F435197

General Info

Members Datasets Scaffolds Average Seq Length
402 148 402 145

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0004911|Ga0495626_0004911_3119_3598
Length 145
Sequence MHSPDKTTPIQPQGSIMHTTTNNDTLRSLDDTGKLLLRAVLALLLLFHGMSKLAGGIGFITGMLEKAGLPGAFGYLVYIGEVVAPLLILVGVFTLLLVHTSQFFSLNETGGWALELQGMYLGAALAVALLGAGRYSVGGLKGRFN

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002076 3300005327 Bacteria 16814
2 Ga0070683_100060143 3300005329 Bacteria 3530
3 Ga0070680_100108141 3300005336 Bacteria 2313
4 Ga0070680_100340716 3300005336 Bacteria 1274
5 Ga0070660_100007080 3300005339 Bacteria 7793
6 Ga0070660_100088823 3300005339 Bacteria 2434
7 Ga0070691_10062719 3300005341 Bacteria 1790
8 Ga0070661_100026801 3300005344 Bacteria 4147
9 Ga0070669_100900918 3300005353 Bacteria 755
10 Ga0070659_100014092 3300005366 Bacteria 5967
11 Ga0070659_100028994 3300005366 Bacteria 4276
12 Ga0070659_100286708 3300005366 Bacteria 1370
13 Ga0070714_100029991 3300005435 Bacteria 4525
14 Ga0070714_100723143 3300005435 Bacteria 961
15 Ga0070713_101076091 3300005436 Bacteria 777
16 Ga0070711_100390332 3300005439 Bacteria 1128
17 Ga0070663_100017261 3300005455 Bacteria 4706
18 Ga0070662_100306427 3300005457 Bacteria 1292
19 Ga0070699_100026859 3300005518 Bacteria 4966
20 Ga0070699_100258674 3300005518 Bacteria 1556
21 Ga0070679_100110868 3300005530 Bacteria 2730
22 Ga0070679_100207224 3300005530 Bacteria 1925
23 Ga0070679_100666793 3300005530 Bacteria 983
24 Ga0070684_100124537 3300005535 Bacteria 2320
25 Ga0070684_101808612 3300005535 Bacteria 576
26 Ga0068853_100090053 3300005539 Bacteria 2696
27 Ga0070693_100267325 3300005547 Bacteria 1140
28 Ga0068855_100161415 3300005563 Bacteria 2543
29 Ga0068855_100860589 3300005563 Bacteria 960
30 Ga0070664_100014971 3300005564 Bacteria 6330
31 Ga0068854_100011319 3300005578 Bacteria 5802
32 Ga0068856_100009042 3300005614 Bacteria 9694
33 Ga0068856_100323196 3300005614 Bacteria 1560
34 Ga0068852_100066940 3300005616 Bacteria 3139
35 Ga0068852_100407303 3300005616 Bacteria 1339
36 Ga0068861_100150874 3300005719 Bacteria 1907
37 Ga0068851_10003311 3300005834 Bacteria 7158
38 Ga0075434_100316522 3300006871 Unclassified 1581
39 Ga0068865_100904212 3300006881 Bacteria 768
40 Ga0075436_100134526 3300006914 Bacteria 1735
41 Ga0075435_100768747 3300007076 Bacteria 838
42 Ga0105240_10021532 3300009093 Bacteria 8573
43 Ga0105240_10035370 3300009093 Bacteria 6439
44 Ga0105240_10269429 3300009093 Bacteria 1961
45 Ga0105237_10050202 3300009545 Bacteria 4192
46 Ga0105237_10100596 3300009545 Bacteria 2882
47 Ga0105238_10007768 3300009551 Bacteria 10724
48 Ga0105239_10039353 3300010375 Bacteria 5181
49 Ga0105246_10224139 3300011119 Bacteria 1476
50 Ga0157373_10003436 3300013100 Bacteria 11985
51 Ga0157371_10185045 3300013102 Bacteria 1490
52 Ga0157370_10015767 3300013104 Bacteria 7669
53 Ga0157370_10022974 3300013104 Bacteria 6198
54 Ga0157370_10030981 3300013104 Bacteria 5237
55 Ga0157369_10011852 3300013105 Bacteria 9902
56 Ga0157369_10153036 3300013105 Bacteria 2438
57 Ga0157369_10233497 3300013105 Bacteria 1922
58 Ga0163162_10377784 3300013306 Bacteria 1550
59 Ga0157372_10151972 3300013307 Bacteria 2672
60 Ga0157372_10157395 3300013307 Bacteria 2625
61 Ga0157372_10203380 3300013307 Bacteria 2294
62 Ga0157372_10887361 3300013307 Bacteria 1035
63 Ga0157372_13128600 3300013307 Bacteria 528
64 Ga0206354_11164308 3300020081 Bacteria 3382
65 Ga0206353_11882268 3300020082 Bacteria 3517
66 Ga0154015_1157659 3300020610 Bacteria 1095
67 Ga0209148_1001112 3300025254 Bacteria 16051
68 Ga0207656_10055888 3300025321 Bacteria 1719
69 Ga0207699_10058882 3300025906 Bacteria 2300
70 Ga0207705_10068339 3300025909 Bacteria 2572
71 Ga0207705_10070481 3300025909 Bacteria 2533
72 Ga0207705_10521444 3300025909 Bacteria 923
73 Ga0207654_10040766 3300025911 Bacteria 2618
74 Ga0207707_10037804 3300025912 Bacteria 4217
75 Ga0207707_11026133 3300025912 Bacteria 676
76 Ga0207695_10011934 3300025913 Bacteria 10463
77 Ga0207695_10097547 3300025913 Bacteria 2940
78 Ga0207695_10157410 3300025913 Bacteria 2206
79 Ga0207671_10404360 3300025914 Bacteria 1086
80 Ga0207663_10712864 3300025916 Bacteria 795
81 Ga0207660_10313531 3300025917 Bacteria 1251
82 Ga0207660_10924337 3300025917 Bacteria 712
83 Ga0207657_10000545 3300025919 Bacteria 40246
84 Ga0207657_10052623 3300025919 Bacteria 3532
85 Ga0207657_10265475 3300025919 Bacteria 1365
86 Ga0207657_10742799 3300025919 Bacteria 761
87 Ga0207649_10145325 3300025920 Bacteria 1627
88 Ga0207652_10008437 3300025921 Bacteria 8291
89 Ga0207652_10356692 3300025921 Bacteria 1320
90 Ga0207681_10749278 3300025923 Bacteria 814
91 Ga0207694_10012386 3300025924 Bacteria 6427
92 Ga0207700_10065423 3300025928 Bacteria 2774
93 Ga0207664_10109183 3300025929 Bacteria 2298
94 Ga0207664_10637783 3300025929 Bacteria 957
95 Ga0207690_10141926 3300025932 Bacteria 1771
96 Ga0207690_10208815 3300025932 Bacteria 1487
97 Ga0207706_10052388 3300025933 Bacteria 3603
98 Ga0207706_10398472 3300025933 Bacteria 1193
99 Ga0207704_11153655 3300025938 Bacteria 660
100 Ga0207661_10110199 3300025944 Bacteria 2326
101 Ga0207679_10113505 3300025945 Bacteria 2143
102 Ga0207667_10001020 3300025949 Bacteria 35702
103 Ga0207667_10126173 3300025949 Bacteria 2636
104 Ga0207667_10366030 3300025949 Bacteria 1470
105 Ga0207667_10615881 3300025949 Bacteria 1094
106 Ga0207640_10302226 3300025981 Bacteria 1266
107 Ga0207639_10010534 3300026041 Bacteria 6404
108 Ga0207639_11629099 3300026041 Bacteria 605
109 Ga0207678_10003081 3300026067 Bacteria 15079
110 Ga0207702_10135908 3300026078 Bacteria 2218
111 Ga0207674_10000599 3300026116 Bacteria 47369
112 Ga0207675_100134028 3300026118 Bacteria 2349
113 Ga0207698_10112848 3300026142 Bacteria 2282
114 Ga0395899_0026998 3300037312 Bacteria 4330
115 Ga0395899_0122023 3300037312 Bacteria 1865
116 Ga0395899_0157342 3300037312 Bacteria 1607
117 Ga0395899_0425312 3300037312 Bacteria 874
118 Ga0395900_0012300 3300037418 Bacteria 8754
119 Ga0395900_0127107 3300037418 Bacteria 2614
120 Ga0395900_0296446 3300037418 Bacteria 1604
121 Ga0395900_0832794 3300037418 Bacteria 849
122 Ga0395898_0038891 3300037466 Bacteria 4711
123 Ga0395898_0159638 3300037466 Bacteria 2156
124 Ga0395898_0488586 3300037466 Bacteria 1171
125 Ga0395898_1176580 3300037466 Bacteria 698
126 Ga0395905_0079235 3300037471 Bacteria 3079
127 Ga0395905_0163803 3300037471 Bacteria 2089
128 Ga0395905_0202361 3300037471 Bacteria 1861
129 Ga0395905_0398216 3300037471 Bacteria 1271
130 Ga0395901_0006544 3300038443 Bacteria 11783
131 Ga0395901_0300761 3300038443 Bacteria 1663
132 Ga0395901_0437424 3300038443 Bacteria 1339
133 Ga0495617_000012 3300046452 Bacteria 295916
134 Ga0495617_073620 3300046452 Bacteria 1122
135 Ga0495627_000118 3300046453 Bacteria 99480
136 Ga0495590_0000013 3300046457 Bacteria 271977
137 Ga0495590_0006583 3300046457 Bacteria 4527
138 Ga0495590_0014062 3300046457 Bacteria 2930
139 Ga0495591_000109 3300046458 Bacteria 94877
140 Ga0495591_007355 3300046458 Bacteria 4694
141 Ga0495638_0208487 3300046460 Bacteria 1099
142 Ga0495638_0566511 3300046460 Bacteria 562
143 Ga0495605_0000072 3300046474 Bacteria 133731
144 Ga0495605_0004941 3300046474 Bacteria 7791
145 Ga0495605_0013762 3300046474 Bacteria 4446
146 Ga0495605_0043984 3300046474 Bacteria 2210
147 Ga0495605_0106852 3300046474 Bacteria 1280
148 Ga0495605_0193687 3300046474 Bacteria 888
149 Ga0495584_0000029 3300046491 Bacteria 105850
150 Ga0495584_0000791 3300046491 Bacteria 20848
151 Ga0495584_0261695 3300046491 Bacteria 879
152 Ga0495585_0000048 3300046492 Bacteria 120031
153 Ga0495585_0007053 3300046492 Bacteria 6912
154 Ga0495585_0210512 3300046492 Bacteria 985
155 Ga0495585_0275651 3300046492 Bacteria 833
156 Ga0495594_0050157 3300046499 Bacteria 2295
157 Ga0495596_0000243 3300046500 Bacteria 36829
158 Ga0495596_0000309 3300046500 Bacteria 32084
159 Ga0495596_0003025 3300046500 Bacteria 8705
160 Ga0495596_0003935 3300046500 Bacteria 7352
161 Ga0495596_0020735 3300046500 Bacteria 2688
162 Ga0495596_0023664 3300046500 Bacteria 2491
163 Ga0495596_0025081 3300046500 Bacteria 2411
164 Ga0495596_0025461 3300046500 Bacteria 2391
165 Ga0495596_0094711 3300046500 Bacteria 1159
166 Ga0495607_0002120 3300046501 Bacteria 16568
167 Ga0495607_0002863 3300046501 Bacteria 13664
168 Ga0495607_0005992 3300046501 Bacteria 8618
169 Ga0495607_0008378 3300046501 Bacteria 7070
170 Ga0495607_0013962 3300046501 Bacteria 5245
171 Ga0495607_0017736 3300046501 Bacteria 4558
172 Ga0495607_0032051 3300046501 Bacteria 3212
173 Ga0495583_0000463 3300046506 Bacteria 59986
174 Ga0495583_0000697 3300046506 Bacteria 43333
175 Ga0495583_0001770 3300046506 Bacteria 20595
176 Ga0495583_0011831 3300046506 Bacteria 4985
177 Ga0495583_0028892 3300046506 Bacteria 2720
178 Ga0495583_0097507 3300046506 Bacteria 1258
179 Ga0495606_0018958 3300046507 Bacteria 5141
180 Ga0495606_0039782 3300046507 Bacteria 3163
181 Ga0495606_0074336 3300046507 Bacteria 2129
182 Ga0495610_0004903 3300046512 Bacteria 9722
183 Ga0495616_0000131 3300046513 Bacteria 65268
184 Ga0495616_0000238 3300046513 Bacteria 44742
185 Ga0495616_0000388 3300046513 Bacteria 34173
186 Ga0495616_0001928 3300046513 Bacteria 13957
187 Ga0495616_0020509 3300046513 Bacteria 3593
188 Ga0495616_0022267 3300046513 Bacteria 3423
189 Ga0495616_0067250 3300046513 Bacteria 1742
190 Ga0495616_0123675 3300046513 Bacteria 1191
191 Ga0495616_0192586 3300046513 Bacteria 900
192 Ga0495616_0390288 3300046513 Bacteria 573
193 Ga0495631_0000737 3300046518 Bacteria 21033
194 Ga0495631_0002673 3300046518 Bacteria 9920
195 Ga0495631_0004913 3300046518 Bacteria 7044
196 Ga0495631_0017067 3300046518 Bacteria 3441
197 Ga0495631_0023136 3300046518 Bacteria 2883
198 Ga0495631_0039124 3300046518 Bacteria 2106
199 Ga0495631_0115584 3300046518 Bacteria 1153
200 Ga0495631_0161327 3300046518 Bacteria 962
201 Ga0495632_0000116 3300046519 Bacteria 81523
202 Ga0495632_0000156 3300046519 Bacteria 70702
203 Ga0495632_0000853 3300046519 Bacteria 26790
204 Ga0495632_0001593 3300046519 Bacteria 18701
205 Ga0495632_0003692 3300046519 Bacteria 10734
206 Ga0495632_0014760 3300046519 Bacteria 4407
207 Ga0495632_0024852 3300046519 Bacteria 3176
208 Ga0495632_0064615 3300046519 Bacteria 1769
209 Ga0495637_0000008 3300046520 Bacteria 404658
210 Ga0495637_0051725 3300046520 Bacteria 1717
211 Ga0495637_0057590 3300046520 Bacteria 1605
212 Ga0495637_0065149 3300046520 Bacteria 1484
213 Ga0495643_0000121 3300046522 Bacteria 125932
214 Ga0495643_0005225 3300046522 Bacteria 8838
215 Ga0495643_0006816 3300046522 Bacteria 7465
216 Ga0495643_0014186 3300046522 Bacteria 4746
217 Ga0495643_0028165 3300046522 Bacteria 3152
218 Ga0495643_0066303 3300046522 Bacteria 1904
219 Ga0495643_0091543 3300046522 Bacteria 1568
220 Ga0495643_0295619 3300046522 Bacteria 740
221 Ga0495644_0007278 3300046523 Bacteria 4277
222 Ga0495644_0027243 3300046523 Bacteria 2165
223 Ga0495644_0075377 3300046523 Bacteria 1270
224 Ga0495648_0000116 3300046524 Bacteria 98123
225 Ga0495648_0005481 3300046524 Bacteria 10528
226 Ga0495648_0007837 3300046524 Bacteria 8495
227 Ga0495648_0040184 3300046524 Bacteria 2968
228 Ga0495648_0047558 3300046524 Bacteria 2650
229 Ga0495648_0183606 3300046524 Bacteria 1061
230 Ga0495648_0385232 3300046524 Bacteria 631
231 Ga0495666_0002015 3300046526 Bacteria 10043
232 Ga0495666_0029471 3300046526 Bacteria 2700
233 Ga0495642_0000010 3300046528 Bacteria 136557
234 Ga0495642_0000459 3300046528 Bacteria 21479
235 Ga0495642_0002240 3300046528 Bacteria 7922
236 Ga0495642_0024702 3300046528 Bacteria 2378
237 Ga0495642_0029050 3300046528 Bacteria 2205
238 Ga0495642_0435014 3300046528 Bacteria 579
239 Ga0495654_0005595 3300046530 Bacteria 7271
240 Ga0495654_0052292 3300046530 Bacteria 1990
241 Ga0495654_0067621 3300046530 Bacteria 1701
242 Ga0495654_0185286 3300046530 Bacteria 899
243 Ga0495665_0001347 3300046531 Bacteria 13125
244 Ga0495665_0015551 3300046531 Bacteria 4096
245 Ga0495587_0001570 3300046536 Bacteria 15194
246 Ga0495609_0007564 3300046538 Bacteria 5401
247 Ga0495609_0008690 3300046538 Bacteria 4953
248 Ga0495609_0023384 3300046538 Bacteria 2841
249 Ga0495609_0060136 3300046538 Bacteria 1680
250 Ga0495609_0088079 3300046538 Bacteria 1352
251 Ga0495609_0172417 3300046538 Bacteria 913
252 Ga0495597_0010574 3300046542 Bacteria 4503
253 Ga0495597_0014466 3300046542 Bacteria 3757
254 Ga0495597_0019080 3300046542 Bacteria 3211
255 Ga0495597_0027852 3300046542 Bacteria 2589
256 Ga0495597_0161830 3300046542 Bacteria 913
257 Ga0495645_0023835 3300046543 Bacteria 4436
258 Ga0495622_0001500 3300046557 Bacteria 11667
259 Ga0495633_0000874 3300046558 Bacteria 26052
260 Ga0495633_0056515 3300046558 Unclassified 1844
261 Ga0495633_0071954 3300046558 Bacteria 1613
262 Ga0495633_0100581 3300046558 Bacteria 1342
263 Ga0495633_0150743 3300046558 Bacteria 1074
264 Ga0495656_0006750 3300046615 Bacteria 4033
265 Ga0495656_0025576 3300046615 Bacteria 2342
266 Ga0495668_0000006 3300046616 Bacteria 553404
267 Ga0495668_0000532 3300046616 Bacteria 47353
268 Ga0495668_0000733 3300046616 Bacteria 39289
269 Ga0495668_0002189 3300046616 Bacteria 16712
270 Ga0495668_0006228 3300046616 Bacteria 7876
271 Ga0495668_0033857 3300046616 Bacteria 2869
272 Ga0495668_0057870 3300046616 Bacteria 2139
273 Ga0495611_0001733 3300046648 Bacteria 10560
274 Ga0495611_0003086 3300046648 Bacteria 7397
275 Ga0495611_0004803 3300046648 Bacteria 5807
276 Ga0495611_0027979 3300046648 Bacteria 2468
277 Ga0495611_0295649 3300046648 Bacteria 747
278 Ga0495625_0010704 3300046660 Bacteria 7554
279 Ga0495625_0031882 3300046660 Bacteria 3915
280 Ga0495625_0248641 3300046660 Bacteria 1155
281 Ga0495661_0002259 3300046665 Bacteria 14910
282 Ga0495661_0002490 3300046665 Bacteria 14173
283 Ga0495661_0006159 3300046665 Bacteria 8441
284 Ga0495661_0029945 3300046665 Bacteria 3469
285 Ga0495661_0045398 3300046665 Bacteria 2688
286 Ga0495661_0045480 3300046665 Bacteria 2684
287 Ga0495661_0057941 3300046665 Bacteria 2310
288 Ga0495661_0076096 3300046665 Bacteria 1949
289 Ga0495661_0077806 3300046665 Bacteria 1920
290 Ga0495661_0102008 3300046665 Bacteria 1613
291 Ga0495661_0127387 3300046665 Bacteria 1399
292 Ga0495661_0169331 3300046665 Bacteria 1166
293 Ga0495661_0183386 3300046665 Bacteria 1107
294 Ga0495661_0225848 3300046665 Bacteria 968
295 Ga0495588_0000052 3300046674 Bacteria 304493
296 Ga0495588_0002966 3300046674 Bacteria 7332
297 Ga0495588_0028372 3300046674 Bacteria 2801
298 Ga0495588_0041932 3300046674 Bacteria 2338
299 Ga0495669_0019563 3300046684 Bacteria 2923
300 Ga0495669_0031167 3300046684 Bacteria 2341
301 Ga0495669_0038224 3300046684 Bacteria 2125
302 Ga0495669_0070220 3300046684 Bacteria 1595
303 Ga0495669_0075459 3300046684 Bacteria 1542
304 Ga0495669_0373973 3300046684 Bacteria 689
305 Ga0495613_0053263 3300046689 Bacteria 2978
306 Ga0495670_0052918 3300046691 Bacteria 2033
307 Ga0495670_0082147 3300046691 Bacteria 1642
308 Ga0495671_0000092 3300046692 Bacteria 85232
309 Ga0495671_0000484 3300046692 Bacteria 30964
310 Ga0495671_0000792 3300046692 Bacteria 22664
311 Ga0495671_0010833 3300046692 Bacteria 5040
312 Ga0495671_0089259 3300046692 Bacteria 1509
313 Ga0495649_0000071 3300046694 Bacteria 89386
314 Ga0495649_0053926 3300046694 Bacteria 2175
315 Ga0495649_0113801 3300046694 Bacteria 1433
316 Ga0495589_0000115 3300046794 Bacteria 75796
317 Ga0495589_0000654 3300046794 Bacteria 22704
318 Ga0495589_0001477 3300046794 Bacteria 13524
319 Ga0495589_0017199 3300046794 Bacteria 3713
320 Ga0495589_0021653 3300046794 Bacteria 3284
321 Ga0495589_0057789 3300046794 Bacteria 1907
322 Ga0495660_0000218 3300046810 Bacteria 57673
323 Ga0495660_0005717 3300046810 Bacteria 7425
324 Ga0495660_0012774 3300046810 Bacteria 4872
325 Ga0495660_0022574 3300046810 Bacteria 3592
326 Ga0495660_0052663 3300046810 Bacteria 2210
327 Ga0495660_0065234 3300046810 Bacteria 1944
328 Ga0495660_0079790 3300046810 Bacteria 1718
329 Ga0495660_0110962 3300046810 Bacteria 1399
330 Ga0495581_0009228 3300047315 Bacteria 5706
331 Ga0495636_0024252 3300047318 Bacteria 2459
332 Ga0495636_0245293 3300047318 Bacteria 827
333 Ga0495672_0000033 3300047320 Bacteria 291992
334 Ga0495672_0001570 3300047320 Bacteria 22373
335 Ga0495672_0004983 3300047320 Bacteria 10650
336 Ga0495683_0000168 3300047323 Bacteria 63828
337 Ga0495683_0054425 3300047323 Bacteria 1994
338 Ga0495683_0385510 3300047323 Unclassified 585
339 Ga0495687_000067 3300047443 Bacteria 161372
340 Ga0495687_000086 3300047443 Bacteria 143855
341 Ga0495677_0000584 3300047445 Bacteria 14980
342 Ga0495677_0000985 3300047445 Bacteria 11464
343 Ga0495677_0002359 3300047445 Bacteria 7418
344 Ga0495677_0004949 3300047445 Bacteria 5080
345 Ga0495677_0028233 3300047445 Bacteria 2037
346 Ga0495677_0029100 3300047445 Bacteria 2008
347 Ga0495677_0041935 3300047445 Bacteria 1676
348 Ga0495677_0187111 3300047445 Unclassified 803
349 Ga0495679_004238 3300047446 Bacteria 6669
350 Ga0495679_008936 3300047446 Bacteria 4039
351 Ga0495679_016875 3300047446 Bacteria 2628
352 Ga0495685_004815 3300047447 Bacteria 4380
353 Ga0495685_084471 3300047447 Bacteria 1055
354 Ga0495685_094758 3300047447 Bacteria 987
355 Ga0495673_0087886 3300047469 Bacteria 1275
356 Ga0495681_0001730 3300047470 Bacteria 16136
357 Ga0495681_0010130 3300047470 Bacteria 5732
358 Ga0495681_0025432 3300047470 Bacteria 3098
359 Ga0495681_0050902 3300047470 Bacteria 1950
360 Ga0495681_0112969 3300047470 Bacteria 1174
361 Ga0495681_0113617 3300047470 Bacteria 1169
362 Ga0495686_0000431 3300047472 Bacteria 65240
363 Ga0495686_0021849 3300047472 Bacteria 4241
364 Ga0495686_0094887 3300047472 Bacteria 1807
365 Ga0495686_0135666 3300047472 Bacteria 1455
366 Ga0495686_0155285 3300047472 Bacteria 1341
367 Ga0495593_0069368 3300047673 Bacteria 1833
368 Ga0495626_0000011 3300048091 Bacteria 260928
369 Ga0495626_0001550 3300048091 Bacteria 18037
370 Ga0495626_0003408 3300048091 Bacteria 10220
371 Ga0495626_0004911 3300048091 Bacteria 8032
372 Ga0495626_0005288 3300048091 Bacteria 7621
373 Ga0495626_0012060 3300048091 Bacteria 4547
374 Ga0495626_0012228 3300048091 Bacteria 4506
375 Ga0495626_0015366 3300048091 Bacteria 3922
376 Ga0495626_0093976 3300048091 Bacteria 1315
377 Ga0495626_0194201 3300048091 Bacteria 835
378 Ga0495626_0222735 3300048091 Bacteria 766
379 Ga0496102_0175900 3300048905 Bacteria 2015
380 Ga0496106_0022475 3300048909 Bacteria 4686
381 Ga0496106_0062637 3300048909 Bacteria 2825
382 Ga0496107_0029464 3300048910 Bacteria 3905
383 Ga0496107_0070147 3300048910 Bacteria 2544
384 Ga0496110_0000007 3300048913 Bacteria 114271
385 Ga0496110_0001834 3300048913 Bacteria 15666
386 Ga0496111_0029712 3300048914 Bacteria 3883
387 Ga0496111_0760913 3300048914 Bacteria 702
388 Ga0496115_0032229 3300048918 Bacteria 4134
389 Ga0496123_0002198 3300048926 Bacteria 24822
390 Ga0495678_000024 3300049459 Bacteria 229034
391 Ga0495678_000035 3300049459 Bacteria 200957
392 Ga0495678_020732 3300049459 Bacteria 2903
393 Ga0495682_0000365 3300049460 Bacteria 32900
394 Ga0495682_0003650 3300049460 Bacteria 6783
395 Ga0495682_0009487 3300049460 Bacteria 3797
396 Ga0495682_0013363 3300049460 Bacteria 3128
397 Ga0495682_0016084 3300049460 Bacteria 2830
398 Ga0495682_0254902 3300049460 Bacteria 620
399 nmdc:mga0rr50_696309_c1 3300050513 Bacteria 867
400 nmdc:mga08x19_387451_c1 3300050514 Bacteria 979
401 Ga0587083_0058271 3300059505 Bacteria 863
402 Ga0587076_099591 3300059645 Bacteria 647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0161830 Ga0495597_0161830_446_874 115
2 3300046665 Ga0495661_0076096 Ga0495661_0076096_1471_1899 115
3 3300048091 Ga0495626_0001550 Ga0495626_0001550_16869_17297 115
4 3300046520 Ga0495637_0057590 Ga0495637_0057590_74_502 127
5 3300048091 Ga0495626_0004911 Ga0495626_0004911_3119_3598 127
6 3300046526 Ga0495666_0029471 Ga0495666_0029471_428_946 129
7 3300046531 Ga0495665_0015551 Ga0495665_0015551_1702_2220 129
8 3300046536 Ga0495587_0001570 Ga0495587_0001570_1566_2084 129
9 3300046674 Ga0495588_0002966 Ga0495588_0002966_4889_5407 129
10 3300047673 Ga0495593_0069368 Ga0495593_0069368_1296_1814 129
11 3300046474 Ga0495605_0193687 Ga0495605_0193687_448_876 130
12 3300046506 Ga0495583_0000463 Ga0495583_0000463_57927_58355 130
13 3300046530 Ga0495654_0185286 Ga0495654_0185286_163_624 130
14 3300046491 Ga0495584_0261695 Ga0495584_0261695_277_702 131
15 3300046513 Ga0495616_0022267 Ga0495616_0022267_1489_1947 132
16 3300046518 Ga0495631_0004913 Ga0495631_0004913_3381_3839 132
17 3300046519 Ga0495632_0000156 Ga0495632_0000156_60900_61358 132
18 3300046665 Ga0495661_0002490 Ga0495661_0002490_12461_12937 132
19 3300046694 Ga0495649_0113801 Ga0495649_0113801_746_1204 132
20 3300046810 Ga0495660_0005717 Ga0495660_0005717_6431_6889 132
21 3300048091 Ga0495626_0093976 Ga0495626_0093976_251_709 132
22 3300049459 Ga0495678_020732 Ga0495678_020732_303_761 132
23 3300049460 Ga0495682_0000365 Ga0495682_0000365_13540_13998 132
24 3300046528 Ga0495642_0000459 Ga0495642_0000459_13501_13941 134
25 3300047445 Ga0495677_0028233 Ga0495677_0028233_1559_1999 134
26 3300013307 Ga0157372_13128600 Ga0157372_131286002 135
27 3300025909 Ga0207705_10521444 Ga0207705_105214442 135
28 3300046507 Ga0495606_0018958 Ga0495606_0018958_3783_4190 135
29 3300046513 Ga0495616_0192586 Ga0495616_0192586_19_426 135
30 3300046522 Ga0495643_0091543 Ga0495643_0091543_252_659 135
31 3300046674 Ga0495588_0000052 Ga0495588_0000052_195297_195713 135
32 3300047443 Ga0495687_000067 Ga0495687_000067_37939_38346 135
33 3300048926 Ga0496123_0002198 Ga0496123_0002198_14057_14503 135
34 3300006881 Ga0068865_100904212 Ga0068865_1009042121 139
35 3300025938 Ga0207704_11153655 Ga0207704_111536551 139
36 3300046616 Ga0495668_0000006 Ga0495668_0000006_171389_171808 139
37 3300005563 Ga0068855_100860589 Ga0068855_1008605891 140
38 3300006871 Ga0075434_100316522 Ga0075434_1003165221 140
39 3300013307 Ga0157372_10887361 Ga0157372_108873612 140
40 3300025254 Ga0209148_1001112 Ga0209148_100111210 140
41 3300025949 Ga0207667_10615881 Ga0207667_106158812 140
42 3300037312 Ga0395899_0026998 Ga0395899_0026998_3447_3869 140
43 3300037312 Ga0395899_0122023 Ga0395899_0122023_58_480 140
44 3300037312 Ga0395899_0157342 Ga0395899_0157342_1130_1552 140
45 3300037312 Ga0395899_0425312 Ga0395899_0425312_203_625 140
46 3300037418 Ga0395900_0012300 Ga0395900_0012300_7871_8293 140
47 3300037418 Ga0395900_0127107 Ga0395900_0127107_1670_2092 140
48 3300037418 Ga0395900_0296446 Ga0395900_0296446_1091_1513 140
49 3300037466 Ga0395898_0038891 Ga0395898_0038891_1025_1447 140
50 3300037466 Ga0395898_0159638 Ga0395898_0159638_976_1398 140
51 3300037466 Ga0395898_1176580 Ga0395898_1176580_96_518 140
52 3300037471 Ga0395905_0163803 Ga0395905_0163803_358_780 140
53 3300037471 Ga0395905_0202361 Ga0395905_0202361_1083_1505 140
54 3300037471 Ga0395905_0398216 Ga0395905_0398216_440_862 140
55 3300038443 Ga0395901_0006544 Ga0395901_0006544_11148_11570 140
56 3300038443 Ga0395901_0300761 Ga0395901_0300761_218_640 140
57 3300046543 Ga0495645_0023835 Ga0495645_0023835_995_1417 140
58 3300048905 Ga0496102_0175900 Ga0496102_0175900_1502_1924 140
59 3300048909 Ga0496106_0022475 Ga0496106_0022475_1869_2291 140
60 3300048910 Ga0496107_0029464 Ga0496107_0029464_159_581 140
61 3300005457 Ga0070662_100306427 Ga0070662_1003064272 141
62 3300011119 Ga0105246_10224139 Ga0105246_102241392 141
63 3300025933 Ga0207706_10052388 Ga0207706_100523882 141
64 3300046452 Ga0495617_000012 Ga0495617_000012_200593_201018 141
65 3300046452 Ga0495617_073620 Ga0495617_073620_12_437 141
66 3300046453 Ga0495627_000118 Ga0495627_000118_43002_43427 141
67 3300046457 Ga0495590_0000013 Ga0495590_0000013_176542_176967 141
68 3300046457 Ga0495590_0006583 Ga0495590_0006583_2511_2936 141
69 3300046457 Ga0495590_0014062 Ga0495590_0014062_603_1028 141
70 3300046458 Ga0495591_000109 Ga0495591_000109_5996_6421 141
71 3300046458 Ga0495591_007355 Ga0495591_007355_3695_4168 141
72 3300046460 Ga0495638_0208487 Ga0495638_0208487_460_885 141
73 3300046460 Ga0495638_0566511 Ga0495638_0566511_13_438 141
74 3300046474 Ga0495605_0000072 Ga0495605_0000072_65351_65776 141
75 3300046474 Ga0495605_0004941 Ga0495605_0004941_353_778 141
76 3300046474 Ga0495605_0013762 Ga0495605_0013762_351_824 141
77 3300046474 Ga0495605_0043984 Ga0495605_0043984_1740_2165 141
78 3300046474 Ga0495605_0106852 Ga0495605_0106852_62_487 141
79 3300046491 Ga0495584_0000029 Ga0495584_0000029_26888_27313 141
80 3300046491 Ga0495584_0000791 Ga0495584_0000791_13720_14193 141
81 3300046492 Ga0495585_0000048 Ga0495585_0000048_104082_104507 141
82 3300046492 Ga0495585_0007053 Ga0495585_0007053_1255_1680 141
83 3300046492 Ga0495585_0210512 Ga0495585_0210512_497_970 141
84 3300046492 Ga0495585_0275651 Ga0495585_0275651_108_614 141
85 3300046499 Ga0495594_0050157 Ga0495594_0050157_1652_2077 141
86 3300046500 Ga0495596_0000243 Ga0495596_0000243_10260_10685 141
87 3300046500 Ga0495596_0000309 Ga0495596_0000309_29415_29840 141
88 3300046500 Ga0495596_0003025 Ga0495596_0003025_3800_4225 141
89 3300046500 Ga0495596_0003935 Ga0495596_0003935_1881_2306 141
90 3300046500 Ga0495596_0020735 Ga0495596_0020735_700_1125 141
91 3300046500 Ga0495596_0023664 Ga0495596_0023664_591_1076 141
92 3300046500 Ga0495596_0025081 Ga0495596_0025081_363_836 141
93 3300046500 Ga0495596_0025461 Ga0495596_0025461_1908_2333 141
94 3300046500 Ga0495596_0094711 Ga0495596_0094711_362_787 141
95 3300046501 Ga0495607_0002120 Ga0495607_0002120_6566_6991 141
96 3300046501 Ga0495607_0002863 Ga0495607_0002863_5823_6248 141
97 3300046501 Ga0495607_0005992 Ga0495607_0005992_6028_6471 141
98 3300046501 Ga0495607_0008378 Ga0495607_0008378_4758_5216 141
99 3300046501 Ga0495607_0013962 Ga0495607_0013962_1589_2014 141
100 3300046501 Ga0495607_0017736 Ga0495607_0017736_1855_2313 141
101 3300046501 Ga0495607_0032051 Ga0495607_0032051_37_462 141
102 3300046506 Ga0495583_0000697 Ga0495583_0000697_3957_4427 141
103 3300046506 Ga0495583_0001770 Ga0495583_0001770_1022_1447 141
104 3300046506 Ga0495583_0011831 Ga0495583_0011831_2542_2967 141
105 3300046506 Ga0495583_0028892 Ga0495583_0028892_725_1150 141
106 3300046506 Ga0495583_0097507 Ga0495583_0097507_477_950 141
107 3300046507 Ga0495606_0039782 Ga0495606_0039782_577_1050 141
108 3300046507 Ga0495606_0074336 Ga0495606_0074336_260_718 141
109 3300046512 Ga0495610_0004903 Ga0495610_0004903_7390_7815 141
110 3300046513 Ga0495616_0000131 Ga0495616_0000131_43778_44203 141
111 3300046513 Ga0495616_0000238 Ga0495616_0000238_11633_12061 141
112 3300046513 Ga0495616_0000388 Ga0495616_0000388_23166_23609 141
113 3300046513 Ga0495616_0001928 Ga0495616_0001928_6625_7050 141
114 3300046513 Ga0495616_0020509 Ga0495616_0020509_379_852 141
115 3300046513 Ga0495616_0067250 Ga0495616_0067250_576_1001 141
116 3300046513 Ga0495616_0123675 Ga0495616_0123675_692_1156 141
117 3300046513 Ga0495616_0390288 Ga0495616_0390288_56_481 141
118 3300046518 Ga0495631_0000737 Ga0495631_0000737_14472_14897 141
119 3300046518 Ga0495631_0002673 Ga0495631_0002673_5776_6201 141
120 3300046518 Ga0495631_0017067 Ga0495631_0017067_2938_3363 141
121 3300046518 Ga0495631_0023136 Ga0495631_0023136_363_788 141
122 3300046518 Ga0495631_0039124 Ga0495631_0039124_100_525 141
123 3300046518 Ga0495631_0115584 Ga0495631_0115584_326_799 141
124 3300046518 Ga0495631_0161327 Ga0495631_0161327_336_806 141
125 3300046519 Ga0495632_0000116 Ga0495632_0000116_27466_27891 141
126 3300046519 Ga0495632_0000853 Ga0495632_0000853_17893_18336 141
127 3300046519 Ga0495632_0001593 Ga0495632_0001593_7881_8345 141
128 3300046519 Ga0495632_0003692 Ga0495632_0003692_4353_4778 141
129 3300046519 Ga0495632_0014760 Ga0495632_0014760_1219_1692 141
130 3300046519 Ga0495632_0024852 Ga0495632_0024852_1836_2261 141
131 3300046519 Ga0495632_0064615 Ga0495632_0064615_481_906 141
132 3300046520 Ga0495637_0000008 Ga0495637_0000008_94620_95045 141
133 3300046520 Ga0495637_0051725 Ga0495637_0051725_231_704 141
134 3300046520 Ga0495637_0065149 Ga0495637_0065149_260_685 141
135 3300046522 Ga0495643_0000121 Ga0495643_0000121_39449_39877 141
136 3300046522 Ga0495643_0005225 Ga0495643_0005225_1248_1697 141
137 3300046522 Ga0495643_0006816 Ga0495643_0006816_5390_5815 141
138 3300046522 Ga0495643_0014186 Ga0495643_0014186_1819_2244 141
139 3300046522 Ga0495643_0028165 Ga0495643_0028165_2229_2687 141
140 3300046522 Ga0495643_0066303 Ga0495643_0066303_919_1377 141
141 3300046522 Ga0495643_0295619 Ga0495643_0295619_181_687 141
142 3300046523 Ga0495644_0007278 Ga0495644_0007278_1055_1480 141
143 3300046523 Ga0495644_0027243 Ga0495644_0027243_1117_1542 141
144 3300046523 Ga0495644_0075377 Ga0495644_0075377_773_1198 141
145 3300046524 Ga0495648_0000116 Ga0495648_0000116_46381_46806 141
146 3300046524 Ga0495648_0005481 Ga0495648_0005481_4104_4529 141
147 3300046524 Ga0495648_0007837 Ga0495648_0007837_7033_7458 141
148 3300046524 Ga0495648_0040184 Ga0495648_0040184_486_911 141
149 3300046524 Ga0495648_0047558 Ga0495648_0047558_1842_2267 141
150 3300046524 Ga0495648_0183606 Ga0495648_0183606_294_767 141
151 3300046524 Ga0495648_0385232 Ga0495648_0385232_20_445 141
152 3300046526 Ga0495666_0002015 Ga0495666_0002015_9211_9636 141
153 3300046528 Ga0495642_0000010 Ga0495642_0000010_45157_45582 141
154 3300046528 Ga0495642_0002240 Ga0495642_0002240_5866_6291 141
155 3300046528 Ga0495642_0024702 Ga0495642_0024702_1328_1801 141
156 3300046528 Ga0495642_0029050 Ga0495642_0029050_684_1109 141
157 3300046528 Ga0495642_0435014 Ga0495642_0435014_97_525 141
158 3300046530 Ga0495654_0005595 Ga0495654_0005595_5107_5532 141
159 3300046530 Ga0495654_0052292 Ga0495654_0052292_1061_1519 141
160 3300046530 Ga0495654_0067621 Ga0495654_0067621_1044_1469 141
161 3300046531 Ga0495665_0001347 Ga0495665_0001347_2598_3023 141
162 3300046538 Ga0495609_0007564 Ga0495609_0007564_2929_3354 141
163 3300046538 Ga0495609_0008690 Ga0495609_0008690_3002_3475 141
164 3300046538 Ga0495609_0023384 Ga0495609_0023384_1734_2159 141
165 3300046538 Ga0495609_0060136 Ga0495609_0060136_675_1100 141
166 3300046538 Ga0495609_0088079 Ga0495609_0088079_855_1280 141
167 3300046538 Ga0495609_0172417 Ga0495609_0172417_162_620 141
168 3300046542 Ga0495597_0010574 Ga0495597_0010574_1642_2067 141
169 3300046542 Ga0495597_0014466 Ga0495597_0014466_1881_2306 141
170 3300046542 Ga0495597_0019080 Ga0495597_0019080_2550_2975 141
171 3300046542 Ga0495597_0027852 Ga0495597_0027852_1447_1872 141
172 3300046557 Ga0495622_0001500 Ga0495622_0001500_9402_9827 141
173 3300046558 Ga0495633_0000874 Ga0495633_0000874_21302_21727 141
174 3300046558 Ga0495633_0056515 Ga0495633_0056515_269_694 141
175 3300046558 Ga0495633_0071954 Ga0495633_0071954_465_935 141
176 3300046558 Ga0495633_0100581 Ga0495633_0100581_79_504 141
177 3300046558 Ga0495633_0150743 Ga0495633_0150743_318_743 141
178 3300046615 Ga0495656_0006750 Ga0495656_0006750_160_585 141
179 3300046615 Ga0495656_0025576 Ga0495656_0025576_16_441 141
180 3300046616 Ga0495668_0000532 Ga0495668_0000532_46178_46603 141
181 3300046616 Ga0495668_0000733 Ga0495668_0000733_34006_34431 141
182 3300046616 Ga0495668_0002189 Ga0495668_0002189_1740_2165 141
183 3300046616 Ga0495668_0006228 Ga0495668_0006228_5793_6218 141
184 3300046616 Ga0495668_0033857 Ga0495668_0033857_773_1198 141
185 3300046616 Ga0495668_0057870 Ga0495668_0057870_173_646 141
186 3300046648 Ga0495611_0001733 Ga0495611_0001733_19_444 141
187 3300046648 Ga0495611_0003086 Ga0495611_0003086_78_503 141
188 3300046648 Ga0495611_0004803 Ga0495611_0004803_5158_5583 141
189 3300046648 Ga0495611_0027979 Ga0495611_0027979_1302_1727 141
190 3300046648 Ga0495611_0295649 Ga0495611_0295649_228_653 141
191 3300046660 Ga0495625_0010704 Ga0495625_0010704_6759_7184 141
192 3300046660 Ga0495625_0031882 Ga0495625_0031882_1897_2322 141
193 3300046660 Ga0495625_0248641 Ga0495625_0248641_683_1108 141
194 3300046665 Ga0495661_0002259 Ga0495661_0002259_12377_12802 141
195 3300046665 Ga0495661_0006159 Ga0495661_0006159_3306_3770 141
196 3300046665 Ga0495661_0029945 Ga0495661_0029945_176_601 141
197 3300046665 Ga0495661_0045398 Ga0495661_0045398_1360_1785 141
198 3300046665 Ga0495661_0045480 Ga0495661_0045480_702_1127 141
199 3300046665 Ga0495661_0057941 Ga0495661_0057941_744_1169 141
200 3300046665 Ga0495661_0077806 Ga0495661_0077806_1190_1648 141
201 3300046665 Ga0495661_0102008 Ga0495661_0102008_80_505 141
202 3300046665 Ga0495661_0127387 Ga0495661_0127387_814_1239 141
203 3300046665 Ga0495661_0169331 Ga0495661_0169331_295_768 141
204 3300046665 Ga0495661_0183386 Ga0495661_0183386_317_742 141
205 3300046665 Ga0495661_0225848 Ga0495661_0225848_39_464 141
206 3300046674 Ga0495588_0028372 Ga0495588_0028372_22_447 141
207 3300046674 Ga0495588_0041932 Ga0495588_0041932_551_976 141
208 3300046684 Ga0495669_0019563 Ga0495669_0019563_992_1417 141
209 3300046684 Ga0495669_0031167 Ga0495669_0031167_446_871 141
210 3300046684 Ga0495669_0038224 Ga0495669_0038224_554_979 141
211 3300046684 Ga0495669_0070220 Ga0495669_0070220_191_616 141
212 3300046684 Ga0495669_0075459 Ga0495669_0075459_112_537 141
213 3300046684 Ga0495669_0373973 Ga0495669_0373973_59_517 141
214 3300046689 Ga0495613_0053263 Ga0495613_0053263_2349_2774 141
215 3300046691 Ga0495670_0052918 Ga0495670_0052918_786_1259 141
216 3300046691 Ga0495670_0082147 Ga0495670_0082147_787_1257 141
217 3300046692 Ga0495671_0000092 Ga0495671_0000092_42375_42800 141
218 3300046692 Ga0495671_0000484 Ga0495671_0000484_15176_15601 141
219 3300046692 Ga0495671_0000792 Ga0495671_0000792_19506_19931 141
220 3300046692 Ga0495671_0010833 Ga0495671_0010833_1994_2419 141
221 3300046692 Ga0495671_0089259 Ga0495671_0089259_629_1054 141
222 3300046694 Ga0495649_0000071 Ga0495649_0000071_47226_47651 141
223 3300046694 Ga0495649_0053926 Ga0495649_0053926_309_785 141
224 3300046794 Ga0495589_0000115 Ga0495589_0000115_323_781 141
225 3300046794 Ga0495589_0000654 Ga0495589_0000654_20181_20606 141
226 3300046794 Ga0495589_0001477 Ga0495589_0001477_6861_7286 141
227 3300046794 Ga0495589_0017199 Ga0495589_0017199_1191_1676 141
228 3300046794 Ga0495589_0021653 Ga0495589_0021653_399_824 141
229 3300046794 Ga0495589_0057789 Ga0495589_0057789_668_1141 141
230 3300046810 Ga0495660_0000218 Ga0495660_0000218_34493_34951 141
231 3300046810 Ga0495660_0012774 Ga0495660_0012774_676_1101 141
232 3300046810 Ga0495660_0022574 Ga0495660_0022574_2948_3421 141
233 3300046810 Ga0495660_0052663 Ga0495660_0052663_1740_2165 141
234 3300046810 Ga0495660_0065234 Ga0495660_0065234_235_720 141
235 3300046810 Ga0495660_0079790 Ga0495660_0079790_348_773 141
236 3300046810 Ga0495660_0110962 Ga0495660_0110962_122_547 141
237 3300047315 Ga0495581_0009228 Ga0495581_0009228_627_1052 141
238 3300047318 Ga0495636_0024252 Ga0495636_0024252_1291_1716 141
239 3300047318 Ga0495636_0245293 Ga0495636_0245293_238_663 141
240 3300047320 Ga0495672_0000033 Ga0495672_0000033_173039_173464 141
241 3300047320 Ga0495672_0001570 Ga0495672_0001570_12261_12719 141
242 3300047320 Ga0495672_0004983 Ga0495672_0004983_1013_1486 141
243 3300047323 Ga0495683_0000168 Ga0495683_0000168_41905_42330 141
244 3300047323 Ga0495683_0054425 Ga0495683_0054425_294_767 141
245 3300047323 Ga0495683_0385510 Ga0495683_0385510_27_452 141
246 3300047443 Ga0495687_000086 Ga0495687_000086_114903_115361 141
247 3300047445 Ga0495677_0000584 Ga0495677_0000584_5592_6056 141
248 3300047445 Ga0495677_0000985 Ga0495677_0000985_4991_5449 141
249 3300047445 Ga0495677_0002359 Ga0495677_0002359_785_1210 141
250 3300047445 Ga0495677_0004949 Ga0495677_0004949_252_677 141
251 3300047445 Ga0495677_0029100 Ga0495677_0029100_111_536 141
252 3300047445 Ga0495677_0041935 Ga0495677_0041935_88_513 141
253 3300047445 Ga0495677_0187111 Ga0495677_0187111_315_773 141
254 3300047446 Ga0495679_004238 Ga0495679_004238_1967_2392 141
255 3300047446 Ga0495679_008936 Ga0495679_008936_547_972 141
256 3300047446 Ga0495679_016875 Ga0495679_016875_296_721 141
257 3300047447 Ga0495685_004815 Ga0495685_004815_1809_2234 141
258 3300047447 Ga0495685_084471 Ga0495685_084471_440_913 141
259 3300047447 Ga0495685_094758 Ga0495685_094758_59_484 141
260 3300047469 Ga0495673_0087886 Ga0495673_0087886_176_649 141
261 3300047470 Ga0495681_0001730 Ga0495681_0001730_3803_4273 141
262 3300047470 Ga0495681_0010130 Ga0495681_0010130_5131_5556 141
263 3300047470 Ga0495681_0025432 Ga0495681_0025432_2644_3069 141
264 3300047470 Ga0495681_0050902 Ga0495681_0050902_267_692 141
265 3300047470 Ga0495681_0112969 Ga0495681_0112969_396_821 141
266 3300047470 Ga0495681_0113617 Ga0495681_0113617_60_485 141
267 3300047472 Ga0495686_0000431 Ga0495686_0000431_8334_8819 141
268 3300047472 Ga0495686_0021849 Ga0495686_0021849_3046_3471 141
269 3300047472 Ga0495686_0094887 Ga0495686_0094887_236_661 141
270 3300047472 Ga0495686_0135666 Ga0495686_0135666_452_877 141
271 3300047472 Ga0495686_0155285 Ga0495686_0155285_583_1008 141
272 3300048091 Ga0495626_0000011 Ga0495626_0000011_95219_95677 141
273 3300048091 Ga0495626_0003408 Ga0495626_0003408_5571_5996 141
274 3300048091 Ga0495626_0005288 Ga0495626_0005288_4181_4606 141
275 3300048091 Ga0495626_0012060 Ga0495626_0012060_3858_4331 141
276 3300048091 Ga0495626_0012228 Ga0495626_0012228_3083_3508 141
277 3300048091 Ga0495626_0015366 Ga0495626_0015366_3211_3636 141
278 3300048091 Ga0495626_0194201 Ga0495626_0194201_317_742 141
279 3300048091 Ga0495626_0222735 Ga0495626_0222735_318_743 141
280 3300048909 Ga0496106_0062637 Ga0496106_0062637_2134_2589 141
281 3300048910 Ga0496107_0070147 Ga0496107_0070147_741_1196 141
282 3300048913 Ga0496110_0000007 Ga0496110_0000007_5337_5762 141
283 3300048913 Ga0496110_0001834 Ga0496110_0001834_14101_14556 141
284 3300048914 Ga0496111_0029712 Ga0496111_0029712_1404_1859 141
285 3300048914 Ga0496111_0760913 Ga0496111_0760913_60_485 141
286 3300048918 Ga0496115_0032229 Ga0496115_0032229_2770_3198 141
287 3300049459 Ga0495678_000024 Ga0495678_000024_115024_115449 141
288 3300049459 Ga0495678_000035 Ga0495678_000035_12639_13064 141
289 3300049460 Ga0495682_0003650 Ga0495682_0003650_2652_3125 141
290 3300049460 Ga0495682_0009487 Ga0495682_0009487_1308_1733 141
291 3300049460 Ga0495682_0013363 Ga0495682_0013363_983_1408 141
292 3300049460 Ga0495682_0016084 Ga0495682_0016084_1537_1962 141
293 3300049460 Ga0495682_0254902 Ga0495682_0254902_142_600 141
294 3300005518 Ga0070699_100258674 Ga0070699_1002586741 143
295 3300005366 Ga0070659_100286708 Ga0070659_1002867082 144
296 3300005535 Ga0070684_101808612 Ga0070684_1018086121 144
297 3300025909 Ga0207705_10068339 Ga0207705_100683393 144
298 3300025919 Ga0207657_10742799 Ga0207657_107427992 144
299 3300005336 Ga0070680_100340716 Ga0070680_1003407162 145
300 3300005518 Ga0070699_100026859 Ga0070699_1000268594 145
301 3300005547 Ga0070693_100267325 Ga0070693_1002673252 145
302 3300009093 Ga0105240_10269429 Ga0105240_102694294 145
303 3300025912 Ga0207707_11026133 Ga0207707_110261332 145
304 3300025913 Ga0207695_10097547 Ga0207695_100975473 145
305 3300025928 Ga0207700_10065423 Ga0207700_100654232 145
306 3300005327 Ga0070658_10002076 Ga0070658_100020766 146
307 3300005329 Ga0070683_100060143 Ga0070683_1000601434 146
308 3300005336 Ga0070680_100108141 Ga0070680_1001081412 146
309 3300005339 Ga0070660_100007080 Ga0070660_1000070803 146
310 3300005339 Ga0070660_100088823 Ga0070660_1000888232 146
311 3300005341 Ga0070691_10062719 Ga0070691_100627192 146
312 3300005344 Ga0070661_100026801 Ga0070661_1000268014 146
313 3300005353 Ga0070669_100900918 Ga0070669_1009009181 146
314 3300005366 Ga0070659_100014092 Ga0070659_1000140922 146
315 3300005366 Ga0070659_100028994 Ga0070659_1000289942 146
316 3300005435 Ga0070714_100029991 Ga0070714_1000299913 146
317 3300005435 Ga0070714_100723143 Ga0070714_1007231431 146
318 3300005436 Ga0070713_101076091 Ga0070713_1010760912 146
319 3300005439 Ga0070711_100390332 Ga0070711_1003903321 146
320 3300005455 Ga0070663_100017261 Ga0070663_1000172615 146
321 3300005530 Ga0070679_100110868 Ga0070679_1001108682 146
322 3300005530 Ga0070679_100207224 Ga0070679_1002072242 146
323 3300005530 Ga0070679_100666793 Ga0070679_1006667932 146
324 3300005535 Ga0070684_100124537 Ga0070684_1001245372 146
325 3300005539 Ga0068853_100090053 Ga0068853_1000900533 146
326 3300005563 Ga0068855_100161415 Ga0068855_1001614151 146
327 3300005564 Ga0070664_100014971 Ga0070664_1000149716 146
328 3300005578 Ga0068854_100011319 Ga0068854_1000113196 146
329 3300005614 Ga0068856_100009042 Ga0068856_1000090428 146
330 3300005614 Ga0068856_100323196 Ga0068856_1003231961 146
331 3300005616 Ga0068852_100066940 Ga0068852_1000669403 146
332 3300005616 Ga0068852_100407303 Ga0068852_1004073032 146
333 3300005719 Ga0068861_100150874 Ga0068861_1001508742 146
334 3300005834 Ga0068851_10003311 Ga0068851_100033115 146
335 3300006914 Ga0075436_100134526 Ga0075436_1001345262 146
336 3300007076 Ga0075435_100768747 Ga0075435_1007687472 146
337 3300009093 Ga0105240_10021532 Ga0105240_100215325 146
338 3300009093 Ga0105240_10035370 Ga0105240_100353702 146
339 3300009545 Ga0105237_10050202 Ga0105237_100502023 146
340 3300009545 Ga0105237_10100596 Ga0105237_101005963 146
341 3300009551 Ga0105238_10007768 Ga0105238_100077686 146
342 3300010375 Ga0105239_10039353 Ga0105239_100393535 146
343 3300013100 Ga0157373_10003436 Ga0157373_100034366 146
344 3300013102 Ga0157371_10185045 Ga0157371_101850452 146
345 3300013104 Ga0157370_10015767 Ga0157370_100157672 146
346 3300013104 Ga0157370_10022974 Ga0157370_100229743 146
347 3300013104 Ga0157370_10030981 Ga0157370_100309815 146
348 3300013105 Ga0157369_10011852 Ga0157369_100118524 146
349 3300013105 Ga0157369_10153036 Ga0157369_101530362 146
350 3300013105 Ga0157369_10233497 Ga0157369_102334972 146
351 3300013306 Ga0163162_10377784 Ga0163162_103777841 146
352 3300013307 Ga0157372_10151972 Ga0157372_101519723 146
353 3300013307 Ga0157372_10157395 Ga0157372_101573954 146
354 3300013307 Ga0157372_10203380 Ga0157372_102033802 146
355 3300020081 Ga0206354_11164308 Ga0206354_111643084 146
356 3300020082 Ga0206353_11882268 Ga0206353_118822683 146
357 3300020610 Ga0154015_1157659 Ga0154015_11576592 146
358 3300025321 Ga0207656_10055888 Ga0207656_100558882 146
359 3300025906 Ga0207699_10058882 Ga0207699_100588822 146
360 3300025909 Ga0207705_10070481 Ga0207705_100704812 146
361 3300025911 Ga0207654_10040766 Ga0207654_100407662 146
362 3300025912 Ga0207707_10037804 Ga0207707_100378044 146
363 3300025913 Ga0207695_10011934 Ga0207695_100119346 146
364 3300025913 Ga0207695_10157410 Ga0207695_101574102 146
365 3300025914 Ga0207671_10404360 Ga0207671_104043602 146
366 3300025916 Ga0207663_10712864 Ga0207663_107128642 146
367 3300025917 Ga0207660_10313531 Ga0207660_103135312 146
368 3300025917 Ga0207660_10924337 Ga0207660_109243372 146
369 3300025919 Ga0207657_10000545 Ga0207657_1000054525 146
370 3300025919 Ga0207657_10052623 Ga0207657_100526233 146
371 3300025919 Ga0207657_10265475 Ga0207657_102654751 146
372 3300025920 Ga0207649_10145325 Ga0207649_101453252 146
373 3300025921 Ga0207652_10008437 Ga0207652_100084372 146
374 3300025921 Ga0207652_10356692 Ga0207652_103566922 146
375 3300025923 Ga0207681_10749278 Ga0207681_107492781 146
376 3300025924 Ga0207694_10012386 Ga0207694_100123865 146
377 3300025929 Ga0207664_10109183 Ga0207664_101091833 146
378 3300025929 Ga0207664_10637783 Ga0207664_106377832 146
379 3300025932 Ga0207690_10141926 Ga0207690_101419262 146
380 3300025932 Ga0207690_10208815 Ga0207690_102088151 146
381 3300025933 Ga0207706_10398472 Ga0207706_103984721 146
382 3300025944 Ga0207661_10110199 Ga0207661_101101993 146
383 3300025945 Ga0207679_10113505 Ga0207679_101135052 146
384 3300025949 Ga0207667_10001020 Ga0207667_1000102010 146
385 3300025949 Ga0207667_10126173 Ga0207667_101261732 146
386 3300025949 Ga0207667_10366030 Ga0207667_103660302 146
387 3300025981 Ga0207640_10302226 Ga0207640_103022262 146
388 3300026041 Ga0207639_10010534 Ga0207639_100105346 146
389 3300026041 Ga0207639_11629099 Ga0207639_116290991 146
390 3300026067 Ga0207678_10003081 Ga0207678_100030816 146
391 3300026078 Ga0207702_10135908 Ga0207702_101359082 146
392 3300026116 Ga0207674_10000599 Ga0207674_1000059930 146
393 3300026118 Ga0207675_100134028 Ga0207675_1001340283 146
394 3300026142 Ga0207698_10112848 Ga0207698_101128482 146
395 3300037418 Ga0395900_0832794 Ga0395900_0832794_16_456 146
396 3300037466 Ga0395898_0488586 Ga0395898_0488586_565_1005 146
397 3300037471 Ga0395905_0079235 Ga0395905_0079235_1543_1983 146
398 3300038443 Ga0395901_0437424 Ga0395901_0437424_107_547 146
399 3300050513 nmdc:mga0rr50_696309_c1 nmdc:mga0rr50_696309_c1_284_724 146
400 3300050514 nmdc:mga08x19_387451_c1 nmdc:mga08x19_387451_c1_108_548 146
401 3300059505 Ga0587083_0058271 Ga0587083_0058271_96_536 146
402 3300059645 Ga0587076_099591 Ga0587076_099591_28_468 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

33

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5292 21 131
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5089 21 131
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4786 18 131
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.4767 22 130
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4501 18 131
ID Description Score Start End Superfamily
af_Q9VRE4_271_372_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7659 81 130 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6902 11 131 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6841 19 130 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6361 19 130 1.10.10.1740
af_A0A1D6HRG8_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6278 22 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1M7YAC6-F1-model_v4 Putative oxidoreductase 0.9172 18 138 GO:0005886
AF-A0A328YTP2-F1-model_v4 Putative membrane protein YphA (DoxX/SURF4 family) 0.9169 2 146 GO:0005886
AF-A0A3N1WZY1-F1-model_v4 Putative oxidoreductase 0.9119 18 138 GO:0005886
AF-D5V2U8-F1-model_v4 DoxX family protein 0.9113 14 138 GO:0005886
AF-A0A7C5D8Z5-F1-model_v4 DoxX family protein 0.9084 18 138 GO:0005886

Feature Viewer

pLDDT pTM Quality
66.54 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map