 | Bacteria | 4635 |
| 310 | Ga0496123_0002592 | 3300048926 | Bacteria | 21986 |
| 311 | Ga0496123_0036981 | 3300048926 | Bacteria | 3453 |
| 312 | Ga0496123_0037121 | 3300048926 | Bacteria | 3445 |
| 313 | Ga0496124_0000219 | 3300048927 | Bacteria | 111562 |
| 314 | Ga0496124_0000584 | 3300048927 | Bacteria | 61524 |
| 315 | Ga0496124_0001337 | 3300048927 | Bacteria | 37033 |
| 316 | Ga0496124_0007264 | 3300048927 | Bacteria | 11816 |
| 317 | Ga0496124_0012154 | 3300048927 | Bacteria | 8525 |
| 318 | Ga0496124_0253785 | 3300048927 | Bacteria | 1299 |
| 319 | Ga0496125_0000251 | 3300048928 | Bacteria | 110300 |
| 320 | Ga0496125_0000825 | 3300048928 | Bacteria | 49981 |
| 321 | Ga0496125_0001438 | 3300048928 | Bacteria | 34681 |
| 322 | Ga0496125_0088325 | 3300048928 | Bacteria | 2337 |
| 323 | Ga0496126_0001087 | 3300048929 | Bacteria | 45711 |
| 324 | Ga0496126_0006973 | 3300048929 | Bacteria | 12492 |
| 325 | Ga0496126_0042046 | 3300048929 | Bacteria | 4224 |
| 326 | Ga0501031_0027221 | 3300049568 | Bacteria | 3728 |
| 327 | Ga0501031_0078274 | 3300049568 | Bacteria | 2154 |
| 328 | Ga0501031_0106492 | 3300049568 | Bacteria | 1830 |
| 329 | Ga0501032_0011165 | 3300049569 | Bacteria | 6453 |
| 330 | Ga0501032_0075048 | 3300049569 | Bacteria | 2252 |
| 331 | Ga0501032_0298275 | 3300049569 | Bacteria | 1042 |
| 332 | Ga0501033_0010238 | 3300049570 | Bacteria | 7195 |
| 333 | Ga0501033_0059658 | 3300049570 | Bacteria | 2817 |
| 334 | Ga0501034_0002264 | 3300049571 | Bacteria | 23614 |
| 335 | Ga0501034_0002403 | 3300049571 | Bacteria | 22668 |
| 336 | Ga0501034_0087809 | 3300049571 | Bacteria | 3109 |
| 337 | Ga0501034_0174456 | 3300049571 | Bacteria | 2116 |
| 338 | Ga0501036_0025387 | 3300049572 | Bacteria | 4998 |
| 339 | Ga0501037_0021686 | 3300049573 | Bacteria | 4750 |
| 340 | Ga0501037_0120656 | 3300049573 | Bacteria | 1885 |
| 341 | Ga0501038_0039625 | 3300049574 | Bacteria | 4120 |
| 342 | Ga0501038_0087555 | 3300049574 | Bacteria | 2615 |
| 343 | Ga0501038_0242562 | 3300049574 | Bacteria | 1430 |
| 344 | Ga0501039_0019611 | 3300049575 | Bacteria | 5186 |
| 345 | Ga0501039_0324751 | 3300049575 | Bacteria | 1209 |
| 346 | Ga0501043_0039385 | 3300049579 | Bacteria | 3714 |
| 347 | Ga0501043_0045757 | 3300049579 | Bacteria | 3441 |
| 348 | Ga0501046_0324966 | 3300049580 | Bacteria | 1120 |
| 349 | Ga0501047_0005616 | 3300049581 | Bacteria | 11816 |
| 350 | Ga0501048_0016232 | 3300049582 | Bacteria | 5490 |
| 351 | Ga0501048_0061216 | 3300049582 | Bacteria | 2666 |
| 352 | Ga0501070_0038358 | 3300049586 | Bacteria | 3997 |
| 353 | Ga0501080_0015725 | 3300049742 | Bacteria | 6979 |
| 354 | Ga0501275_000137 | 3300049772 | Bacteria | 8171 |
| 355 | Ga0501035_0006759 | 3300049822 | Bacteria | 10719 |
| 356 | Ga0501035_0055813 | 3300049822 | Bacteria | 3526 |
| 357 | Ga0501035_0080433 | 3300049822 | Bacteria | 2877 |
| 358 | Ga0501035_0163554 | 3300049822 | Bacteria | 1925 |
| 359 | Ga0501035_0234756 | 3300049822 | Bacteria | 1562 |
| 360 | Ga0501044_0016710 | 3300049823 | Bacteria | 7878 |
| 361 | Ga0501044_0059182 | 3300049823 | Bacteria | 3926 |
| 362 | Ga0501044_0142000 | 3300049823 | Bacteria | 2389 |
| 363 | nmdc:mga00v17_154784_c1 | 3300050491 | Bacteria | 1474 |
| 364 | nmdc:mga00v17_574_c1 | 3300050491 | Bacteria | 20546 |
| 365 | nmdc:mga00v17_86307_c1 | 3300050491 | Bacteria | 1967 |
| 366 | Ga0500634_0004804 | 3300053161 | Bacteria | 6327 |
| 367 | Ga0466962_0026292 | 3300061719 | Bacteria | 2794 |
| 368 | Ga0466962_0158633 | 3300061719 | Bacteria | 1099 |
| 369 | 2578456872 | 2576861471 | Bacteria | 4648976 |
| 370 | 2643818209 | 2643221559 | Bacteria | 4424915 |
| 371 | 2643880397 | 2643221573 | Bacteria | 4784121 |
| 372 | 2643906663 | 2643221579 | Bacteria | 4443405 |
| 373 | 2643913836 | 2643221581 | Bacteria | 3893603 |
| 374 | 2643937877 | 2643221586 | Bacteria | 4446529 |
| 375 | 2644078786 | 2643221612 | Bacteria | 4361984 |
| 376 | 2644528122 | 2643221695 | Bacteria | 3441323 |
| 377 | 2644660972 | 2643221720 | Bacteria | 4694283 |
| 378 | 2644693563 | 2643221727 | Bacteria | 4415595 |
| 379 | 2644699054 | 2643221728 | Bacteria | 4797149 |
| 380 | 2687584969 | 2687453130 | Bacteria | 4227172 |
| 381 | 2748018757 | 2747842501 | Bacteria | 5293829 |
| 382 | 2819661379 | 2818991457 | Bacteria | 5323295 |
| 383 | 2842758894 | 2842757796 | Bacteria | 3981385 |
| 384 | 2852652028 | 2852649853 | Bacteria | 4036942 |
| 385 | 2852687249 | 2852684882 | Bacteria | 5463342 |
| 386 | 2857444288 | 2857442823 | Bacteria | 4562550 |
| 387 | 2894414329 | 2894414249 | Bacteria | 4405451 |
| 388 | 2895502852 | 2895498888 | Bacteria | 5283788 |
| 389 | 2895512894 | 2895511927 | Bacteria | 6802080 |
| 390 | 2895522902 | 2895522137 | Bacteria | 3284416 |
| 391 | 2895525326 | 2895525241 | Bacteria | 3388457 |
| 392 | 2919130994 | 2919130084 | Bacteria | 5301837 |
| 393 | 2919515553 | 2919513703 | Bacteria | 3844312 |
| 394 | 2919678443 | 2919675420 | Bacteria | 3969095 |
| 395 | 2923519746 | 2923516293 | Bacteria | 3716336 |
| 396 | 2929196231 | 2929195423 | Bacteria | 5325372 |
| 397 | 2941478651 | 2941475908 | Bacteria | 4145589 |
| 398 | 8002870908 | 8002869464 | Bacteria | 3588529 |
| 399 | 8003015509 | 8003014200 | Bacteria | 4059994 |
| 400 | 8021622525 | 8021622325 | Bacteria | 4844743 |
| 401 | 8021628665 | 8021626552 | Bacteria | 4665214 |
| 402 | 8021650851 | 8021648035 | Bacteria | 4772378 |
| 403 | Ga0439449_0002838 | |||
| 404 | SwRhRL2b_contig_3470979 | |||
| 405 | MBSR1b_contig_6401888 | |||
| 406 | JGI24739J22299_10000087 | |||
| 407 | JGI25157J39369_1001284 | |||
| 408 | JGI25153J46596_10010132 | |||
| 409 | rootH1_10097541 | |||
| 410 | Ga0055527_1000140 | |||
| 411 | Ga0055535_1000147 | |||
| 412 | Ga0055535_1000278 | |||
| 413 | Ga0055542_1000064 | |||
| 414 | Ga0055542_1000308 | |||
| 415 | Ga0055529_1000072 | |||
| 416 | Ga0055524_1007011 | |||
| 417 | Ga0055524_1010056 | |||
| 418 | Ga0055536_1000759 | |||
| 419 | Ga0055536_1005294 | |||
| 420 | Ga0055536_1006701 | |||
| 421 | Ga0055536_1014566 | |||
| 422 | Ga0055530_10001396 | |||
| 423 | Ga0055530_10003265 | |||
| 424 | Ga0055531_10004504 | |||
| 425 | Ga0055531_10006858 | |||
| 426 | Ga0058692_1000028 | |||
| 427 | Ga0065704_10072505 | |||
| 428 | Ga0065704_10144331 | |||
| 429 | Ga0065715_10094970 | |||
| 430 | Ga0070690_100000679 | |||
| 431 | Ga0070670_100009158 | |||
| 432 | Ga0070670_100011348 | |||
| 433 | Ga0070670_100073661 | |||
| 434 | Ga0070670_100347405 | |||
| 435 | Ga0070660_100044971 | |||
| 436 | Ga0070687_100002156 | |||
| 437 | Ga0070661_100033798 | |||
| 438 | Ga0070669_100008308 | |||
| 439 | Ga0070669_100058663 | |||
| 440 | Ga0070675_100001328 | |||
| 441 | Ga0070671_100018481 | |||
| 442 | Ga0070671_100303541 | |||
| 443 | Ga0070673_100001221 | |||
| 444 | Ga0070688_100046229 | |||
| 445 | Ga0070659_100124972 | |||
| 446 | Ga0070667_100316753 | |||
| 447 | Ga0070701_10018974 | |||
| 448 | Ga0070705_100028884 | |||
| 449 | Ga0070700_100002135 | |||
| 450 | Ga0070663_100181746 | |||
| 451 | Ga0070678_100030344 | |||
| 452 | Ga0070662_100321378 | |||
| 453 | Ga0070684_100000450 | |||
| 454 | Ga0070672_100041648 | |||
| 455 | Ga0070672_100106060 | |||
| 456 | Ga0070686_100000933 | |||
| 457 | Ga0070696_100176574 | |||
| 458 | Ga0070693_100038696 | |||
| 459 | Ga0070665_100015798 | |||
| 460 | Ga0068855_100009026 | |||
| 461 | Ga0068855_100092486 | |||
| 462 | Ga0070664_100001964 | |||
| 463 | Ga0068857_100001283 | |||
| 464 | Ga0068854_100002940 | |||
| 465 | Ga0068854_100038189 | |||
| 466 | Ga0068856_100038861 | |||
| 467 | Ga0070702_100054498 | |||
| 468 | Ga0068852_100038796 | |||
| 469 | Ga0068859_100006841 | |||
| 470 | Ga0068864_100000569 | |||
| 471 | Ga0068866_10042409 | |||
| 472 | Ga0068861_100020202 | |||
| 473 | Ga0068851_10000226 | |||
| 474 | Ga0068863_100001625 | |||
| 475 | Ga0068858_100054718 | |||
| 476 | Ga0068862_100004773 | |||
| 477 | Ga0075364_10000199 | |||
| 478 | Ga0075434_100205832 | |||
| 479 | Ga0068865_100035116 | |||
| 480 | Ga0097620_100006841 | |||
| 481 | Ga0105251_10000155 | |||
| 482 | Ga0105251_10002607 | |||
| 483 | Ga0105244_10020824 | |||
| 484 | Ga0105240_10005933 | |||
| 485 | Ga0105240_10030882 | |||
| 486 | Ga0105240_10047398 | |||
| 487 | Ga0105240_10051758 | |||
| 488 | Ga0105243_10031039 | |||
| 489 | Ga0105248_10001446 | |||
| 490 | Ga0105248_10144138 | |||
| 491 | Ga0105248_10350440 | |||
| 492 | Ga0105248_10700582 | |||
| 493 | Ga0105237_10000212 | |||
| 494 | Ga0105237_10000387 | |||
| 495 | Ga0105237_10097696 | |||
| 496 | Ga0105249_10008733 | |||
| 497 | Ga0105032_100139 | |||
| 498 | Ga0105239_10013080 | |||
| 499 | Ga0157314_1000003 | |||
| 500 | Ga0157369_10047874 | |||
| 501 | Ga0163162_10083756 | |||
| 502 | Ga0157372_10056422 | |||
| 503 | Ga0157375_10001177 | |||
| 504 | Ga0157375_10255886 | |||
| 505 | Ga0163163_10001913 | |||
| 506 | Ga0157377_10018572 | |||
| 507 | Ga0182006_1015236 | |||
| 508 | Ga0182005_1000676 | |||
| 509 | Ga0182005_1003051 | |||
| 510 | Ga0163161_10008609 | |||
| 511 | Ga0206353_10413103 | |||
| 512 | Ga0213876_10052435 | |||
| 513 | Ga0209674_100111 | |||
| 514 | Ga0209672_100008 | |||
| 515 | Ga0209258_100004 | |||
| 516 | Ga0209258_100008 | |||
| 517 | Ga0209258_100217 | |||
| 518 | Ga0209026_1000384 | |||
| 519 | Ga0209026_1000437 | |||
| 520 | Ga0209677_105507 | |||
| 521 | Ga0209148_1000041 | |||
| 522 | Ga0209148_1000197 | |||
| 523 | Ga0209759_1000164 | |||
| 524 | Ga0209129_1002281 | |||
| 525 | Ga0209455_1000007 | |||
| 526 | Ga0209673_1004308 | |||
| 527 | Ga0209675_1007371 | |||
| 528 | Ga0209676_1000018 | |||
| 529 | Ga0209676_1000501 | |||
| 530 | Ga0209676_1003012 | |||
| 531 | Ga0209676_1006481 | |||
| 532 | Ga0209676_1012381 | |||
| 533 | Ga0209676_1012770 | |||
| 534 | Ga0209025_1002579 | |||
| 535 | Ga0209025_1003420 | |||
| 536 | Ga0209025_1020582 | |||
| 537 | Ga0209564_1008102 | |||
| 538 | Ga0209758_1000408 | |||
| 539 | Ga0209758_1030868 | |||
| 540 | Ga0209050_1000424 | |||
| 541 | Ga0209050_1002116 | |||
| 542 | Ga0209256_1001986 | |||
| 543 | Ga0209256_1002614 | |||
| 544 | Ga0209256_1005972 | |||
| 545 | Ga0209051_1000809 | |||
| 546 | Ga0209051_1022773 | |||
| 547 | Ga0209257_1000035 | |||
| 548 | Ga0209257_1000414 | |||
| 549 | Ga0209257_1001475 | |||
| 550 | Ga0209257_1012708 | |||
| 551 | Ga0209257_1017247 | |||
| 552 | Ga0207655_1050401 | |||
| 553 | Ga0207713_1001387 | |||
| 554 | Ga0207713_1003492 | |||
| 555 | Ga0207682_10039412 | |||
| 556 | Ga0207647_10011817 | |||
| 557 | Ga0207647_10021906 | |||
| 558 | Ga0207695_10001617 | |||
| 559 | Ga0207695_10009925 | |||
| 560 | Ga0207695_10024489 | |||
| 561 | Ga0207671_10000009 | |||
| 562 | Ga0207671_10000327 | |||
| 563 | Ga0207662_10005373 | |||
| 564 | Ga0207657_10027100 | |||
| 565 | Ga0207649_10124953 | |||
| 566 | Ga0207681_10006279 | |||
| 567 | Ga0207694_10035353 | |||
| 568 | Ga0207650_10002717 | |||
| 569 | Ga0207650_10107187 | |||
| 570 | Ga0207650_10489729 | |||
| 571 | Ga0207659_10031698 | |||
| 572 | Ga0207687_10203985 | |||
| 573 | Ga0207644_10072150 | |||
| 574 | Ga0207706_10335702 | |||
| 575 | Ga0207670_10024203 | |||
| 576 | Ga0207691_10057156 | |||
| 577 | Ga0207711_10005954 | |||
| 578 | Ga0207711_10025341 | |||
| 579 | Ga0207689_10159212 | |||
| 580 | Ga0207679_10036818 | |||
| 581 | Ga0207667_10000063 | |||
| 582 | Ga0207667_10035763 | |||
| 583 | Ga0207651_10030405 | |||
| 584 | Ga0207712_10086311 | |||
| 585 | Ga0207668_10007764 | |||
| 586 | Ga0207640_10000746 | |||
| 587 | Ga0207640_10072491 | |||
| 588 | Ga0207658_10071560 | |||
| 589 | Ga0207703_10105125 | |||
| 590 | Ga0207678_10371963 | |||
| 591 | Ga0207708_10003483 | |||
| 592 | Ga0207702_10000985 | |||
| 593 | Ga0207641_10031430 | |||
| 594 | Ga0207641_10419153 | |||
| 595 | Ga0207648_10010963 | |||
| 596 | Ga0207676_10004368 | |||
| 597 | Ga0207674_10000123 | |||
| 598 | Ga0207674_10092901 | |||
| 599 | Ga0207675_100071135 | |||
| 600 | Ga0209371_1000025 | |||
| 601 | Ga0209970_1004485 | |||
| 602 | Ga0209983_1022754 | |||
| 603 | Ga0209971_1001501 | |||
| 604 | Ga0268265_10005173 | |||
| 605 | Ga0268264_10012065 | |||
| 606 | Ga0268256_1000027 | |||
| 607 | Ga0307513_10313635 | |||
| 608 | Ga0307410_10129331 | |||
| 609 | Ga0307406_10004711 | |||
| 610 | Ga0307416_100034678 | |||
| 611 | Ga0307416_100250482 | |||
| 612 | Ga0307414_10001239 | |||
| 613 | Ga0307414_10004652 | |||
| 614 | Ga0307414_10017956 | |||
| 615 | Ga0307411_10114401 | |||
| 616 | Ga0307411_10131552 | |||
| 617 | Ga0316574_0168259 | |||
| 618 | Ga0373931_0099822 | |||
| 619 | Ga0316584_0084340 | |||
| 620 | Ga0395899_0000057 | |||
| 621 | Ga0395899_0019444 | |||
| 622 | Ga0395899_0106379 | |||
| 623 | Ga0395900_0000035 | |||
| 624 | Ga0395900_0018823 | |||
| 625 | Ga0395898_0000045 | |||
| 626 | Ga0395898_0000150 | |||
| 627 | Ga0395905_0004974 | |||
| 628 | Ga0395901_0036036 | |||
| 629 | Ga0395901_0087858 | |||
| 630 | Ga0436365_1474399 | |||
| 631 | Ga0439436_0001192 | |||
| 632 | Ga0439436_0001844 | |||
| 633 | Ga0439436_0014671 | |||
| 634 | Ga0439436_0032814 | |||
| 635 | Ga0439436_0054857 | |||
| 636 | Ga0439465_0000271 | |||
| 637 | Ga0439465_0019999 | |||
| 638 | Ga0439465_0082944 | |||
| 639 | Ga0451807_2042735 | |||
| 640 | Ga0439445_0001921 | |||
| 641 | Ga0439445_0002572 | |||
| 642 | Ga0439445_0027085 | |||
| 643 | Ga0439449_0000094 | |||
| 644 | Ga0439449_0002733 | |||
| 645 | Ga0451577_0007856 | |||
| 646 | Ga0451577_0020907 | |||
| 647 | Ga0451577_0193836 | |||
| 648 | Ga0466969_0001986 | |||
| 649 | Ga0466969_0081193 | |||
| 650 | Ga0466972_0027472 | |||
| 651 | Ga0466982_0000006 | |||
| 652 | Ga0466966_0028677 | |||
| 653 | Ga0466966_0075700 | |||
| 654 | Ga0466961_0000201 | |||
| 655 | Ga0466961_0000758 | |||
| 656 | Ga0466961_0004623 | |||
| 657 | Ga0466961_0126727 | |||
| 658 | Ga0466964_0013641 | |||
| 659 | Ga0466964_0032921 | |||
| 660 | Ga0453684_0535231 | |||
| 661 | Ga0466971_0000539 | |||
| 662 | Ga0466970_0000399 | |||
| 663 | Ga0466970_0054801 | |||
| 664 | Ga0466957_0001246 | |||
| 665 | Ga0466957_0055809 | |||
| 666 | Ga0466959_0000038 | |||
| 667 | Ga0466959_0002947 | |||
| 668 | Ga0451576_0327842 | |||
| 669 | Ga0466958_0031969 | |||
| 670 | Ga0466967_0031492 | |||
| 671 | Ga0495627_022468 | |||
| 672 | Ga0495610_0002965 | |||
| 673 | Ga0495616_0162253 | |||
| 674 | Ga0495631_0010000 | |||
| 675 | Ga0495598_0002801 | |||
| 676 | Ga0495621_0000246 | |||
| 677 | Ga0495621_0002002 | |||
| 678 | Ga0495633_0006647 | |||
| 679 | Ga0495656_0022257 | |||
| 680 | Ga0495668_0032153 | |||
| 681 | Ga0495671_0149951 | |||
| 682 | Ga0495660_0035310 | |||
| 683 | Ga0495636_0010028 | |||
| 684 | Ga0495636_0028422 | |||
| 685 | Ga0495672_0088360 | |||
| 686 | Ga0495615_0032334 | |||
| 687 | Ga0495615_0045625 | |||
| 688 | Ga0496103_0188345 | |||
| 689 | Ga0496106_0011188 | |||
| 690 | Ga0496110_0098884 | |||
| 691 | Ga0496112_0188638 | |||
| 692 | Ga0496112_0248485 | |||
| 693 | Ga0496112_0338677 | |||
| 694 | Ga0496113_0151437 | |||
| 695 | Ga0496114_0000853 | |||
| 696 | Ga0496116_0015919 | |||
| 697 | Ga0496116_0095167 | |||
| 698 | Ga0496117_0001505 | |||
| 699 | Ga0496117_0020497 | |||
| 700 | Ga0496118_0104254 | |||
| 701 | Ga0496118_0142476 | |||
| 702 | Ga0496119_0000719 | |||
| 703 | Ga0496119_0001745 | |||
| 704 | Ga0496120_0000196 | |||
| 705 | Ga0496120_0001466 | |||
| 706 | Ga0496121_0018204 | |||
| 707 | Ga0496121_0026151 | |||
| 708 | Ga0496121_0048779 | |||
| 709 | Ga0496122_0001011 | |||
| 710 | Ga0496122_0006902 | |||
| 711 | Ga0496122_0029410 | |||
| 712 | Ga0496123_0002592 | |||
| 713 | Ga0496123_0036981 | |||
| 714 | Ga0496123_0037121 | |||
| 715 | Ga0496124_0000219 | |||
| 716 | Ga0496124_0000584 | |||
| 717 | Ga0496124_0001337 | |||
| 718 | Ga0496124_0007264 | |||
| 719 | Ga0496124_0012154 | |||
| 720 | Ga0496124_0253785 | |||
| 721 | Ga0496125_0000251 | |||
| 722 | Ga0496125_0000825 | |||
| 723 | Ga0496125_0001438 | |||
| 724 | Ga0496125_0088325 | |||
| 725 | Ga0496126_0001087 | |||
| 726 | Ga0496126_0006973 | |||
| 727 | Ga0496126_0042046 | |||
| 728 | Ga0501031_0027221 | |||
| 729 | Ga0501031_0078274 | |||
| 730 | Ga0501031_0106492 | |||
| 731 | Ga0501032_0011165 | |||
| 732 | Ga0501032_0075048 | |||
| 733 | Ga0501032_0298275 | |||
| 734 | Ga0501033_0010238 | |||
| 735 | Ga0501033_0059658 | |||
| 736 | Ga0501034_0002264 | |||
| 737 | Ga0501034_0002403 | |||
| 738 | Ga0501034_0087809 | |||
| 739 | Ga0501034_0174456 | |||
| 740 | Ga0501036_0025387 | |||
| 741 | Ga0501037_0021686 | |||
| 742 | Ga0501037_0120656 | |||
| 743 | Ga0501038_0039625 | |||
| 744 | Ga0501038_0087555 | |||
| 745 | Ga0501038_0242562 | |||
| 746 | Ga0501039_0019611 | |||
| 747 | Ga0501039_0324751 | |||
| 748 | Ga0501043_0039385 | |||
| 749 | Ga0501043_0045757 | |||
| 750 | Ga0501046_0324966 | |||
| 751 | Ga0501047_0005616 | |||
| 752 | Ga0501048_0016232 | |||
| 753 | Ga0501048_0061216 | |||
| 754 | Ga0501070_0038358 | |||
| 755 | Ga0501080_0015725 | |||
| 756 | Ga0501275_000137 | |||
| 757 | Ga0501035_0006759 | |||
| 758 | Ga0501035_0055813 | |||
| 759 | Ga0501035_0080433 | |||
| 760 | Ga0501035_0163554 | |||
| 761 | Ga0501035_0234756 | |||
| 762 | Ga0501044_0016710 | |||
| 763 | Ga0501044_0059182 | |||
| 764 | Ga0501044_0142000 | |||
| 765 | nmdc:mga00v17_154784_c1 | |||
| 766 | nmdc:mga00v17_574_c1 | |||
| 767 | nmdc:mga00v17_86307_c1 | |||
| 768 | Ga0500634_0004804 | |||
| 769 | Ga0466962_0026292 | |||
| 770 | Ga0466962_0158633 | |||
| 771 | 2578456872 | |||
| 772 | 2643818209 | |||
| 773 | 2643880397 | |||
| 774 | 2643906663 | |||
| 775 | 2643913836 | |||
| 776 | 2643937877 | |||
| 777 | 2644078786 | |||
| 778 | 2644528122 | |||
| 779 | 2644660972 | |||
| 780 | 2644693563 | |||
| 781 | 2644699054 | |||
| 782 | 2687584969 | |||
| 783 | 2748018757 | |||
| 784 | 2819661379 | |||
| 785 | 2842758894 | |||
| 786 | 2852652028 | |||
| 787 | 2852687249 | |||
| 788 | 2857444288 | |||
| 789 | 2894414329 | |||
| 790 | 2895502852 | |||
| 791 | 2895512894 | |||
| 792 | 2895522902 | |||
| 793 | 2895525326 | |||
| 794 | 2919130994 | |||
| 795 | 2919515553 | |||
| 796 | 2919678443 | |||
| 797 | 2923519746 | |||
| 798 | 2929196231 | |||
| 799 | 2941478651 | |||
| 800 | 8002870908 | |||
| 801 | 8003015509 | |||
| 802 | 8021622525 | |||
| 803 | 8021628665 | |||
| 804 | 8021650851 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h6o-assembly1.cif.gz_A | porphobilinogen deaminase from vibrio cholerae | 0.923 | 2 | 301 |
| 5h6o-assembly1.cif.gz_A | porphobilinogen deaminase from vibrio cholerae | 0.9199 | 2 | 301 |
| 1ypn-assembly1.cif.gz_A | reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction | 0.9118 | 3 | 301 |
| 2ypn-assembly1.cif.gz_A | hydroxymethylbilane synthase | 0.9105 | 1 | 301 |
| 4mlq-assembly1.cif.gz_A | crystal structure of bacillus megaterium porphobilinogen deaminase | 0.9103 | 1 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5m7fA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9634 | 4 | 95 | 3.40.190.10 |
| 1ah5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9518 | 99 | 197 | 3.40.190.10 |
| af_Q54P93_232_322_3.30.160.40 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9465 | 222 | 301 | 3.30.160.40 |
| af_F1R6A1_237_360_3.30.160.40 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9437 | 219 | 301 | 3.30.160.40 |
| 4fajA03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.9424 | 1 | 40 | 3.10.105.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9IPV6-F1-model_v4 | Hydroxymethylbilane synthase | 0.9657 | 215 | 303 |
GO:0004418
GO:0033014 |
| AF-A0A496W235-F1-model_v4 | Hydroxymethylbilane synthase | 0.9656 | 221 | 302 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-A0A7C7MUS1-F1-model_v4 | Hydroxymethylbilane synthase | 0.9628 | 217 | 301 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-A0A645FZN3-F1-model_v4 | Porphobilinogen deaminase (EC 2.5.1.61) | 0.9617 | 225 | 301 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-X1BBZ5-F1-model_v4 | Porphobilinogen deaminase C-terminal domain-containing protein | 0.9613 | 226 | 301 |
GO:0004418
GO:0005737 GO:0006783 |