F435183

General Info

Members Datasets Scaffolds Average Seq Length
402 283 804 137

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0034190|Ga0495622_0034190_963_1403
Length 140
Sequence MPPPPDEPPFTKGHPAPDALEREVEISAIRAQGKGGQNVNKVSNAVHLRFDIRASSLSEELKERLLSGSDRRVSRDGILIIKAQSHRSLEQNREEALGRLRALIEQASHVPRPRRGSHKRRLQGKEKRANVKALRRRVED

Samples

Sample ID Description Type Environment
1 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
173 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
174 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
175 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
176 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
177 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
178 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
179 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
238 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
239 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
240 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
243 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
244 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
251 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
268 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
269 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
272 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
282 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
283 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.37
Nodule 0.5
Rhizoplane 1
Rhizosphere 64.93
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495622_0034190 3300046557 Bacteria 2371
2 JGI25155J39150_1000090 3300002704 Bacteria 51836
3 JGI25156J39149_1000148 3300002705 Bacteria 51890
4 JGI25154J39366_1000155 3300002738 Bacteria 52889
5 JGI25157J39369_1000183 3300002741 Bacteria 52889
6 JGI25159J45721_1000700 3300002987 Bacteria 14634
7 JGI25159J45721_1013364 3300002987 Bacteria 1902
8 JGI25151J46595_10001873 3300003187 Bacteria 13428
9 JGI25151J46595_10023375 3300003187 Bacteria 2547
10 JGI25151J46595_10033441 3300003187 Bacteria 1981
11 rootH1_10095717 3300003316 Bacteria 4100
12 rootL2_10018177 3300003322 Bacteria 6146
13 rootL2_10019510 3300003322 Bacteria 4452
14 rootH1_10038457 3300003323 Bacteria 9183
15 rootH1_10201108 3300003323 Bacteria 1004
16 JGI25160J50197_1000059 3300003354 Bacteria 116962
17 JGI25160J50197_1029594 3300003354 Bacteria 1444
18 JGI25161J50226_1000109 3300003374 Bacteria 64835
19 JGI25161J50226_1023261 3300003374 Bacteria 613
20 Ga0055526_1005473 3300003771 Bacteria 7288
21 Ga0055526_1007631 3300003771 Bacteria 5579
22 Ga0055526_1050996 3300003771 Bacteria 944
23 Ga0055537_1000245 3300003773 Bacteria 39851
24 Ga0055537_1008529 3300003773 Bacteria 2355
25 Ga0055524_1000057 3300003775 Bacteria 139566
26 Ga0055536_1003494 3300003781 Bacteria 8425
27 Ga0055534_1017401 3300003784 Bacteria 1272
28 Ga0055534_1027939 3300003784 Bacteria 887
29 Ga0055528_1032513 3300003790 Bacteria 1329
30 Ga0055530_10002076 3300003791 Bacteria 13433
31 Ga0055530_10030955 3300003791 Bacteria 1411
32 Ga0055540_1001554 3300003792 Bacteria 13439
33 Ga0055531_10002433 3300003794 Bacteria 12465
34 Ga0055543_1000138 3300004625 Bacteria 60628
35 Ga0055543_1008092 3300004625 Bacteria 2360
36 Ga0065165_1000086 3300005262 Bacteria 154235
37 Ga0065165_1003210 3300005262 Bacteria 11915
38 Ga0065165_1008442 3300005262 Bacteria 4817
39 Ga0070676_10543149 3300005328 Bacteria 831
40 Ga0068869_100391081 3300005334 Bacteria 1142
41 Ga0070680_100414553 3300005336 Bacteria 1149
42 Ga0070682_100028026 3300005337 Bacteria 3385
43 Ga0068868_101247094 3300005338 Bacteria 689
44 Ga0068868_101247870 3300005338 Bacteria 689
45 Ga0070660_100174917 3300005339 Bacteria 1735
46 Ga0070660_100297183 3300005339 Bacteria 1323
47 Ga0070689_101025634 3300005340 Bacteria 735
48 Ga0070661_100277788 3300005344 Bacteria 1299
49 Ga0070692_10011717 3300005345 Bacteria 4035
50 Ga0070692_10115399 3300005345 Bacteria 1491
51 Ga0070659_100874349 3300005366 Bacteria 784
52 Ga0070667_101197979 3300005367 Bacteria 711
53 Ga0070714_100015439 3300005435 Bacteria 6146
54 Ga0070714_100198241 3300005435 Bacteria 1836
55 Ga0070705_100081299 3300005440 Bacteria 1990
56 Ga0070694_100261896 3300005444 Bacteria 1312
57 Ga0070708_100118868 3300005445 Bacteria 2435
58 Ga0070663_100222434 3300005455 Bacteria 1483
59 Ga0070681_10074878 3300005458 Bacteria 3346
60 Ga0070706_100188102 3300005467 Bacteria 1930
61 Ga0070707_100298823 3300005468 Bacteria 1564
62 Ga0070698_100367757 3300005471 Bacteria 1370
63 Ga0070698_101579766 3300005471 Bacteria 608
64 Ga0070699_100006642 3300005518 Bacteria 10056
65 Ga0070679_100025119 3300005530 Bacteria 5843
66 Ga0070679_101150813 3300005530 Bacteria 721
67 Ga0070684_100081796 3300005535 Bacteria 2858
68 Ga0068853_100164313 3300005539 Bacteria 2005
69 Ga0068853_100342443 3300005539 Bacteria 1389
70 Ga0068853_100411873 3300005539 Bacteria 1266
71 Ga0070686_101086829 3300005544 Bacteria 660
72 Ga0070695_100119260 3300005545 Bacteria 1802
73 Ga0070695_100177844 3300005545 Bacteria 1505
74 Ga0070695_100294289 3300005545 Bacteria 1198
75 Ga0070695_100751895 3300005545 Bacteria 778
76 Ga0070696_100029501 3300005546 Bacteria 3750
77 Ga0070696_100361669 3300005546 Bacteria 1126
78 Ga0070696_100591210 3300005546 Bacteria 894
79 Ga0070696_100700143 3300005546 Bacteria 826
80 Ga0070696_101407548 3300005546 Bacteria 595
81 Ga0070693_100004998 3300005547 Bacteria 6335
82 Ga0070704_100085515 3300005549 Bacteria 2334
83 Ga0070704_100166685 3300005549 Bacteria 1747
84 Ga0070704_100696509 3300005549 Bacteria 901
85 Ga0068855_100222038 3300005563 Bacteria 2118
86 Ga0068855_100354446 3300005563 Bacteria 1616
87 Ga0068857_100585929 3300005577 Bacteria 1053
88 Ga0068854_100170679 3300005578 Bacteria 1692
89 Ga0068854_100246728 3300005578 Bacteria 1424
90 Ga0068856_100026594 3300005614 Bacteria 5642
91 Ga0068856_100038624 3300005614 Bacteria 4687
92 Ga0068852_100161351 3300005616 Bacteria 2093
93 Ga0068852_100643750 3300005616 Bacteria 1067
94 Ga0068851_10110189 3300005834 Bacteria 1469
95 Ga0068858_101124858 3300005842 Bacteria 771
96 Ga0075363_100599441 3300006048 Bacteria 660
97 Ga0075364_10004242 3300006051 Bacteria 8231
98 Ga0070716_101076898 3300006173 Bacteria 640
99 Ga0070712_100103698 3300006175 Bacteria 2109
100 Ga0075362_10032202 3300006177 Bacteria 2273
101 Ga0075366_10010288 3300006195 Bacteria 5249
102 Ga0075366_10132961 3300006195 Bacteria 1502
103 Ga0097621_100514741 3300006237 Bacteria 1085
104 Ga0075370_10020206 3300006353 Bacteria 3637
105 Ga0075370_10204696 3300006353 Bacteria 1165
106 Ga0075370_10236153 3300006353 Bacteria 1082
107 Ga0075370_10315375 3300006353 Bacteria 931
108 Ga0075370_10564520 3300006353 Bacteria 689
109 Ga0075428_100014718 3300006844 Bacteria 8688
110 Ga0075428_100320418 3300006844 Bacteria 1666
111 Ga0075430_100898052 3300006846 Bacteria 730
112 Ga0075431_100959915 3300006847 Bacteria 823
113 Ga0075436_100010630 3300006914 Bacteria 6312
114 Ga0075436_100038677 3300006914 Bacteria 3293
115 Ga0079104_1009955 3300006946 Bacteria 3173
116 Ga0105240_10058934 3300009093 Bacteria 4793
117 Ga0111539_10014998 3300009094 Bacteria 9657
118 Ga0105245_11900814 3300009098 Bacteria 648
119 Ga0114129_10462972 3300009147 Bacteria 1661
120 Ga0105241_10071305 3300009174 Bacteria 2697
121 Ga0105241_10921652 3300009174 Bacteria 813
122 Ga0105237_10023031 3300009545 Bacteria 6387
123 Ga0105238_10112002 3300009551 Bacteria 2709
124 Ga0105239_10174801 3300010375 Bacteria 2402
125 Ga0105246_11021759 3300011119 Bacteria 750
126 Ga0157373_10021602 3300013100 Bacteria 4673
127 Ga0157371_10316176 3300013102 Bacteria 1132
128 Ga0157370_10396573 3300013104 Bacteria 1270
129 Ga0157370_11489858 3300013104 Bacteria 608
130 Ga0157372_10301698 3300013307 Bacteria 1863
131 Ga0157372_10317394 3300013307 Bacteria 1814
132 Ga0157380_10146234 3300014326 Bacteria 2037
133 Ga0157377_10866044 3300014745 Bacteria 672
134 Ga0213872_10264102 3300021361 Bacteria 722
135 Ga0209435_100014 3300025206 Bacteria 322129
136 Ga0209436_104445 3300025208 Bacteria 3466
137 Ga0207425_1005409 3300025245 Bacteria 3647
138 Ga0207425_1036160 3300025245 Bacteria 959
139 Ga0209646_1000001 3300025246 Bacteria 3092932
140 Ga0209026_1000137 3300025250 Bacteria 116282
141 Ga0209759_1000013 3300025256 Bacteria 399300
142 Ga0209129_1009317 3300025258 Bacteria 2605
143 Ga0209565_1000028 3300025263 Bacteria 348536
144 Ga0209565_1001085 3300025263 Bacteria 13573
145 Ga0209673_1000035 3300025273 Bacteria 328411
146 Ga0209673_1008755 3300025273 Bacteria 4466
147 Ga0209130_1000052 3300025284 Bacteria 216971
148 Ga0209130_1011570 3300025284 Bacteria 2357
149 Ga0209675_1001685 3300025291 Bacteria 12264
150 Ga0209675_1003118 3300025291 Bacteria 8079
151 Ga0209676_1000634 3300025292 Bacteria 50573
152 Ga0209676_1013887 3300025292 Bacteria 3067
153 Ga0209025_1005213 3300025294 Bacteria 10723
154 Ga0209025_1012897 3300025294 Bacteria 5311
155 Ga0209025_1023178 3300025294 Bacteria 3256
156 Ga0209564_1000229 3300025295 Bacteria 125047
157 Ga0209564_1003759 3300025295 Bacteria 9912
158 Ga0209564_1004913 3300025295 Bacteria 7918
159 Ga0209758_1022528 3300025297 Bacteria 2883
160 Ga0209050_1000023 3300025298 Bacteria 537172
161 Ga0209050_1011041 3300025298 Bacteria 4349
162 Ga0209050_1013772 3300025298 Bacteria 3556
163 Ga0209050_1029475 3300025298 Bacteria 1754
164 Ga0209256_1000003 3300025299 Bacteria 1661127
165 Ga0207426_1000306 3300025302 Bacteria 96112
166 Ga0207426_1007697 3300025302 Bacteria 4473
167 Ga0209051_1000017 3300025303 Bacteria 537172
168 Ga0209051_1004187 3300025303 Bacteria 9003
169 Ga0209051_1030581 3300025303 Bacteria 2087
170 Ga0209257_1000041 3300025304 Bacteria 537172
171 Ga0209257_1000061 3300025304 Bacteria 367698
172 Ga0209257_1027053 3300025304 Bacteria 1917
173 Ga0207685_10038558 3300025905 Bacteria 1767
174 Ga0207699_10888364 3300025906 Bacteria 657
175 Ga0207654_10180887 3300025911 Bacteria 1376
176 Ga0207694_10600954 3300025924 Bacteria 925
177 Ga0207700_11079020 3300025928 Bacteria 718
178 Ga0207664_10840075 3300025929 Bacteria 825
179 Ga0207665_10193739 3300025939 Bacteria 1478
180 Ga0207679_11452055 3300025945 Bacteria 629
181 Ga0207639_10226334 3300026041 Bacteria 1618
182 Ga0207702_10042319 3300026078 Bacteria 3821
183 Ga0207674_11188040 3300026116 Bacteria 732
184 Ga0207698_10460595 3300026142 Bacteria 1230
185 Ga0209281_1050747 3300027111 Unclassified 662
186 Ga0209981_1004620 3300027378 Bacteria 1811
187 Ga0209996_1027754 3300027395 Bacteria 815
188 Ga0209968_1023044 3300027526 Bacteria 1017
189 Ga0209999_1018619 3300027543 Bacteria 1271
190 Ga0209966_1041745 3300027695 Bacteria 958
191 Ga0209974_10055437 3300027876 Bacteria 1337
192 Ga0265318_10039702 3300028577 Bacteria 1795
193 Ga0307515_10000013 3300028794 Bacteria 568456
194 Ga0307515_10002637 3300028794 Bacteria 38528
195 Ga0307515_10064215 3300028794 Bacteria 5136
196 Ga0307515_10409158 3300028794 Bacteria 980
197 Ga0265330_10000062 3300031235 Bacteria 95409
198 Ga0265332_10000001 3300031238 Bacteria 863783
199 Ga0265328_10009465 3300031239 Bacteria 3965
200 Ga0265328_10013425 3300031239 Bacteria 3243
201 Ga0265325_10009916 3300031241 Bacteria 5542
202 Ga0265325_10015878 3300031241 Bacteria 4222
203 Ga0265340_10007258 3300031247 Bacteria 6028
204 Ga0265331_10000873 3300031250 Bacteria 24581
205 Ga0265327_10000135 3300031251 Bacteria 162683
206 Ga0265327_10000178 3300031251 Bacteria 135732
207 Ga0265327_10000407 3300031251 Bacteria 79425
208 Ga0265316_10230614 3300031344 Bacteria 1363
209 Ga0307513_10007938 3300031456 Bacteria 13654
210 Ga0307513_10027199 3300031456 Bacteria 6572
211 Ga0307509_10000245 3300031507 Bacteria 87456
212 Ga0307408_100465032 3300031548 Bacteria 1100
213 Ga0307408_101123872 3300031548 Bacteria 730
214 Ga0265314_10000145 3300031711 Bacteria 106541
215 Ga0307516_10000193 3300031730 Bacteria 78825
216 Ga0307516_10035658 3300031730 Bacteria 4987
217 Ga0307516_10048824 3300031730 Bacteria 4164
218 Ga0307413_11719308 3300031824 Bacteria 560
219 Ga0307406_10017929 3300031901 Bacteria 4130
220 Ga0307406_10861360 3300031901 Bacteria 769
221 Ga0307407_11010020 3300031903 Bacteria 643
222 Ga0307414_10022528 3300032004 Bacteria 3976
223 Ga0307411_10005959 3300032005 Bacteria 6055
224 Ga0316583_10007765 3300032133 Bacteria 3869
225 Ga0373948_0078898 3300034817 Bacteria 748
226 Ga0373940_0019619 3300035088 Bacteria 1710
227 Ga0373923_0575592 3300035111 Bacteria 553
228 Ga0373939_0000059 3300035114 Bacteria 38006
229 Ga0373939_0114497 3300035114 Bacteria 944
230 Ga0373945_0026090 3300035116 Bacteria 2034
231 Ga0373957_0350511 3300035120 Bacteria 630
232 Ga0373960_0010777 3300035121 Bacteria 2239
233 Ga0373943_0014531 3300035170 Bacteria 3567
234 Ga0373946_0026136 3300035171 Bacteria 2300
235 Ga0373961_0017943 3300035241 Bacteria 1842
236 Ga0373931_0000334 3300035691 Bacteria 19574
237 Ga0373931_0095939 3300035691 Bacteria 1660
238 Ga0373935_0118354 3300035692 Bacteria 1767
239 Ga0373937_0384458 3300036401 Bacteria 1331
240 Ga0373925_0001458 3300037068 Bacteria 20434
241 Ga0373925_0104102 3300037068 Bacteria 2185
242 Ga0395899_0002181 3300037312 Bacteria 16076
243 Ga0395898_0051723 3300037466 Bacteria 4016
244 Ga0395905_0007569 3300037471 Bacteria 10791
245 Ga0436361_0356446 3300039447 Bacteria 920
246 Ga0439461_0002998 3300041410 Bacteria 2749
247 Ga0451793_1783535 3300041452 Bacteria 1084
248 Ga0451807_0776223 3300041486 Bacteria 694
249 Ga0451853_0636476 3300041512 Bacteria 1757
250 Ga0451853_1013450 3300041512 Bacteria 2418
251 Ga0439431_0005586 3300041997 Bacteria 2774
252 Ga0450917_000017 3300042120 Bacteria 7614
253 Ga0450920_023014 3300042122 Bacteria 1208
254 Ga0450888_001374 3300042126 Bacteria 2324
255 Ga0450890_003838 3300042127 Bacteria 1979
256 Ga0450891_004138 3300042129 Bacteria 1365
257 Ga0450891_024036 3300042129 Bacteria 610
258 Ga0450892_001235 3300042130 Bacteria 2618
259 Ga0450903_046949 3300042138 Bacteria 635
260 Ga0450889_000047 3300042144 Bacteria 10757
261 Ga0439446_0021333 3300042156 Bacteria 1830
262 Ga0439434_0091383 3300042435 Bacteria 973
263 Ga0439435_0002609 3300042436 Bacteria 3612
264 Ga0450893_0002762 3300042532 Bacteria 2746
265 Ga0451577_0003346 3300042876 Bacteria 17953
266 Ga0451577_0019387 3300042876 Bacteria 6254
267 Ga0451577_0048113 3300042876 Bacteria 3811
268 Ga0451577_0180414 3300042876 Bacteria 1903
269 Ga0451577_0199269 3300042876 Bacteria 1807
270 Ga0451577_0241630 3300042876 Bacteria 1634
271 Ga0451577_0751034 3300042876 Bacteria 882
272 Ga0451577_1360089 3300042876 Bacteria 630
273 Ga0439440_0205269 3300042993 Bacteria 586
274 Ga0453683_0521431 3300044673 Bacteria 772
275 Ga0453684_0015397 3300044712 Bacteria 12107
276 Ga0453684_0022126 3300044712 Bacteria 9454
277 Ga0453684_0029009 3300044712 Bacteria 7872
278 Ga0453684_0124991 3300044712 Bacteria 3098
279 Ga0453684_0140203 3300044712 Bacteria 2888
280 Ga0453684_0331001 3300044712 Bacteria 1722
281 Ga0453684_0645584 3300044712 Bacteria 1155
282 Ga0453684_0804846 3300044712 Bacteria 1013
283 Ga0453684_2557491 3300044712 Bacteria 503
284 Ga0451576_0000237 3300045051 Bacteria 134538
285 Ga0451576_0043050 3300045051 Bacteria 4765
286 Ga0451576_0055391 3300045051 Bacteria 4149
287 Ga0451576_0134098 3300045051 Bacteria 2582
288 Ga0451576_0188256 3300045051 Bacteria 2155
289 Ga0451576_1394399 3300045051 Bacteria 729
290 Ga0451576_2161758 3300045051 Bacteria 572
291 Ga0495603_0033834 3300046455 Bacteria 3075
292 Ga0495629_0000011 3300046459 Bacteria 268675
293 Ga0495629_0054736 3300046459 Bacteria 2791
294 Ga0495641_0463482 3300046461 Bacteria 577
295 Ga0495650_0019572 3300046471 Bacteria 3326
296 Ga0495580_0042012 3300046472 Bacteria 3258
297 Ga0495639_0000691 3300046475 Bacteria 15443
298 Ga0495662_0079542 3300046476 Bacteria 1594
299 Ga0495594_0081109 3300046499 Bacteria 1811
300 Ga0495618_0076508 3300046514 Bacteria 2133
301 Ga0495628_0303222 3300046516 Bacteria 1182
302 Ga0495628_0647288 3300046516 Bacteria 751
303 Ga0495630_0037574 3300046517 Bacteria 3621
304 Ga0495630_0590805 3300046517 Bacteria 851
305 Ga0495666_0001280 3300046526 Bacteria 12186
306 Ga0495666_0018382 3300046526 Bacteria 3479
307 Ga0495642_0575825 3300046528 Bacteria 500
308 Ga0495640_0055680 3300046533 Bacteria 2705
309 Ga0495586_0001350 3300046535 Bacteria 13620
310 Ga0495587_0207528 3300046536 Bacteria 1107
311 Ga0495621_0135750 3300046539 Bacteria 960
312 Ga0495635_0003571 3300046663 Bacteria 10761
313 Ga0495635_0144275 3300046663 Bacteria 1621
314 Ga0495647_0055744 3300046681 Bacteria 1548
315 Ga0495658_0030222 3300046683 Bacteria 2940
316 Ga0495624_0014906 3300046690 Bacteria 5264
317 Ga0495624_0558623 3300046690 Bacteria 683
318 Ga0495670_0001873 3300046691 Bacteria 10349
319 Ga0495600_0035831 3300046809 Bacteria 3224
320 Ga0495581_0050736 3300047315 Bacteria 2396
321 Ga0495604_0162047 3300047317 Bacteria 1579
322 Ga0495676_0011411 3300047321 Bacteria 8020
323 Ga0495680_0002268 3300047322 Bacteria 19803
324 Ga0495685_013355 3300047447 Bacteria 2787
325 Ga0495684_0005217 3300047471 Bacteria 10128
326 Ga0495593_0110736 3300047673 Bacteria 1402
327 Ga0495602_0786064 3300048088 Bacteria 640
328 Ga0496109_0212830 3300048912 Bacteria 1818
329 Ga0496114_0172428 3300048917 Bacteria 1886
330 Ga0496121_0039158 3300048924 Bacteria 4184
331 Ga0496122_0342095 3300048925 Bacteria 785
332 Ga0496123_0262256 3300048926 Bacteria 846
333 Ga0496124_0000004 3300048927 Bacteria 976131
334 Ga0496126_0059742 3300048929 Bacteria 3432
335 Ga0496126_0771439 3300048929 Bacteria 740
336 Ga0501291_036902 3300049514 Bacteria 846
337 Ga0501293_009951 3300049516 Bacteria 817
338 Ga0501298_020863 3300049521 Bacteria 1224
339 Ga0501300_001339 3300049523 Bacteria 3717
340 Ga0501031_0763676 3300049568 Bacteria 620
341 Ga0501036_0604760 3300049572 Bacteria 909
342 Ga0501038_0329567 3300049574 Bacteria 1193
343 Ga0501074_1007302 3300049590 Bacteria 586
344 Ga0501075_0089138 3300049591 Bacteria 2339
345 Ga0501076_1077283 3300049592 Bacteria 662
346 Ga0501199_024732 3300049650 Bacteria 714
347 Ga0501201_006650 3300049651 Bacteria 1098
348 Ga0501202_115488 3300049652 Bacteria 669
349 Ga0501202_127454 3300049652 Bacteria 646
350 Ga0501211_000141 3300049658 Bacteria 5708
351 Ga0501217_021933 3300049661 Bacteria 1511
352 Ga0501227_026225 3300049665 Bacteria 1372
353 Ga0501253_107181 3300049683 Bacteria 662
354 Ga0501258_004364 3300049687 Bacteria 1335
355 Ga0501221_001332 3300049704 Bacteria 4058
356 Ga0501079_0101006 3300049741 Bacteria 2237
357 Ga0501080_0385717 3300049742 Bacteria 1262
358 Ga0501081_0963737 3300049743 Bacteria 644
359 Ga0501266_004499 3300049763 Bacteria 1726
360 Ga0501267_000198 3300049764 Bacteria 4179
361 Ga0501272_001970 3300049769 Bacteria 2012
362 Ga0501045_0139135 3300049824 Bacteria 1805
363 nmdc:mga03n38_425475_c1 3300050490 Bacteria 735
364 nmdc:mga00v17_137020_c1 3300050491 Bacteria 1568
365 nmdc:mga0k408_3497_c2 3300050493 Bacteria 5168
366 nmdc:mga0k408_538894_c1 3300050493 Bacteria 690
367 nmdc:mga07m45_125848_c1 3300050496 Bacteria 1482
368 nmdc:mga07m45_464_c1 3300050496 Bacteria 17073
369 nmdc:mga07m45_467767_c1 3300050496 Bacteria 731
370 nmdc:mga07m45_736603_c1 3300050496 Bacteria 566
371 nmdc:mga06r32_1205659_c1 3300050510 Bacteria 703
372 nmdc:mga08y16_27005_c1 3300050511 Bacteria 6050
373 nmdc:mga08x19_28522_c1 3300050514 Bacteria 3496
374 nmdc:mga08x19_49241_c1 3300050514 Bacteria 2702
375 Ga0495601_0083870 3300053077 Bacteria 2047
376 Ga0495612_0283398 3300053078 Bacteria 741
377 Ga0495619_0091878 3300053085 Bacteria 2055
378 Ga0500643_081454 3300053087 Bacteria 888
379 Ga0500644_0004116 3300053088 Bacteria 3621
380 Ga0500646_0197262 3300053090 Bacteria 689
381 Ga0500566_0060358 3300053094 Bacteria 2148
382 Ga0500650_0000260 3300053098 Bacteria 12731
383 Ga0500555_052983 3300053103 Bacteria 1106
384 Ga0500593_000657 3300053117 Bacteria 13168
385 Ga0500608_196255 3300053122 Bacteria 839
386 Ga0500618_049343 3300053125 Bacteria 955
387 Ga0500628_005438 3300053129 Bacteria 2125
388 Ga0500658_0146848 3300053134 Bacteria 1061
389 Ga0500559_0160164 3300053136 Bacteria 1058
390 Ga0500568_0099818 3300053139 Bacteria 1090
391 Ga0500568_0190494 3300053139 Bacteria 753
392 Ga0500616_0422879 3300053153 Bacteria 529
393 Ga0500622_0004155 3300053156 Bacteria 9266
394 Ga0500622_0322003 3300053156 Bacteria 651
395 Ga0500636_0002342 3300053177 Bacteria 10513
396 Ga0500645_000474 3300053730 Bacteria 27453
397 Ga0500645_005379 3300053730 Bacteria 4726
398 Ga0500645_033650 3300053730 Bacteria 1533
399 Ga0500661_007009 3300055283 Bacteria 2091
400 2511245638 2511231002 Bacteria 5042903
401 2857545674 2857542790 Bacteria 5326616
402 2974322863 2974320154 Bacteria 4571377
403 Ga0495622_0034190
404 JGI25155J39150_1000090
405 JGI25156J39149_1000148
406 JGI25154J39366_1000155
407 JGI25157J39369_1000183
408 JGI25159J45721_1000700
409 JGI25159J45721_1013364
410 JGI25151J46595_10001873
411 JGI25151J46595_10023375
412 JGI25151J46595_10033441
413 rootH1_10095717
414 rootL2_10018177
415 rootL2_10019510
416 rootH1_10038457
417 rootH1_10201108
418 JGI25160J50197_1000059
419 JGI25160J50197_1029594
420 JGI25161J50226_1000109
421 JGI25161J50226_1023261
422 Ga0055526_1005473
423 Ga0055526_1007631
424 Ga0055526_1050996
425 Ga0055537_1000245
426 Ga0055537_1008529
427 Ga0055524_1000057
428 Ga0055536_1003494
429 Ga0055534_1017401
430 Ga0055534_1027939
431 Ga0055528_1032513
432 Ga0055530_10002076
433 Ga0055530_10030955
434 Ga0055540_1001554
435 Ga0055531_10002433
436 Ga0055543_1000138
437 Ga0055543_1008092
438 Ga0065165_1000086
439 Ga0065165_1003210
440 Ga0065165_1008442
441 Ga0070676_10543149
442 Ga0068869_100391081
443 Ga0070680_100414553
444 Ga0070682_100028026
445 Ga0068868_101247094
446 Ga0068868_101247870
447 Ga0070660_100174917
448 Ga0070660_100297183
449 Ga0070689_101025634
450 Ga0070661_100277788
451 Ga0070692_10011717
452 Ga0070692_10115399
453 Ga0070659_100874349
454 Ga0070667_101197979
455 Ga0070714_100015439
456 Ga0070714_100198241
457 Ga0070705_100081299
458 Ga0070694_100261896
459 Ga0070708_100118868
460 Ga0070663_100222434
461 Ga0070681_10074878
462 Ga0070706_100188102
463 Ga0070707_100298823
464 Ga0070698_100367757
465 Ga0070698_101579766
466 Ga0070699_100006642
467 Ga0070679_100025119
468 Ga0070679_101150813
469 Ga0070684_100081796
470 Ga0068853_100164313
471 Ga0068853_100342443
472 Ga0068853_100411873
473 Ga0070686_101086829
474 Ga0070695_100119260
475 Ga0070695_100177844
476 Ga0070695_100294289
477 Ga0070695_100751895
478 Ga0070696_100029501
479 Ga0070696_100361669
480 Ga0070696_100591210
481 Ga0070696_100700143
482 Ga0070696_101407548
483 Ga0070693_100004998
484 Ga0070704_100085515
485 Ga0070704_100166685
486 Ga0070704_100696509
487 Ga0068855_100222038
488 Ga0068855_100354446
489 Ga0068857_100585929
490 Ga0068854_100170679
491 Ga0068854_100246728
492 Ga0068856_100026594
493 Ga0068856_100038624
494 Ga0068852_100161351
495 Ga0068852_100643750
496 Ga0068851_10110189
497 Ga0068858_101124858
498 Ga0075363_100599441
499 Ga0075364_10004242
500 Ga0070716_101076898
501 Ga0070712_100103698
502 Ga0075362_10032202
503 Ga0075366_10010288
504 Ga0075366_10132961
505 Ga0097621_100514741
506 Ga0075370_10020206
507 Ga0075370_10204696
508 Ga0075370_10236153
509 Ga0075370_10315375
510 Ga0075370_10564520
511 Ga0075428_100014718
512 Ga0075428_100320418
513 Ga0075430_100898052
514 Ga0075431_100959915
515 Ga0075436_100010630
516 Ga0075436_100038677
517 Ga0079104_1009955
518 Ga0105240_10058934
519 Ga0111539_10014998
520 Ga0105245_11900814
521 Ga0114129_10462972
522 Ga0105241_10071305
523 Ga0105241_10921652
524 Ga0105237_10023031
525 Ga0105238_10112002
526 Ga0105239_10174801
527 Ga0105246_11021759
528 Ga0157373_10021602
529 Ga0157371_10316176
530 Ga0157370_10396573
531 Ga0157370_11489858
532 Ga0157372_10301698
533 Ga0157372_10317394
534 Ga0157380_10146234
535 Ga0157377_10866044
536 Ga0213872_10264102
537 Ga0209435_100014
538 Ga0209436_104445
539 Ga0207425_1005409
540 Ga0207425_1036160
541 Ga0209646_1000001
542 Ga0209026_1000137
543 Ga0209759_1000013
544 Ga0209129_1009317
545 Ga0209565_1000028
546 Ga0209565_1001085
547 Ga0209673_1000035
548 Ga0209673_1008755
549 Ga0209130_1000052
550 Ga0209130_1011570
551 Ga0209675_1001685
552 Ga0209675_1003118
553 Ga0209676_1000634
554 Ga0209676_1013887
555 Ga0209025_1005213
556 Ga0209025_1012897
557 Ga0209025_1023178
558 Ga0209564_1000229
559 Ga0209564_1003759
560 Ga0209564_1004913
561 Ga0209758_1022528
562 Ga0209050_1000023
563 Ga0209050_1011041
564 Ga0209050_1013772
565 Ga0209050_1029475
566 Ga0209256_1000003
567 Ga0207426_1000306
568 Ga0207426_1007697
569 Ga0209051_1000017
570 Ga0209051_1004187
571 Ga0209051_1030581
572 Ga0209257_1000041
573 Ga0209257_1000061
574 Ga0209257_1027053
575 Ga0207685_10038558
576 Ga0207699_10888364
577 Ga0207654_10180887
578 Ga0207694_10600954
579 Ga0207700_11079020
580 Ga0207664_10840075
581 Ga0207665_10193739
582 Ga0207679_11452055
583 Ga0207639_10226334
584 Ga0207702_10042319
585 Ga0207674_11188040
586 Ga0207698_10460595
587 Ga0209281_1050747
588 Ga0209981_1004620
589 Ga0209996_1027754
590 Ga0209968_1023044
591 Ga0209999_1018619
592 Ga0209966_1041745
593 Ga0209974_10055437
594 Ga0265318_10039702
595 Ga0307515_10000013
596 Ga0307515_10002637
597 Ga0307515_10064215
598 Ga0307515_10409158
599 Ga0265330_10000062
600 Ga0265332_10000001
601 Ga0265328_10009465
602 Ga0265328_10013425
603 Ga0265325_10009916
604 Ga0265325_10015878
605 Ga0265340_10007258
606 Ga0265331_10000873
607 Ga0265327_10000135
608 Ga0265327_10000178
609 Ga0265327_10000407
610 Ga0265316_10230614
611 Ga0307513_10007938
612 Ga0307513_10027199
613 Ga0307509_10000245
614 Ga0307408_100465032
615 Ga0307408_101123872
616 Ga0265314_10000145
617 Ga0307516_10000193
618 Ga0307516_10035658
619 Ga0307516_10048824
620 Ga0307413_11719308
621 Ga0307406_10017929
622 Ga0307406_10861360
623 Ga0307407_11010020
624 Ga0307414_10022528
625 Ga0307411_10005959
626 Ga0316583_10007765
627 Ga0373948_0078898
628 Ga0373940_0019619
629 Ga0373923_0575592
630 Ga0373939_0000059
631 Ga0373939_0114497
632 Ga0373945_0026090
633 Ga0373957_0350511
634 Ga0373960_0010777
635 Ga0373943_0014531
636 Ga0373946_0026136
637 Ga0373961_0017943
638 Ga0373931_0000334
639 Ga0373931_0095939
640 Ga0373935_0118354
641 Ga0373937_0384458
642 Ga0373925_0001458
643 Ga0373925_0104102
644 Ga0395899_0002181
645 Ga0395898_0051723
646 Ga0395905_0007569
647 Ga0436361_0356446
648 Ga0439461_0002998
649 Ga0451793_1783535
650 Ga0451807_0776223
651 Ga0451853_0636476
652 Ga0451853_1013450
653 Ga0439431_0005586
654 Ga0450917_000017
655 Ga0450920_023014
656 Ga0450888_001374
657 Ga0450890_003838
658 Ga0450891_004138
659 Ga0450891_024036
660 Ga0450892_001235
661 Ga0450903_046949
662 Ga0450889_000047
663 Ga0439446_0021333
664 Ga0439434_0091383
665 Ga0439435_0002609
666 Ga0450893_0002762
667 Ga0451577_0003346
668 Ga0451577_0019387
669 Ga0451577_0048113
670 Ga0451577_0180414
671 Ga0451577_0199269
672 Ga0451577_0241630
673 Ga0451577_0751034
674 Ga0451577_1360089
675 Ga0439440_0205269
676 Ga0453683_0521431
677 Ga0453684_0015397
678 Ga0453684_0022126
679 Ga0453684_0029009
680 Ga0453684_0124991
681 Ga0453684_0140203
682 Ga0453684_0331001
683 Ga0453684_0645584
684 Ga0453684_0804846
685 Ga0453684_2557491
686 Ga0451576_0000237
687 Ga0451576_0043050
688 Ga0451576_0055391
689 Ga0451576_0134098
690 Ga0451576_0188256
691 Ga0451576_1394399
692 Ga0451576_2161758
693 Ga0495603_0033834
694 Ga0495629_0000011
695 Ga0495629_0054736
696 Ga0495641_0463482
697 Ga0495650_0019572
698 Ga0495580_0042012
699 Ga0495639_0000691
700 Ga0495662_0079542
701 Ga0495594_0081109
702 Ga0495618_0076508
703 Ga0495628_0303222
704 Ga0495628_0647288
705 Ga0495630_0037574
706 Ga0495630_0590805
707 Ga0495666_0001280
708 Ga0495666_0018382
709 Ga0495642_0575825
710 Ga0495640_0055680
711 Ga0495586_0001350
712 Ga0495587_0207528
713 Ga0495621_0135750
714 Ga0495635_0003571
715 Ga0495635_0144275
716 Ga0495647_0055744
717 Ga0495658_0030222
718 Ga0495624_0014906
719 Ga0495624_0558623
720 Ga0495670_0001873
721 Ga0495600_0035831
722 Ga0495581_0050736
723 Ga0495604_0162047
724 Ga0495676_0011411
725 Ga0495680_0002268
726 Ga0495685_013355
727 Ga0495684_0005217
728 Ga0495593_0110736
729 Ga0495602_0786064
730 Ga0496109_0212830
731 Ga0496114_0172428
732 Ga0496121_0039158
733 Ga0496122_0342095
734 Ga0496123_0262256
735 Ga0496124_0000004
736 Ga0496126_0059742
737 Ga0496126_0771439
738 Ga0501291_036902
739 Ga0501293_009951
740 Ga0501298_020863
741 Ga0501300_001339
742 Ga0501031_0763676
743 Ga0501036_0604760
744 Ga0501038_0329567
745 Ga0501074_1007302
746 Ga0501075_0089138
747 Ga0501076_1077283
748 Ga0501199_024732
749 Ga0501201_006650
750 Ga0501202_115488
751 Ga0501202_127454
752 Ga0501211_000141
753 Ga0501217_021933
754 Ga0501227_026225
755 Ga0501253_107181
756 Ga0501258_004364
757 Ga0501221_001332
758 Ga0501079_0101006
759 Ga0501080_0385717
760 Ga0501081_0963737
761 Ga0501266_004499
762 Ga0501267_000198
763 Ga0501272_001970
764 Ga0501045_0139135
765 nmdc:mga03n38_425475_c1
766 nmdc:mga00v17_137020_c1
767 nmdc:mga0k408_3497_c2
768 nmdc:mga0k408_538894_c1
769 nmdc:mga07m45_125848_c1
770 nmdc:mga07m45_464_c1
771 nmdc:mga07m45_467767_c1
772 nmdc:mga07m45_736603_c1
773 nmdc:mga06r32_1205659_c1
774 nmdc:mga08y16_27005_c1
775 nmdc:mga08x19_28522_c1
776 nmdc:mga08x19_49241_c1
777 Ga0495601_0083870
778 Ga0495612_0283398
779 Ga0495619_0091878
780 Ga0500643_081454
781 Ga0500644_0004116
782 Ga0500646_0197262
783 Ga0500566_0060358
784 Ga0500650_0000260
785 Ga0500555_052983
786 Ga0500593_000657
787 Ga0500608_196255
788 Ga0500618_049343
789 Ga0500628_005438
790 Ga0500658_0146848
791 Ga0500559_0160164
792 Ga0500568_0099818
793 Ga0500568_0190494
794 Ga0500616_0422879
795 Ga0500622_0004155
796 Ga0500622_0322003
797 Ga0500636_0002342
798 Ga0500645_000474
799 Ga0500645_005379
800 Ga0500645_033650
801 Ga0500661_007009
802 2511245638
803 2857545674
804 2974322863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

18

140

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.8559 12 100
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8381 10 99
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8112 10 99
2jva-assembly1.cif.gz_A nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211 0.7946 6 98
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.7872 12 100
ID Description Score Start End Superfamily
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8381 10 99 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8378 39 96 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8112 10 99 3.30.160.20
1j26A01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7954 15 99 3.30.160.20
2jvaA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7946 6 98 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A0P9H3X0-F1-model_v4 deleted 0.8791 9 98
AF-A0A1F8TTM0-F1-model_v4 Peptidyl-tRNA hydrolase 0.8458 9 100 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A1E7JBG0-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.8331 9 92 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A377TQH4-F1-model_v4 Peptidyl-tRNA hydrolase domain-containing protein (EC 3.1.1.29) 0.833 6 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A3D4BK31-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8319 25 111 GO:0004045
GO:0043022
GO:0072344

Map