F435186

General Info

Members Datasets Scaffolds Average Seq Length
402 213 805 285

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0001554|Ga0495625_0001554_3174_4115
Length 313
Sequence MSCKPFCPIKPKKRLKKTHNNLNKVKHNAPDINQQELEAIALNVREHIVRMSTDGGCFTGASLSAVDLIVYLYTRFLNVNKDNLNHPNRDYLFLSKGHDVPALYGTFAELGLLDKGRLKNHLSLNDHIYWHPNTHIPGIEFHSGSLGHLPSVAIGVALDLKISGGENKVVCILGDGELNEGTCWEAVLVANAYKLDNLVFVVDRNQFQANVRTEDLIPLEPLADKFRAFGAAVKRIDGHNFIDLHHAFSAYPFEEGKLNVVIADTVRGKGLPSIEERADRWFCNFSANEIDQLLLELRGDHNTLLTSETLVVR

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
156 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
157 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
207 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
208 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
209 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
210 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
211 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
212 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
213 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0.25
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0
Rhizoplane 0.5
Rhizosphere 80.1
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0001554 3300046660 Bacteria 27355
2 JGI24740J21852_10004265 3300001979 Bacteria 6164
3 JGI24739J22299_10000609 3300001989 Bacteria 12933
4 JGI24739J22299_10001237 3300001989 Bacteria 9609
5 JGI24737J22298_10000858 3300001990 Bacteria 10841
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI25162J39368_1000022 3300002737 Bacteria 239510
8 JGI25162J39368_1002671 3300002737 Bacteria 6526
9 JGI25154J39366_1000065 3300002738 Bacteria 104126
10 JGI25406J46586_10006079 3300003203 Bacteria 5578
11 JGI25165J46597_1001215 3300003214 Bacteria 15446
12 JGI25153J46596_10002789 3300003215 Bacteria 9929
13 JGI25153J46596_10025691 3300003215 Bacteria 2099
14 rootH1_10003740 3300003316 Bacteria 21380
15 rootH1_10003740 3300003323 Bacteria 6583
16 rootH2_10000445 3300003320 Bacteria 13620
17 rootH2_10033210 3300003320 Bacteria 28982
18 rootH2_10099442 3300003320 Bacteria 3003
19 rootH2_10171823 3300003320 Unclassified 2503
20 rootL2_10100602 3300003322 Bacteria 17649
21 rootL2_10115626 3300003322 Bacteria 1863
22 rootL2_10225044 3300003322 Bacteria 1922
23 rootL2_10267332 3300003322 Bacteria 1049
24 rootH1_10008609 3300003323 Bacteria 127787
25 rootH1_10045022 3300003323 Bacteria 11969
26 rootH1_10062657 3300003323 Bacteria 12665
27 rootH1_10072004 3300003323 Bacteria 3112
28 rootH1_10168402 3300003323 Bacteria 4046
29 rootH1_10175327 3300003323 Bacteria 4603
30 JGI25160J50197_1000466 3300003354 Bacteria 25036
31 JGI25160J50197_1010690 3300003354 Bacteria 3301
32 Ga0055528_1001114 3300003790 Bacteria 17623
33 Ga0055530_10001972 3300003791 Bacteria 13962
34 Ga0055543_1012353 3300004625 Bacteria 1720
35 Ga0058863_11759973 3300004799 Bacteria 6002
36 Ga0065165_1000328 3300005262 Bacteria 77624
37 Ga0065714_10009089 3300005288 Bacteria 4645
38 Ga0070658_10154001 3300005327 Bacteria 1926
39 Ga0070683_100108570 3300005329 Bacteria 2617
40 Ga0070680_100025695 3300005336 Bacteria 4708
41 Ga0070660_100079000 3300005339 Bacteria 2581
42 Ga0070660_100571804 3300005339 Bacteria 944
43 Ga0070671_100169002 3300005355 Unclassified 1849
44 Ga0070673_100031446 3300005364 Bacteria 3983
45 Ga0070673_100092319 3300005364 Bacteria 2476
46 Ga0070659_100000042 3300005366 Bacteria 103672
47 Ga0070709_10000016 3300005434 Bacteria 145008
48 Ga0070714_100000098 3300005435 Bacteria 74167
49 Ga0070662_100000030 3300005457 Bacteria 81418
50 Ga0070681_10043758 3300005458 Bacteria 4483
51 Ga0070706_100268236 3300005467 Bacteria 1593
52 Ga0070679_100037644 3300005530 Bacteria 4807
53 Ga0070679_100212259 3300005530 Bacteria 1899
54 Ga0070684_100215434 3300005535 Bacteria 1751
55 Ga0070684_100234148 3300005535 Bacteria 1677
56 Ga0068853_100073970 3300005539 Bacteria 2972
57 Ga0068853_100101046 3300005539 Bacteria 2550
58 Ga0068853_100216900 3300005539 Bacteria 1746
59 Ga0070695_100216065 3300005545 Bacteria 1379
60 Ga0070665_100000267 3300005548 Bacteria 85526
61 Ga0068855_100000156 3300005563 Bacteria 86845
62 Ga0068855_100000426 3300005563 Bacteria 52084
63 Ga0068855_100013311 3300005563 Bacteria 9921
64 Ga0068855_100017334 3300005563 Bacteria 8666
65 Ga0068855_100021089 3300005563 Bacteria 7812
66 Ga0068855_100028056 3300005563 Bacteria 6733
67 Ga0068855_100168128 3300005563 Bacteria 2484
68 Ga0068855_100209854 3300005563 Bacteria 2189
69 Ga0068855_100436563 3300005563 Bacteria 1430
70 Ga0068854_100044912 3300005578 Bacteria 3139
71 Ga0068856_100000030 3300005614 Bacteria 128494
72 Ga0068856_100017692 3300005614 Bacteria 6911
73 Ga0068856_100051872 3300005614 Bacteria 4044
74 Ga0068856_100253137 3300005614 Bacteria 1776
75 Ga0068859_100003095 3300005617 Bacteria 16886
76 Ga0068858_100076504 3300005842 Bacteria 3108
77 Ga0081539_10000375 3300005985 Bacteria 97516
78 Ga0070716_100060772 3300006173 Bacteria 2184
79 Ga0075366_10011311 3300006195 Bacteria 5036
80 Ga0097621_100001408 3300006237 Bacteria 16567
81 Ga0075370_10168421 3300006353 Bacteria 1287
82 Ga0068871_100000114 3300006358 Bacteria 49426
83 Ga0075431_100000142 3300006847 Bacteria 48638
84 Ga0075429_100060297 3300006880 Bacteria 3305
85 Ga0097620_100003095 3300006931 Bacteria 16886
86 Ga0105240_10005284 3300009093 Bacteria 19277
87 Ga0105240_10009232 3300009093 Bacteria 13991
88 Ga0105240_10035558 3300009093 Bacteria 6418
89 Ga0105240_10193624 3300009093 Bacteria 2389
90 Ga0105240_10352837 3300009093 Bacteria 1668
91 Ga0105240_10512467 3300009093 Bacteria 1332
92 Ga0114129_10467029 3300009147 Bacteria 1653
93 Ga0105241_10000254 3300009174 Bacteria 40113
94 Ga0105241_10000611 3300009174 Bacteria 26865
95 Ga0105237_10000398 3300009545 Bacteria 61844
96 Ga0105237_10030718 3300009545 Bacteria 5454
97 Ga0105237_10045332 3300009545 Bacteria 4426
98 Ga0105237_10048520 3300009545 Bacteria 4268
99 Ga0105237_10108853 3300009545 Bacteria 2762
100 Ga0105237_10218372 3300009545 Unclassified 1907
101 Ga0105238_10000496 3300009551 Bacteria 41316
102 Ga0105238_10001181 3300009551 Bacteria 26283
103 Ga0105238_10002502 3300009551 Bacteria 18383
104 Ga0105238_10022251 3300009551 Bacteria 6463
105 Ga0105238_10026482 3300009551 Bacteria 5913
106 Ga0105249_10080839 3300009553 Bacteria 3020
107 Ga0105239_10000002 3300010375 Bacteria 610298
108 Ga0105239_10000094 3300010375 Bacteria 124925
109 Ga0105239_10000590 3300010375 Bacteria 51676
110 Ga0105239_10000908 3300010375 Bacteria 42116
111 Ga0105239_10001710 3300010375 Bacteria 28899
112 Ga0105239_10017749 3300010375 Bacteria 7872
113 Ga0105239_10021213 3300010375 Bacteria 7162
114 Ga0105239_10045550 3300010375 Bacteria 4808
115 Ga0105239_10158532 3300010375 Bacteria 2528
116 Ga0105239_10228430 3300010375 Unclassified 2088
117 Ga0105239_10261972 3300010375 Bacteria 1943
118 Ga0105239_10362763 3300010375 Bacteria 1636
119 Ga0105239_10540511 3300010375 Bacteria 1327
120 Ga0105239_10910337 3300010375 Unclassified 1010
121 Ga0157373_10000181 3300013100 Bacteria 51804
122 Ga0157373_10092482 3300013100 Bacteria 2130
123 Ga0157371_10003967 3300013102 Bacteria 13129
124 Ga0157371_10005662 3300013102 Bacteria 10488
125 Ga0157371_10040205 3300013102 Bacteria 3341
126 Ga0157369_10142309 3300013105 Bacteria 2537
127 Ga0157374_10000001 3300013296 Bacteria 1077351
128 Ga0157374_10000203 3300013296 Bacteria 54699
129 Ga0157374_10232806 3300013296 Bacteria 1810
130 Ga0157374_10317561 3300013296 Bacteria 1543
131 Ga0163162_10000074 3300013306 Bacteria 91138
132 Ga0163162_10001325 3300013306 Bacteria 23128
133 Ga0163162_10266937 3300013306 Bacteria 1843
134 Ga0157372_10000011 3300013307 Bacteria 277202
135 Ga0157372_10001233 3300013307 Bacteria 27695
136 Ga0157372_10004011 3300013307 Bacteria 15796
137 Ga0157372_10009946 3300013307 Bacteria 10115
138 Ga0157372_10015637 3300013307 Bacteria 8136
139 Ga0157372_10054843 3300013307 Bacteria 4449
140 Ga0157375_10003586 3300013308 Bacteria 13472
141 Ga0157377_10105053 3300014745 Bacteria 1690
142 Ga0157376_10011437 3300014969 Bacteria 6543
143 Ga0163161_10101119 3300017792 Bacteria 2146
144 Ga0213876_10011120 3300021384 Bacteria 4813
145 Ga0207427_100098 3300025231 Bacteria 122817
146 Ga0209437_100008 3300025233 Bacteria 921142
147 Ga0209437_100024 3300025233 Bacteria 592878
148 Ga0209646_1000002 3300025246 Bacteria 1425781
149 Ga0209026_1001366 3300025250 Bacteria 10894
150 Ga0209026_1001914 3300025250 Bacteria 8428
151 Ga0209233_1000024 3300025261 Bacteria 695418
152 Ga0209455_1000960 3300025272 Bacteria 14685
153 Ga0209455_1004547 3300025272 Bacteria 4502
154 Ga0209673_1000464 3300025273 Bacteria 68394
155 Ga0209564_1004557 3300025295 Bacteria 8409
156 Ga0209564_1011365 3300025295 Bacteria 3999
157 Ga0209758_1001454 3300025297 Bacteria 27809
158 Ga0209758_1013960 3300025297 Bacteria 4321
159 Ga0209758_1017641 3300025297 Bacteria 3540
160 Ga0209050_1000591 3300025298 Bacteria 57888
161 Ga0207426_1000009 3300025302 Bacteria 797229
162 Ga0207426_1001316 3300025302 Bacteria 21180
163 Ga0207426_1004769 3300025302 Bacteria 6452
164 Ga0209257_1005075 3300025304 Bacteria 9557
165 Ga0207680_10068840 3300025903 Bacteria 2185
166 Ga0207647_10144204 3300025904 Bacteria 1395
167 Ga0207699_10000318 3300025906 Bacteria 25773
168 Ga0207705_10000031 3300025909 Bacteria 228571
169 Ga0207654_10002517 3300025911 Bacteria 9311
170 Ga0207654_10129032 3300025911 Bacteria 1598
171 Ga0207707_10023104 3300025912 Bacteria 5441
172 Ga0207695_10002228 3300025913 Bacteria 29088
173 Ga0207695_10012888 3300025913 Bacteria 10006
174 Ga0207695_10013072 3300025913 Bacteria 9910
175 Ga0207695_10030528 3300025913 Bacteria 5931
176 Ga0207695_10177028 3300025913 Bacteria 2055
177 Ga0207695_10182167 3300025913 Bacteria 2021
178 Ga0207671_10002829 3300025914 Bacteria 18049
179 Ga0207671_10002944 3300025914 Bacteria 17546
180 Ga0207671_10003164 3300025914 Bacteria 16641
181 Ga0207671_10018292 3300025914 Bacteria 5379
182 Ga0207671_10026949 3300025914 Bacteria 4300
183 Ga0207671_10122431 3300025914 Unclassified 1989
184 Ga0207671_10222796 3300025914 Unclassified 1478
185 Ga0207660_10084261 3300025917 Bacteria 2343
186 Ga0207657_10053340 3300025919 Bacteria 3503
187 Ga0207657_10198727 3300025919 Bacteria 1614
188 Ga0207652_10121705 3300025921 Bacteria 2322
189 Ga0207694_10016291 3300025924 Bacteria 5610
190 Ga0207694_10020109 3300025924 Bacteria 5049
191 Ga0207694_10057839 3300025924 Unclassified 3015
192 Ga0207694_10077173 3300025924 Bacteria 2610
193 Ga0207694_10098613 3300025924 Unclassified 2314
194 Ga0207659_10031736 3300025926 Bacteria 3620
195 Ga0207700_10158238 3300025928 Bacteria 1879
196 Ga0207664_10000208 3300025929 Bacteria 44416
197 Ga0207644_10078052 3300025931 Unclassified 2440
198 Ga0207690_10004014 3300025932 Bacteria 8692
199 Ga0207706_10000129 3300025933 Bacteria 81280
200 Ga0207704_10617628 3300025938 Bacteria 889
201 Ga0207665_10093484 3300025939 Bacteria 2088
202 Ga0207691_10014548 3300025940 Bacteria 7503
203 Ga0207667_10000070 3300025949 Bacteria 180479
204 Ga0207667_10016254 3300025949 Bacteria 8408
205 Ga0207667_10020961 3300025949 Bacteria 7248
206 Ga0207667_10041038 3300025949 Bacteria 4923
207 Ga0207640_10090668 3300025981 Bacteria 2116
208 Ga0207703_10117401 3300026035 Bacteria 2279
209 Ga0207639_10055302 3300026041 Bacteria 3037
210 Ga0207639_10228785 3300026041 Bacteria 1610
211 Ga0207702_10000133 3300026078 Bacteria 88338
212 Ga0207702_10043960 3300026078 Bacteria 3753
213 Ga0207702_10047069 3300026078 Bacteria 3633
214 Ga0207702_10222344 3300026078 Bacteria 1760
215 Ga0207702_10347439 3300026078 Bacteria 1418
216 Ga0268266_10000018 3300028379 Bacteria 569141
217 Ga0265337_1009627 3300028556 Bacteria 3436
218 Ga0265326_10003690 3300028558 Bacteria 5000
219 Ga0265319_1002289 3300028563 Bacteria 10564
220 Ga0265319_1003918 3300028563 Bacteria 7570
221 Ga0265319_1009693 3300028563 Bacteria 4075
222 Ga0265334_10004902 3300028573 Bacteria 5883
223 Ga0265334_10012610 3300028573 Bacteria 3549
224 Ga0265334_10022195 3300028573 Bacteria 2589
225 Ga0265318_10000212 3300028577 Bacteria 50514
226 Ga0265318_10000702 3300028577 Bacteria 22511
227 Ga0265318_10000841 3300028577 Bacteria 20210
228 Ga0265318_10002743 3300028577 Bacteria 9230
229 Ga0265318_10076827 3300028577 Bacteria 1235
230 Ga0265323_10011455 3300028653 Unclassified 3578
231 Ga0265336_10000071 3300028666 Bacteria 84442
232 Ga0307517_10002650 3300028786 Bacteria 28576
233 Ga0307515_10000280 3300028794 Bacteria 125330
234 Ga0307515_10001599 3300028794 Bacteria 50542
235 Ga0307515_10241489 3300028794 Bacteria 1576
236 Ga0265338_10001026 3300028800 Bacteria 46840
237 Ga0265338_10067409 3300028800 Bacteria 3091
238 Ga0265338_10086621 3300028800 Bacteria 2606
239 Ga0265338_10105755 3300028800 Bacteria 2280
240 Ga0265324_10002727 3300029957 Bacteria 8782
241 Ga0265324_10008921 3300029957 Bacteria 3947
242 Ga0265324_10012599 3300029957 Bacteria 3184
243 Ga0265330_10000094 3300031235 Bacteria 74657
244 Ga0265330_10000371 3300031235 Bacteria 31472
245 Ga0265330_10001291 3300031235 Bacteria 14654
246 Ga0265330_10030762 3300031235 Unclassified 2408
247 Ga0265330_10140747 3300031235 Unclassified 1026
248 Ga0265332_10000163 3300031238 Bacteria 54111
249 Ga0265332_10002305 3300031238 Bacteria 9762
250 Ga0265332_10004465 3300031238 Bacteria 6560
251 Ga0265332_10013446 3300031238 Bacteria 3627
252 Ga0265332_10036866 3300031238 Bacteria 2122
253 Ga0265332_10110047 3300031238 Bacteria 1160
254 Ga0265328_10000315 3300031239 Bacteria 22494
255 Ga0265328_10001546 3300031239 Bacteria 10613
256 Ga0265328_10044491 3300031239 Bacteria 1632
257 Ga0265320_10000095 3300031240 Bacteria 74421
258 Ga0265320_10001458 3300031240 Bacteria 17271
259 Ga0265320_10005000 3300031240 Bacteria 8592
260 Ga0265320_10022794 3300031240 Bacteria 3343
261 Ga0265320_10031400 3300031240 Unclassified 2728
262 Ga0265325_10009751 3300031241 Bacteria 5596
263 Ga0265325_10022899 3300031241 Bacteria 3418
264 Ga0265329_10004650 3300031242 Bacteria 5663
265 Ga0265329_10042671 3300031242 Unclassified 1452
266 Ga0265329_10096650 3300031242 Bacteria 939
267 Ga0265340_10002365 3300031247 Bacteria 10733
268 Ga0265340_10126582 3300031247 Bacteria 1173
269 Ga0265339_10001794 3300031249 Bacteria 15795
270 Ga0265339_10005083 3300031249 Bacteria 8836
271 Ga0265339_10010880 3300031249 Bacteria 5626
272 Ga0265339_10021915 3300031249 Unclassified 3708
273 Ga0265339_10158971 3300031249 Bacteria 1138
274 Ga0265339_10176060 3300031249 Bacteria 1068
275 Ga0265331_10000195 3300031250 Bacteria 74421
276 Ga0265331_10001393 3300031250 Bacteria 17764
277 Ga0265331_10002964 3300031250 Bacteria 11168
278 Ga0265327_10000587 3300031251 Bacteria 61096
279 Ga0265327_10115008 3300031251 Bacteria 1281
280 Ga0265316_10008239 3300031344 Bacteria 9700
281 Ga0265316_10009777 3300031344 Bacteria 8806
282 Ga0265316_10021818 3300031344 Bacteria 5413
283 Ga0265316_10025787 3300031344 Unclassified 4899
284 Ga0265316_10077021 3300031344 Bacteria 2561
285 Ga0307509_10107247 3300031507 Bacteria 2809
286 Ga0265313_10000141 3300031595 Bacteria 74421
287 Ga0265313_10007307 3300031595 Bacteria 7582
288 Ga0265313_10035784 3300031595 Bacteria 2497
289 Ga0265313_10062453 3300031595 Bacteria 1740
290 Ga0307508_10009297 3300031616 Bacteria 9044
291 Ga0307508_10194253 3300031616 Bacteria 1631
292 Ga0265314_10000002 3300031711 Bacteria 2092193
293 Ga0265314_10000278 3300031711 Bacteria 74613
294 Ga0265314_10001106 3300031711 Bacteria 31121
295 Ga0265314_10017318 3300031711 Bacteria 5659
296 Ga0265342_10001666 3300031712 Bacteria 20390
297 Ga0265342_10001932 3300031712 Bacteria 18570
298 Ga0265342_10006779 3300031712 Bacteria 8484
299 Ga0265342_10013339 3300031712 Bacteria 5521
300 Ga0265342_10018292 3300031712 Bacteria 4542
301 Ga0316576_10021828 3300031727 Bacteria 4436
302 Ga0307405_10006286 3300031731 Bacteria 5830
303 Ga0316577_10192630 3300031733 Bacteria 1152
304 Ga0307411_10004539 3300032005 Bacteria 6667
305 Ga0316583_10031015 3300032133 Bacteria 1903
306 Ga0307507_10000362 3300033179 Bacteria 93053
307 Ga0373956_0005988 3300035119 Bacteria 4865
308 Ga0373957_0104656 3300035120 Bacteria 1135
309 Ga0373955_0019431 3300035172 Bacteria 3396
310 Ga0316574_0004423 3300035398 Bacteria 7362
311 Ga0373935_0078310 3300035692 Unclassified 2144
312 Ga0373937_0029634 3300036401 Bacteria 4957
313 Ga0316584_0020006 3300036712 Bacteria 4847
314 Ga0316584_0097849 3300036712 Bacteria 2197
315 Ga0395899_0000001 3300037312 Bacteria 1750322
316 Ga0395899_0000188 3300037312 Bacteria 90869
317 Ga0395899_0000817 3300037312 Bacteria 30278
318 Ga0395899_0115381 3300037312 Bacteria 1927
319 Ga0395900_0000204 3300037418 Bacteria 92834
320 Ga0395900_0000231 3300037418 Bacteria 87314
321 Ga0395900_0003219 3300037418 Bacteria 17678
322 Ga0395898_0031241 3300037466 Bacteria 5323
323 Ga0395905_0000261 3300037471 Bacteria 78643
324 Ga0395905_0002418 3300037471 Bacteria 20716
325 Ga0395901_0013548 3300038443 Bacteria 8291
326 Ga0400484_27390 3300038725 Bacteria 9470
327 Ga0400490_01532 3300038726 Bacteria 2578
328 Ga0400489_17544 3300039093 Bacteria 25529
329 Ga0436365_1704969 3300039437 Bacteria 5683
330 Ga0436361_0407050 3300039447 Bacteria 4797
331 Ga0466969_0064693 3300044656 Bacteria 1770
332 Ga0466972_0001932 3300044658 Bacteria 10167
333 Ga0466961_0049325 3300044693 Bacteria 2691
334 Ga0453684_0001806 3300044712 Bacteria 56712
335 Ga0453684_0262237 3300044712 Bacteria 1978
336 Ga0466959_0192254 3300045049 Bacteria 1424
337 Ga0466959_0194667 3300045049 Bacteria 1414
338 Ga0495651_0251788 3300046462 Bacteria 1206
339 Ga0495650_0000014 3300046471 Bacteria 581606
340 Ga0495585_0001470 3300046492 Bacteria 18428
341 Ga0495606_0000096 3300046507 Bacteria 151500
342 Ga0495606_0010321 3300046507 Bacteria 7767
343 Ga0495606_0019377 3300046507 Bacteria 5065
344 Ga0495606_0186381 3300046507 Bacteria 1192
345 Ga0495610_0002514 3300046512 Bacteria 15313
346 Ga0495616_0003896 3300046513 Bacteria 9511
347 Ga0495616_0026734 3300046513 Bacteria 3067
348 Ga0495648_0000874 3300046524 Bacteria 31750
349 Ga0495654_0017441 3300046530 Bacteria 3777
350 Ga0495633_0000156 3300046558 Bacteria 89387
351 Ga0495633_0008651 3300046558 Bacteria 5715
352 Ga0495668_0000021 3300046616 Bacteria 381308
353 Ga0495625_0000003 3300046660 Bacteria 686847
354 Ga0495625_0000222 3300046660 Bacteria 89536
355 Ga0495625_0036372 3300046660 Bacteria 3620
356 Ga0495625_0067818 3300046660 Bacteria 2509
357 Ga0495661_0004785 3300046665 Bacteria 9713
358 Ga0495671_0082368 3300046692 Bacteria 1577
359 Ga0495671_0105127 3300046692 Bacteria 1379
360 Ga0495649_0000002 3300046694 Bacteria 1093458
361 Ga0495649_0064594 3300046694 Bacteria 1965
362 Ga0495660_0047406 3300046810 Bacteria 2353
363 Ga0495687_003262 3300047443 Bacteria 11964
364 Ga0495686_0000004 3300047472 Bacteria 869019
365 Ga0495686_0000098 3300047472 Bacteria 183131
366 Ga0495686_0001302 3300047472 Bacteria 28111
367 Ga0495686_0001599 3300047472 Bacteria 23920
368 Ga0495686_0015341 3300047472 Bacteria 5237
369 Ga0495686_0039469 3300047472 Bacteria 3015
370 Ga0495614_0053356 3300048089 Bacteria 1733
371 Ga0496114_0000008 3300048917 Bacteria 420692
372 Ga0496121_0208123 3300048924 Bacteria 1388
373 Ga0495678_009352 3300049459 Bacteria 4856
374 Ga0495682_0021810 3300049460 Bacteria 2398
375 Ga0501033_0077109 3300049570 Unclassified 2446
376 Ga0501068_0331475 3300049584 Bacteria 976
377 Ga0501075_0000259 3300049591 Bacteria 28820
378 Ga0501077_0000297 3300049593 Bacteria 29509
379 Ga0501083_0018587 3300049744 Bacteria 4844
380 nmdc:mga0k408_2803_c1 3300050493 Bacteria 9255
381 nmdc:mga07m45_196730_c1 3300050496 Bacteria 1172
382 nmdc:mga05p37_239731_c1 3300050507 Bacteria 2181
383 nmdc:mga09592_76530_c1 3300050508 Bacteria 2846
384 nmdc:mga0qj67_277049_c1 3300050509 Bacteria 1360
385 nmdc:mga06r32_17747_c1 3300050510 Bacteria 6503
386 nmdc:mga08x19_89268_c1 3300050514 Bacteria 2033
387 Ga0500646_0060638 3300053090 Unclassified 1113
388 Ga0500583_0003283 3300053092 Bacteria 5052
389 Ga0500562_000017 3300053108 Bacteria 130556
390 Ga0500618_000023 3300053125 Bacteria 152444
391 Ga0500618_016137 3300053125 Bacteria 1874
392 Ga0500652_015993 3300053131 Bacteria 2720
393 Ga0500568_0085206 3300053139 Bacteria 1196
394 Ga0500616_0050398 3300053153 Bacteria 2199
395 Ga0501082_0000352 3300060353 Bacteria 40671
396 2599478497 2599185184 Bacteria 6430550
397 2919442121 2919437846 Bacteria 6199444
398 2928080451 2928078545 Bacteria 6534839
399 2928149377 2928147474 Bacteria 6512076
400 2929923826 2929921140 Bacteria 8649150
401 2932083206 2932082852 Bacteria 6563563
402 2977236742 2977232053 Bacteria 5485925
403 8003153531 8003151029 Bacteria 8187759
404 Ga0495625_0001554
405 JGI24740J21852_10004265
406 JGI24739J22299_10000609
407 JGI24739J22299_10001237
408 JGI24737J22298_10000858
409 JGI24735J21928_10000002
410 JGI25162J39368_1000022
411 JGI25162J39368_1002671
412 JGI25154J39366_1000065
413 JGI25406J46586_10006079
414 JGI25165J46597_1001215
415 JGI25153J46596_10002789
416 JGI25153J46596_10025691
417 rootH1_10003740
418 rootH2_10000445
419 rootH2_10033210
420 rootH2_10099442
421 rootH2_10171823
422 rootL2_10100602
423 rootL2_10115626
424 rootL2_10225044
425 rootL2_10267332
426 rootH1_10008609
427 rootH1_10045022
428 rootH1_10062657
429 rootH1_10072004
430 rootH1_10168402
431 rootH1_10175327
432 JGI25160J50197_1000466
433 JGI25160J50197_1010690
434 Ga0055528_1001114
435 Ga0055530_10001972
436 Ga0055543_1012353
437 Ga0058863_11759973
438 Ga0065165_1000328
439 Ga0065714_10009089
440 Ga0070658_10154001
441 Ga0070683_100108570
442 Ga0070680_100025695
443 Ga0070660_100079000
444 Ga0070660_100571804
445 Ga0070671_100169002
446 Ga0070673_100031446
447 Ga0070673_100092319
448 Ga0070659_100000042
449 Ga0070709_10000016
450 Ga0070714_100000098
451 Ga0070662_100000030
452 Ga0070681_10043758
453 Ga0070706_100268236
454 Ga0070679_100037644
455 Ga0070679_100212259
456 Ga0070684_100215434
457 Ga0070684_100234148
458 Ga0068853_100073970
459 Ga0068853_100101046
460 Ga0068853_100216900
461 Ga0070695_100216065
462 Ga0070665_100000267
463 Ga0068855_100000156
464 Ga0068855_100000426
465 Ga0068855_100013311
466 Ga0068855_100017334
467 Ga0068855_100021089
468 Ga0068855_100028056
469 Ga0068855_100168128
470 Ga0068855_100209854
471 Ga0068855_100436563
472 Ga0068854_100044912
473 Ga0068856_100000030
474 Ga0068856_100017692
475 Ga0068856_100051872
476 Ga0068856_100253137
477 Ga0068859_100003095
478 Ga0068858_100076504
479 Ga0081539_10000375
480 Ga0070716_100060772
481 Ga0075366_10011311
482 Ga0097621_100001408
483 Ga0075370_10168421
484 Ga0068871_100000114
485 Ga0075431_100000142
486 Ga0075429_100060297
487 Ga0097620_100003095
488 Ga0105240_10005284
489 Ga0105240_10009232
490 Ga0105240_10035558
491 Ga0105240_10193624
492 Ga0105240_10352837
493 Ga0105240_10512467
494 Ga0114129_10467029
495 Ga0105241_10000254
496 Ga0105241_10000611
497 Ga0105237_10000398
498 Ga0105237_10030718
499 Ga0105237_10045332
500 Ga0105237_10048520
501 Ga0105237_10108853
502 Ga0105237_10218372
503 Ga0105238_10000496
504 Ga0105238_10001181
505 Ga0105238_10002502
506 Ga0105238_10022251
507 Ga0105238_10026482
508 Ga0105249_10080839
509 Ga0105239_10000002
510 Ga0105239_10000094
511 Ga0105239_10000590
512 Ga0105239_10000908
513 Ga0105239_10001710
514 Ga0105239_10017749
515 Ga0105239_10021213
516 Ga0105239_10045550
517 Ga0105239_10158532
518 Ga0105239_10228430
519 Ga0105239_10261972
520 Ga0105239_10362763
521 Ga0105239_10540511
522 Ga0105239_10910337
523 Ga0157373_10000181
524 Ga0157373_10092482
525 Ga0157371_10003967
526 Ga0157371_10005662
527 Ga0157371_10040205
528 Ga0157369_10142309
529 Ga0157374_10000001
530 Ga0157374_10000203
531 Ga0157374_10232806
532 Ga0157374_10317561
533 Ga0163162_10000074
534 Ga0163162_10001325
535 Ga0163162_10266937
536 Ga0157372_10000011
537 Ga0157372_10001233
538 Ga0157372_10004011
539 Ga0157372_10009946
540 Ga0157372_10015637
541 Ga0157372_10054843
542 Ga0157375_10003586
543 Ga0157377_10105053
544 Ga0157376_10011437
545 Ga0163161_10101119
546 Ga0213876_10011120
547 Ga0207427_100098
548 Ga0209437_100008
549 Ga0209437_100024
550 Ga0209646_1000002
551 Ga0209026_1001366
552 Ga0209026_1001914
553 Ga0209233_1000024
554 Ga0209455_1000960
555 Ga0209455_1004547
556 Ga0209673_1000464
557 Ga0209564_1004557
558 Ga0209564_1011365
559 Ga0209758_1001454
560 Ga0209758_1013960
561 Ga0209758_1017641
562 Ga0209050_1000591
563 Ga0207426_1000009
564 Ga0207426_1001316
565 Ga0207426_1004769
566 Ga0209257_1005075
567 Ga0207680_10068840
568 Ga0207647_10144204
569 Ga0207699_10000318
570 Ga0207705_10000031
571 Ga0207654_10002517
572 Ga0207654_10129032
573 Ga0207707_10023104
574 Ga0207695_10002228
575 Ga0207695_10012888
576 Ga0207695_10013072
577 Ga0207695_10030528
578 Ga0207695_10177028
579 Ga0207695_10182167
580 Ga0207671_10002829
581 Ga0207671_10002944
582 Ga0207671_10003164
583 Ga0207671_10018292
584 Ga0207671_10026949
585 Ga0207671_10122431
586 Ga0207671_10222796
587 Ga0207660_10084261
588 Ga0207657_10053340
589 Ga0207657_10198727
590 Ga0207652_10121705
591 Ga0207694_10016291
592 Ga0207694_10020109
593 Ga0207694_10057839
594 Ga0207694_10077173
595 Ga0207694_10098613
596 Ga0207659_10031736
597 Ga0207700_10158238
598 Ga0207664_10000208
599 Ga0207644_10078052
600 Ga0207690_10004014
601 Ga0207706_10000129
602 Ga0207704_10617628
603 Ga0207665_10093484
604 Ga0207691_10014548
605 Ga0207667_10000070
606 Ga0207667_10016254
607 Ga0207667_10020961
608 Ga0207667_10041038
609 Ga0207640_10090668
610 Ga0207703_10117401
611 Ga0207639_10055302
612 Ga0207639_10228785
613 Ga0207702_10000133
614 Ga0207702_10043960
615 Ga0207702_10047069
616 Ga0207702_10222344
617 Ga0207702_10347439
618 Ga0268266_10000018
619 Ga0265337_1009627
620 Ga0265326_10003690
621 Ga0265319_1002289
622 Ga0265319_1003918
623 Ga0265319_1009693
624 Ga0265334_10004902
625 Ga0265334_10012610
626 Ga0265334_10022195
627 Ga0265318_10000212
628 Ga0265318_10000702
629 Ga0265318_10000841
630 Ga0265318_10002743
631 Ga0265318_10076827
632 Ga0265323_10011455
633 Ga0265336_10000071
634 Ga0307517_10002650
635 Ga0307515_10000280
636 Ga0307515_10001599
637 Ga0307515_10241489
638 Ga0265338_10001026
639 Ga0265338_10067409
640 Ga0265338_10086621
641 Ga0265338_10105755
642 Ga0265324_10002727
643 Ga0265324_10008921
644 Ga0265324_10012599
645 Ga0265330_10000094
646 Ga0265330_10000371
647 Ga0265330_10001291
648 Ga0265330_10030762
649 Ga0265330_10140747
650 Ga0265332_10000163
651 Ga0265332_10002305
652 Ga0265332_10004465
653 Ga0265332_10013446
654 Ga0265332_10036866
655 Ga0265332_10110047
656 Ga0265328_10000315
657 Ga0265328_10001546
658 Ga0265328_10044491
659 Ga0265320_10000095
660 Ga0265320_10001458
661 Ga0265320_10005000
662 Ga0265320_10022794
663 Ga0265320_10031400
664 Ga0265325_10009751
665 Ga0265325_10022899
666 Ga0265329_10004650
667 Ga0265329_10042671
668 Ga0265329_10096650
669 Ga0265340_10002365
670 Ga0265340_10126582
671 Ga0265339_10001794
672 Ga0265339_10005083
673 Ga0265339_10010880
674 Ga0265339_10021915
675 Ga0265339_10158971
676 Ga0265339_10176060
677 Ga0265331_10000195
678 Ga0265331_10001393
679 Ga0265331_10002964
680 Ga0265327_10000587
681 Ga0265327_10115008
682 Ga0265316_10008239
683 Ga0265316_10009777
684 Ga0265316_10021818
685 Ga0265316_10025787
686 Ga0265316_10077021
687 Ga0307509_10107247
688 Ga0265313_10000141
689 Ga0265313_10007307
690 Ga0265313_10035784
691 Ga0265313_10062453
692 Ga0307508_10009297
693 Ga0307508_10194253
694 Ga0265314_10000002
695 Ga0265314_10000278
696 Ga0265314_10001106
697 Ga0265314_10017318
698 Ga0265342_10001666
699 Ga0265342_10001932
700 Ga0265342_10006779
701 Ga0265342_10013339
702 Ga0265342_10018292
703 Ga0316576_10021828
704 Ga0307405_10006286
705 Ga0316577_10192630
706 Ga0307411_10004539
707 Ga0316583_10031015
708 Ga0307507_10000362
709 Ga0373956_0005988
710 Ga0373957_0104656
711 Ga0373955_0019431
712 Ga0316574_0004423
713 Ga0373935_0078310
714 Ga0373937_0029634
715 Ga0316584_0020006
716 Ga0316584_0097849
717 Ga0395899_0000001
718 Ga0395899_0000188
719 Ga0395899_0000817
720 Ga0395899_0115381
721 Ga0395900_0000204
722 Ga0395900_0000231
723 Ga0395900_0003219
724 Ga0395898_0031241
725 Ga0395905_0000261
726 Ga0395905_0002418
727 Ga0395901_0013548
728 Ga0400484_27390
729 Ga0400490_01532
730 Ga0400489_17544
731 Ga0436365_1704969
732 Ga0436361_0407050
733 Ga0466969_0064693
734 Ga0466972_0001932
735 Ga0466961_0049325
736 Ga0453684_0001806
737 Ga0453684_0262237
738 Ga0466959_0192254
739 Ga0466959_0194667
740 Ga0495651_0251788
741 Ga0495650_0000014
742 Ga0495585_0001470
743 Ga0495606_0000096
744 Ga0495606_0010321
745 Ga0495606_0019377
746 Ga0495606_0186381
747 Ga0495610_0002514
748 Ga0495616_0003896
749 Ga0495616_0026734
750 Ga0495648_0000874
751 Ga0495654_0017441
752 Ga0495633_0000156
753 Ga0495633_0008651
754 Ga0495668_0000021
755 Ga0495625_0000003
756 Ga0495625_0000222
757 Ga0495625_0036372
758 Ga0495625_0067818
759 Ga0495661_0004785
760 Ga0495671_0082368
761 Ga0495671_0105127
762 Ga0495649_0000002
763 Ga0495649_0064594
764 Ga0495660_0047406
765 Ga0495687_003262
766 Ga0495686_0000004
767 Ga0495686_0000098
768 Ga0495686_0001302
769 Ga0495686_0001599
770 Ga0495686_0015341
771 Ga0495686_0039469
772 Ga0495614_0053356
773 Ga0496114_0000008
774 Ga0496121_0208123
775 Ga0495678_009352
776 Ga0495682_0021810
777 Ga0501033_0077109
778 Ga0501068_0331475
779 Ga0501075_0000259
780 Ga0501077_0000297
781 Ga0501083_0018587
782 nmdc:mga0k408_2803_c1
783 nmdc:mga07m45_196730_c1
784 nmdc:mga05p37_239731_c1
785 nmdc:mga09592_76530_c1
786 nmdc:mga0qj67_277049_c1
787 nmdc:mga06r32_17747_c1
788 nmdc:mga08x19_89268_c1
789 Ga0500646_0060638
790 Ga0500583_0003283
791 Ga0500562_000017
792 Ga0500618_000023
793 Ga0500618_016137
794 Ga0500652_015993
795 Ga0500568_0085206
796 Ga0500616_0050398
797 Ga0501082_0000352
798 2599478497
799 2919442121
800 2928080451
801 2928149377
802 2929923826
803 2932083206
804 2977236742
805 8003153531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

38

305

0.92

PF09364

XFP_N

XFP N-terminal domain

105

259

0.9

PF00676

E1_dh

Dehydrogenase E1 component

107

250

0.85

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

140

213

0.83

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

121

260

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9645 3 271
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9179 3 271
5nd5-assembly1.cif.gz_B crystal structure of transketolase from chlamydomonas reinhardtii in complex with tpp and mg2+ 0.897 8 270
8ci0-assembly1.cif.gz_CCC maize transketolase in complex with tpp and hydrolyzed (+)-cornexistin 0.8913 9 277
5hje-assembly1.cif.gz_A crystal structure of transketolase complex with sedoheptulose-7-phoaphate from pichia stipitis 0.8849 9 273
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9613 6 270 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9273 6 270 3.40.50.970
af_A0A1D6P5P4_1_115_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9076 152 250 3.40.50.970
5hjeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8901 9 273 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8888 1 280 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A519T1T5-F1-model_v4 Transketolase 0.9753 1 164
AF-A0A519TF42-F1-model_v4 Transketolase 0.9725 1 195
AF-A0A0B1TWL5-F1-model_v4 Transketolase, N-terminal section 0.9709 12 271
AF-A0A7K2LRF1-F1-model_v4 Transketolase 0.9703 10 271 GO:0000287
AF-M7AF59-F1-model_v4 Dehydrogenase E1 component domain protein 0.968 84 250

Map