F435199

General Info

Members Datasets Scaffolds Average Seq Length
402 275 802 414

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0019079|Ga0496108_0019079_3951_5240
Length 429
Sequence VSWRDASKRGSRNPEQEHIVTQPSTTPSESAQKPGKTAIRPFQVPEVPDAELAELRKRINATRWPERETVADVSQGTQLATSQKLARYWATDYDWRKCEAKLKALPHFMTEIDGLDIHFIHVRSKHEDALPLIVTHGWPGSILEQLKIIEPLTNPTAHGAKASDAFHLVIPSMPGYGYSGKPSPTNDGWNADKIAQAWIVLMKRLGYDQYVAQGGDWGALITQLMGVQAPPELLGIHTNMPGAVPPDIAKALAAHAPPPSGLGADEKRAYEQVAAFSKHLGYAILLGTRPQTLTALADSPVGLAAFMIDHDDRSLELITRSFDGKPEGLTRDDVLDNITLFWLTNTAISAARVYWENKREFFAPVGVSIPVAVSAFPDELYQCPRSWAEKAFPKLIHYNRLPKGGHFAAWEQPQLLVEELRAAFRSLRP

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
80 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
81 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
82 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
228 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
231 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
232 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
235 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
236 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
250 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
257 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
264 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
265 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
266 2734482264 Dyella sp. AD052 Isolate Unclassified
267 2738543009 Luteibacter sp. OK325 Isolate Unclassified
268 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
269 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
270 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
271 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
272 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
273 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
274 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
275 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 1.24
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 1.49
Rhizoplane 3.73
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0019079 3300048911 Bacteria 5627
2 JGI24738J21930_10000899 3300002075 Bacteria 8545
3 JGI25404J52841_10004519 3300003659 Bacteria 2826
4 Ga0058859_11710732 3300004798 Bacteria 3052
5 Ga0065715_10157251 3300005293 Bacteria 1664
6 Ga0070683_100075528 3300005329 Bacteria 3148
7 Ga0070670_100089415 3300005331 Bacteria 2647
8 Ga0070680_100185588 3300005336 Bacteria 1752
9 Ga0070682_100006973 3300005337 Bacteria 6353
10 Ga0070689_100158118 3300005340 Bacteria 1830
11 Ga0070689_100265801 3300005340 Bacteria 1419
12 Ga0070692_10016825 3300005345 Bacteria 3485
13 Ga0070668_100007409 3300005347 Bacteria 8143
14 Ga0070675_100002161 3300005354 Bacteria 14538
15 Ga0070671_100069952 3300005355 Bacteria 2927
16 Ga0070671_100096112 3300005355 Bacteria 2484
17 Ga0070673_100021992 3300005364 Bacteria 4635
18 Ga0070703_10003679 3300005406 Bacteria 4348
19 Ga0070709_10053674 3300005434 Bacteria 2539
20 Ga0070705_100006389 3300005440 Bacteria 5778
21 Ga0070700_100000272 3300005441 Bacteria 27508
22 Ga0070694_100001097 3300005444 Bacteria 15485
23 Ga0070694_100012875 3300005444 Bacteria 5215
24 Ga0068867_100013024 3300005459 Bacteria 5886
25 Ga0070706_100204932 3300005467 Bacteria 1842
26 Ga0070698_100021862 3300005471 Bacteria 6699
27 Ga0070699_100142865 3300005518 Bacteria 2114
28 Ga0070679_100029348 3300005530 Bacteria 5427
29 Ga0070679_100057810 3300005530 Bacteria 3865
30 Ga0070679_100140719 3300005530 Bacteria 2393
31 Ga0070684_100001808 3300005535 Bacteria 15655
32 Ga0070697_100002301 3300005536 Bacteria 14669
33 Ga0070697_100038759 3300005536 Bacteria 3851
34 Ga0070697_100081562 3300005536 Bacteria 2665
35 Ga0068853_100021762 3300005539 Bacteria 5350
36 Ga0070672_100164083 3300005543 Bacteria 1845
37 Ga0070695_100059027 3300005545 Bacteria 2482
38 Ga0070696_100095468 3300005546 Bacteria 2123
39 Ga0070693_100014696 3300005547 Bacteria 4017
40 Ga0070665_100000182 3300005548 Bacteria 111555
41 Ga0070665_100113826 3300005548 Bacteria 2708
42 Ga0070665_100277256 3300005548 Bacteria 1679
43 Ga0070704_100048651 3300005549 Bacteria 2969
44 Ga0068855_100000583 3300005563 Bacteria 44861
45 Ga0070664_100006247 3300005564 Bacteria 9620
46 Ga0070702_100019528 3300005615 Bacteria 3537
47 Ga0070702_100099177 3300005615 Bacteria 1783
48 Ga0068859_100017455 3300005617 Bacteria 7214
49 Ga0068859_100110248 3300005617 Bacteria 2814
50 Ga0068859_100207724 3300005617 Bacteria 2044
51 Ga0068864_100033765 3300005618 Bacteria 4350
52 Ga0068851_10032707 3300005834 Bacteria 2588
53 Ga0068860_100002303 3300005843 Bacteria 20070
54 Ga0081540_1008188 3300005983 Bacteria 7323
55 Ga0081540_1032866 3300005983 Bacteria 2825
56 Ga0081539_10009409 3300005985 Bacteria 8173
57 Ga0075364_10042925 3300006051 Bacteria 2939
58 Ga0070715_10024723 3300006163 Bacteria 2371
59 Ga0070716_100005168 3300006173 Bacteria 6308
60 Ga0070712_100001541 3300006175 Bacteria 14074
61 Ga0070712_100028939 3300006175 Bacteria 3711
62 Ga0097621_100195626 3300006237 Bacteria 1753
63 Ga0075428_100033553 3300006844 Bacteria 5666
64 Ga0075428_100037226 3300006844 Bacteria 5358
65 Ga0075430_100010014 3300006846 Bacteria 8021
66 Ga0075430_100043666 3300006846 Bacteria 3790
67 Ga0075431_100003335 3300006847 Bacteria 15553
68 Ga0075431_100039637 3300006847 Bacteria 4853
69 Ga0075431_100067246 3300006847 Bacteria 3699
70 Ga0075431_100068757 3300006847 Bacteria 3654
71 Ga0075431_100142952 3300006847 Bacteria 2466
72 Ga0075429_100018621 3300006880 Bacteria 6014
73 Ga0068865_100011412 3300006881 Bacteria 5560
74 Ga0097620_100017454 3300006931 Bacteria 7214
75 Ga0097620_100101494 3300006931 Bacteria 2934
76 Ga0097620_100110251 3300006931 Bacteria 2814
77 Ga0097620_100207732 3300006931 Bacteria 2044
78 Ga0075435_100058505 3300007076 Bacteria 3122
79 Ga0075435_100252771 3300007076 Bacteria 1500
80 Ga0075435_100264849 3300007076 Bacteria 1465
81 Ga0099794_10059954 3300007265 Bacteria 1847
82 Ga0105240_10001547 3300009093 Bacteria 39045
83 Ga0105240_10001672 3300009093 Bacteria 37648
84 Ga0105240_10021839 3300009093 Bacteria 8504
85 Ga0105240_10047605 3300009093 Bacteria 5425
86 Ga0105240_10071172 3300009093 Bacteria 4302
87 Ga0111539_10017564 3300009094 Bacteria 8853
88 Ga0111539_10235576 3300009094 Bacteria 2131
89 Ga0111539_10406804 3300009094 Bacteria 1585
90 Ga0105245_10001729 3300009098 Bacteria 19912
91 Ga0105247_10015658 3300009101 Bacteria 4540
92 Ga0114129_10015003 3300009147 Bacteria 11031
93 Ga0114129_10024730 3300009147 Bacteria 8514
94 Ga0114129_10047492 3300009147 Bacteria 6031
95 Ga0114129_10468481 3300009147 Bacteria 1650
96 Ga0105243_10229334 3300009148 Bacteria 1647
97 Ga0105241_10156999 3300009174 Bacteria 1866
98 Ga0105242_10030016 3300009176 Bacteria 4340
99 Ga0105248_10002143 3300009177 Bacteria 21826
100 Ga0105248_10068027 3300009177 Bacteria 3999
101 Ga0105248_10182595 3300009177 Bacteria 2364
102 Ga0105237_10000083 3300009545 Bacteria 127032
103 Ga0105237_10000430 3300009545 Bacteria 59639
104 Ga0105237_10001273 3300009545 Bacteria 33627
105 Ga0105237_10011191 3300009545 Bacteria 9509
106 Ga0105237_10105085 3300009545 Bacteria 2815
107 Ga0105238_10052307 3300009551 Bacteria 4105
108 Ga0105239_10000779 3300010375 Bacteria 45211
109 Ga0157372_10003291 3300013307 Bacteria 17452
110 Ga0157375_10004498 3300013308 Bacteria 12120
111 Ga0157375_10063395 3300013308 Bacteria 3677
112 Ga0163163_10000002 3300014325 Bacteria 609846
113 Ga0163163_10116733 3300014325 Bacteria 2700
114 Ga0163163_10160897 3300014325 Bacteria 2291
115 Ga0157380_10180251 3300014326 Bacteria 1855
116 Ga0157377_10042066 3300014745 Bacteria 2537
117 Ga0157379_10017446 3300014968 Bacteria 6321
118 Ga0157379_10138180 3300014968 Bacteria 2196
119 Ga0182006_1000664 3300015261 Bacteria 24129
120 Ga0182005_1001098 3300015265 Bacteria 11318
121 Ga0163161_10015490 3300017792 Bacteria 5316
122 Ga0206350_10485993 3300020080 Bacteria 3114
123 Ga0214544_1013066 3300021320 Bacteria 10341
124 Ga0214542_1012973 3300021321 Bacteria 10342
125 Ga0214545_1012971 3300021324 Bacteria 10591
126 Ga0214543_1013381 3300021327 Bacteria 10338
127 Ga0213874_10000524 3300021377 Bacteria 7705
128 Ga0224712_10005552 3300022467 Bacteria 3525
129 Ga0224712_10011780 3300022467 Bacteria 2726
130 Ga0207656_10001996 3300025321 Bacteria 6801
131 Ga0207653_10016146 3300025885 Bacteria 2344
132 Ga0207692_10028489 3300025898 Bacteria 2642
133 Ga0207710_10004694 3300025900 Bacteria 5930
134 Ga0207685_10011565 3300025905 Bacteria 2659
135 Ga0207699_10042540 3300025906 Bacteria 2633
136 Ga0207695_10001549 3300025913 Bacteria 37807
137 Ga0207695_10040838 3300025913 Bacteria 4969
138 Ga0207695_10072150 3300025913 Bacteria 3524
139 Ga0207671_10000523 3300025914 Bacteria 51846
140 Ga0207671_10001490 3300025914 Bacteria 27010
141 Ga0207671_10011937 3300025914 Bacteria 7023
142 Ga0207671_10012336 3300025914 Bacteria 6877
143 Ga0207693_10002115 3300025915 Bacteria 17334
144 Ga0207693_10002799 3300025915 Bacteria 15116
145 Ga0207663_10017628 3300025916 Bacteria 3984
146 Ga0207660_10143374 3300025917 Bacteria 1828
147 Ga0207646_10075197 3300025922 Bacteria 3018
148 Ga0207694_10084618 3300025924 Bacteria 2495
149 Ga0207650_10068768 3300025925 Bacteria 2660
150 Ga0207687_10000962 3300025927 Bacteria 19591
151 Ga0207700_10283147 3300025928 Bacteria 1426
152 Ga0207665_10000135 3300025939 Bacteria 49000
153 Ga0207665_10030362 3300025939 Bacteria 3570
154 Ga0207665_10033933 3300025939 Bacteria 3385
155 Ga0207691_10152606 3300025940 Bacteria 2030
156 Ga0207691_10195396 3300025940 Bacteria 1763
157 Ga0207711_10006664 3300025941 Bacteria 9722
158 Ga0207711_10307799 3300025941 Bacteria 1462
159 Ga0207661_10003577 3300025944 Bacteria 10809
160 Ga0207667_10002926 3300025949 Bacteria 21201
161 Ga0207651_10023460 3300025960 Bacteria 3796
162 Ga0207712_10179677 3300025961 Bacteria 1661
163 Ga0207668_10010664 3300025972 Bacteria 5561
164 Ga0207708_10000366 3300026075 Bacteria 35298
165 Ga0207641_10043441 3300026088 Bacteria 3775
166 Ga0207641_10095642 3300026088 Bacteria 2608
167 Ga0207641_10297811 3300026088 Bacteria 1523
168 Ga0207641_10343896 3300026088 Bacteria 1420
169 Ga0207648_10007065 3300026089 Bacteria 11084
170 Ga0207675_100042651 3300026118 Bacteria 4236
171 Ga0207683_10171177 3300026121 Bacteria 1967
172 Ga0207428_10016411 3300027907 Bacteria 6371
173 Ga0207428_10018498 3300027907 Bacteria 5948
174 Ga0268266_10000001 3300028379 Bacteria 4040580
175 Ga0268266_10081062 3300028379 Bacteria 2828
176 Ga0268266_10226502 3300028379 Bacteria 1720
177 Ga0268264_10014860 3300028381 Bacteria 6393
178 Ga0268264_10049335 3300028381 Bacteria 3502
179 Ga0307515_10050170 3300028794 Bacteria 6256
180 Ga0265338_10055134 3300028800 Bacteria 3538
181 Ga0265338_10058058 3300028800 Bacteria 3419
182 Ga0265338_10100489 3300028800 Bacteria 2359
183 Ga0265762_1000713 3300030760 Bacteria 5886
184 Ga0265325_10009962 3300031241 Bacteria 5525
185 Ga0265340_10033281 3300031247 Bacteria 2567
186 Ga0265327_10000539 3300031251 Bacteria 64832
187 Ga0265316_10023756 3300031344 Bacteria 5147
188 Ga0307513_10291645 3300031456 Bacteria 1403
189 Ga0307516_10002759 3300031730 Bacteria 23156
190 Ga0307516_10003200 3300031730 Bacteria 21277
191 Ga0307405_10111904 3300031731 Bacteria 1851
192 Ga0307410_10015366 3300031852 Bacteria 4538
193 Ga0307410_10069624 3300031852 Bacteria 2434
194 Ga0307406_10006436 3300031901 Bacteria 6483
195 Ga0307412_10023748 3300031911 Bacteria 3777
196 Ga0307412_10040751 3300031911 Bacteria 3006
197 Ga0307416_100007314 3300032002 Bacteria 7006
198 Ga0307416_100061335 3300032002 Bacteria 3068
199 Ga0307414_10010957 3300032004 Bacteria 5295
200 Ga0307411_10030222 3300032005 Bacteria 3319
201 Ga0307415_100009417 3300032126 Bacteria 5474
202 Ga0307510_10001159 3300033180 Bacteria 28372
203 Ga0373934_0002824 3300035086 Bacteria 6363
204 Ga0373923_0012750 3300035111 Bacteria 3117
205 Ga0373953_0001046 3300035117 Bacteria 7838
206 Ga0373954_0025806 3300035118 Bacteria 2690
207 Ga0373956_0005038 3300035119 Bacteria 5294
208 Ga0373957_0006578 3300035120 Bacteria 3670
209 Ga0373955_0004854 3300035172 Bacteria 5995
210 Ga0373955_0019412 3300035172 Bacteria 3397
211 Ga0373955_0021528 3300035172 Bacteria 3256
212 Ga0373924_0006217 3300035410 Bacteria 4270
213 Ga0373931_0060304 3300035691 Bacteria 2042
214 Ga0373935_0057810 3300035692 Bacteria 2475
215 Ga0373935_0088099 3300035692 Bacteria 2028
216 Ga0373927_0054041 3300035695 Bacteria 2598
217 Ga0373933_0003562 3300035724 Bacteria 8651
218 Ga0373933_0004772 3300035724 Bacteria 7409
219 Ga0373937_0018743 3300036401 Bacteria 6185
220 Ga0395905_0216928 3300037471 Bacteria 1791
221 Ga0436365_1855810 3300039437 Bacteria 52011
222 Ga0436363_0331733 3300039450 Bacteria 7419
223 Ga0439436_0000001 3300041404 Bacteria 299341
224 Ga0439465_0002335 3300041413 Bacteria 6220
225 Ga0439449_0019350 3300042007 Bacteria 2552
226 Ga0495617_000019 3300046452 Bacteria 247938
227 Ga0495617_013316 3300046452 Bacteria 2797
228 Ga0495592_0010172 3300046454 Bacteria 7092
229 Ga0495592_0036960 3300046454 Bacteria 3676
230 Ga0495638_0000311 3300046460 Bacteria 62620
231 Ga0495651_0020168 3300046462 Bacteria 5174
232 Ga0495653_0022255 3300046463 Bacteria 5131
233 Ga0495650_0003338 3300046471 Bacteria 11824
234 Ga0495650_0037310 3300046471 Bacteria 2117
235 Ga0495584_0000515 3300046491 Bacteria 26425
236 Ga0495585_0000001 3300046492 Bacteria 609804
237 Ga0495585_0009116 3300046492 Bacteria 5975
238 Ga0495607_0000263 3300046501 Bacteria 56351
239 Ga0495606_0000097 3300046507 Bacteria 151339
240 Ga0495606_0001761 3300046507 Bacteria 27728
241 Ga0495608_0001166 3300046511 Bacteria 18615
242 Ga0495610_0008289 3300046512 Bacteria 6750
243 Ga0495616_0000001 3300046513 Bacteria 780061
244 Ga0495618_0026616 3300046514 Bacteria 3598
245 Ga0495620_0000183 3300046515 Bacteria 48275
246 Ga0495620_0007636 3300046515 Bacteria 5855
247 Ga0495628_0061902 3300046516 Bacteria 2934
248 Ga0495630_0068547 3300046517 Bacteria 2668
249 Ga0495631_0000306 3300046518 Bacteria 33967
250 Ga0495631_0000392 3300046518 Bacteria 30178
251 Ga0495637_0019807 3300046520 Bacteria 3105
252 Ga0495644_0016334 3300046523 Bacteria 2841
253 Ga0495648_0000651 3300046524 Bacteria 37060
254 Ga0495652_0010023 3300046529 Bacteria 8586
255 Ga0495652_0102643 3300046529 Bacteria 2316
256 Ga0495665_0037731 3300046531 Bacteria 2578
257 Ga0495587_0001403 3300046536 Bacteria 16023
258 Ga0495587_0001524 3300046536 Bacteria 15406
259 Ga0495609_0010081 3300046538 Bacteria 4548
260 Ga0495597_0004445 3300046542 Bacteria 7703
261 Ga0495622_0014719 3300046557 Bacteria 3633
262 Ga0495622_0094441 3300046557 Bacteria 1373
263 Ga0495667_0025639 3300046559 Bacteria 3972
264 Ga0495668_0013618 3300046616 Bacteria 4790
265 Ga0495611_0000001 3300046648 Bacteria 2628469
266 Ga0495611_0000008 3300046648 Bacteria 218134
267 Ga0495625_0000001 3300046660 Bacteria 1641829
268 Ga0495625_0039407 3300046660 Bacteria 3450
269 Ga0495625_0041588 3300046660 Bacteria 3345
270 Ga0495625_0086071 3300046660 Bacteria 2180
271 Ga0495635_0005960 3300046663 Bacteria 8502
272 Ga0495635_0053820 3300046663 Bacteria 2772
273 Ga0495661_0011344 3300046665 Bacteria 6048
274 Ga0495657_0008402 3300046675 Bacteria 7902
275 Ga0495657_0009144 3300046675 Bacteria 7527
276 Ga0495599_0014730 3300046678 Bacteria 4842
277 Ga0495623_0001294 3300046679 Bacteria 16987
278 Ga0495623_0025889 3300046679 Bacteria 3778
279 Ga0495646_0021835 3300046680 Bacteria 4042
280 Ga0495670_0000499 3300046691 Bacteria 18595
281 Ga0495670_0005574 3300046691 Bacteria 6178
282 Ga0495670_0006152 3300046691 Bacteria 5894
283 Ga0495671_0000642 3300046692 Bacteria 25413
284 Ga0495649_0092848 3300046694 Bacteria 1607
285 Ga0495600_0008267 3300046809 Bacteria 6388
286 Ga0495600_0052034 3300046809 Bacteria 2673
287 Ga0495660_0000008 3300046810 Bacteria 435769
288 Ga0495604_0004956 3300047317 Bacteria 10553
289 Ga0495604_0033042 3300047317 Bacteria 4096
290 Ga0495674_0001195 3300047319 Bacteria 25101
291 Ga0495674_0025264 3300047319 Bacteria 5449
292 Ga0495674_0085712 3300047319 Bacteria 2698
293 Ga0495674_0113977 3300047319 Bacteria 2289
294 Ga0495676_0099875 3300047321 Bacteria 2150
295 Ga0495680_0001745 3300047322 Bacteria 23075
296 Ga0495683_0002575 3300047323 Bacteria 10891
297 Ga0495687_010554 3300047443 Bacteria 5058
298 Ga0495679_000001 3300047446 Bacteria 1607568
299 Ga0495673_0000030 3300047469 Bacteria 468915
300 Ga0495673_0001339 3300047469 Bacteria 20004
301 Ga0495684_0098059 3300047471 Bacteria 2216
302 Ga0495684_0122525 3300047471 Bacteria 1957
303 Ga0495686_0000077 3300047472 Bacteria 205924
304 Ga0495686_0000984 3300047472 Bacteria 34829
305 Ga0495686_0003937 3300047472 Bacteria 12491
306 Ga0495593_0013818 3300047673 Bacteria 4599
307 Ga0495602_0004451 3300048088 Bacteria 14620
308 Ga0495602_0012903 3300048088 Bacteria 8562
309 Ga0495602_0018615 3300048088 Bacteria 6927
310 Ga0496106_0000005 3300048909 Bacteria 273394
311 Ga0496106_0000519 3300048909 Bacteria 27358
312 Ga0496106_0146687 3300048909 Bacteria 1859
313 Ga0496107_0233718 3300048910 Bacteria 1368
314 Ga0496109_0047214 3300048912 Bacteria 3915
315 Ga0496109_0114559 3300048912 Bacteria 2508
316 Ga0496111_0070309 3300048914 Bacteria 2546
317 Ga0496112_0000528 3300048915 Bacteria 26103
318 Ga0496112_0019964 3300048915 Bacteria 6341
319 Ga0496112_0066829 3300048915 Bacteria 3548
320 Ga0496112_0082018 3300048915 Bacteria 3189
321 Ga0496112_0170284 3300048915 Bacteria 2143
322 Ga0496113_0045164 3300048916 Bacteria 3266
323 Ga0496114_0056011 3300048917 Bacteria 3289
324 Ga0496119_0044629 3300048922 Bacteria 2788
325 Ga0496120_0094718 3300048923 Bacteria 1589
326 Ga0496121_0000083 3300048924 Bacteria 226816
327 Ga0496121_0001280 3300048924 Bacteria 43316
328 Ga0496122_0013403 3300048925 Bacteria 8028
329 Ga0496123_0011515 3300048926 Bacteria 7662
330 Ga0496125_0000343 3300048928 Bacteria 88790
331 Ga0495678_000023 3300049459 Bacteria 233463
332 Ga0501038_0000563 3300049574 Bacteria 32838
333 Ga0501067_0001920 3300049583 Bacteria 11419
334 Ga0501073_0017609 3300049589 Bacteria 5174
335 Ga0501198_003510 3300049649 Bacteria 2145
336 Ga0501202_001192 3300049652 Bacteria 4092
337 Ga0501209_018691 3300049656 Bacteria 1606
338 Ga0501217_001738 3300049661 Bacteria 4158
339 Ga0501223_000438 3300049663 Bacteria 10055
340 Ga0501224_001946 3300049664 Bacteria 2788
341 Ga0501227_000957 3300049665 Bacteria 6346
342 Ga0501221_013783 3300049704 Bacteria 1492
343 Ga0501225_0002857 3300049705 Bacteria 5299
344 Ga0501225_0017378 3300049705 Bacteria 1996
345 Ga0501229_004158 3300049706 Bacteria 1754
346 Ga0501212_003911 3300049851 Bacteria 1893
347 Ga0501226_001535 3300049853 Bacteria 2941
348 nmdc:mga00v17_32484_c1 3300050491 Bacteria 3085
349 nmdc:mga05p37_23731_c1 3300050507 Bacteria 7448
350 nmdc:mga05p37_76289_c1 3300050507 Bacteria 4127
351 nmdc:mga09592_3558_c1 3300050508 Bacteria 12581
352 nmdc:mga09592_36330_c1 3300050508 Bacteria 4125
353 nmdc:mga0qj67_23966_c1 3300050509 Bacteria 4701
354 nmdc:mga0qj67_49853_c1 3300050509 Bacteria 3309
355 nmdc:mga06r32_255723_c1 3300050510 Bacteria 1739
356 nmdc:mga06r32_292763_c1 3300050510 Bacteria 1615
357 nmdc:mga06r32_48962_c1 3300050510 Bacteria 4042
358 nmdc:mga06r32_7195_c1 3300050510 Bacteria 10029
359 nmdc:mga08y16_15510_c1 3300050511 Bacteria 8011
360 nmdc:mga08y16_215541_c1 3300050511 Bacteria 1988
361 nmdc:mga08y16_23502_c1 3300050511 Bacteria 6513
362 nmdc:mga08y16_312734_c1 3300050511 Bacteria 1618
363 nmdc:mga08y16_72571_c1 3300050511 Bacteria 3587
364 nmdc:mga0a205_29676_c1 3300050515 Bacteria 5234
365 Ga0495601_0015650 3300053077 Bacteria 4585
366 Ga0495612_0018978 3300053078 Bacteria 2752
367 Ga0495595_0004431 3300053084 Bacteria 5650
368 Ga0495619_0003375 3300053085 Bacteria 10323
369 Ga0495619_0008427 3300053085 Bacteria 6517
370 Ga0500643_000002 3300053087 Bacteria 1277657
371 Ga0500583_0036732 3300053092 Bacteria 2196
372 Ga0500583_0059172 3300053092 Bacteria 1804
373 Ga0500566_0013238 3300053094 Bacteria 4859
374 Ga0500555_000054 3300053103 Bacteria 58599
375 Ga0500569_001448 3300053109 Bacteria 4487
376 Ga0500595_003021 3300053119 Bacteria 8008
377 Ga0500595_003558 3300053119 Bacteria 7238
378 Ga0500614_000610 3300053123 Bacteria 9135
379 Ga0500559_0015978 3300053136 Bacteria 3169
380 Ga0500619_026775 3300053154 Bacteria 1720
381 Ga0500620_010758 3300053155 Bacteria 2425
382 Ga0500637_0012311 3300053178 Bacteria 4454
383 Ga0500611_000037 3300053727 Bacteria 72513
384 Ga0500645_000772 3300053730 Bacteria 19418
385 Ga0500645_000923 3300053730 Bacteria 16914
386 Ga0590077_013237 3300059426 Bacteria 1715
387 Ga0466962_0045498 3300061719 Bacteria 2098
388 2617375742 2617270741 Bacteria 8201522
389 2692320323 2690316117 Bacteria 6800650
390 2721027559 2718218334 Bacteria 4765486
391 2735836874 2734482264 Unclassified 5014763
392 2739226281 2738543009 Bacteria 4944499
393 2776285050 2775506904 Bacteria 5954060
394 2824736635 2824732956 Bacteria 7810675
395 2842919200 2842918807 Bacteria 4289178
396 2847424085 2847417321 Bacteria 6913799
397 2894239421 2894232714 Bacteria 8834183
398 2919455342 2919450847 Bacteria 5631160
399 2919455863 2919450847 Bacteria 5631160
400 2929205811 2929199973 Bacteria 7260745
401 2953994514 2953994433 Bacteria 4303959
402 Ga0496108_0019079
403 JGI24738J21930_10000899
404 JGI25404J52841_10004519
405 Ga0058859_11710732
406 Ga0065715_10157251
407 Ga0070683_100075528
408 Ga0070670_100089415
409 Ga0070680_100185588
410 Ga0070682_100006973
411 Ga0070689_100158118
412 Ga0070689_100265801
413 Ga0070692_10016825
414 Ga0070668_100007409
415 Ga0070675_100002161
416 Ga0070671_100069952
417 Ga0070671_100096112
418 Ga0070673_100021992
419 Ga0070703_10003679
420 Ga0070709_10053674
421 Ga0070705_100006389
422 Ga0070700_100000272
423 Ga0070694_100001097
424 Ga0070694_100012875
425 Ga0068867_100013024
426 Ga0070706_100204932
427 Ga0070698_100021862
428 Ga0070699_100142865
429 Ga0070679_100029348
430 Ga0070679_100057810
431 Ga0070679_100140719
432 Ga0070684_100001808
433 Ga0070697_100002301
434 Ga0070697_100038759
435 Ga0070697_100081562
436 Ga0068853_100021762
437 Ga0070672_100164083
438 Ga0070695_100059027
439 Ga0070696_100095468
440 Ga0070693_100014696
441 Ga0070665_100000182
442 Ga0070665_100113826
443 Ga0070665_100277256
444 Ga0070704_100048651
445 Ga0068855_100000583
446 Ga0070664_100006247
447 Ga0070702_100019528
448 Ga0070702_100099177
449 Ga0068859_100017455
450 Ga0068859_100110248
451 Ga0068859_100207724
452 Ga0068864_100033765
453 Ga0068851_10032707
454 Ga0068860_100002303
455 Ga0081540_1008188
456 Ga0081540_1032866
457 Ga0081539_10009409
458 Ga0075364_10042925
459 Ga0070715_10024723
460 Ga0070716_100005168
461 Ga0070712_100001541
462 Ga0070712_100028939
463 Ga0097621_100195626
464 Ga0075428_100033553
465 Ga0075428_100037226
466 Ga0075430_100010014
467 Ga0075430_100043666
468 Ga0075431_100003335
469 Ga0075431_100039637
470 Ga0075431_100067246
471 Ga0075431_100068757
472 Ga0075431_100142952
473 Ga0075429_100018621
474 Ga0068865_100011412
475 Ga0097620_100017454
476 Ga0097620_100101494
477 Ga0097620_100110251
478 Ga0097620_100207732
479 Ga0075435_100058505
480 Ga0075435_100252771
481 Ga0075435_100264849
482 Ga0099794_10059954
483 Ga0105240_10001547
484 Ga0105240_10001672
485 Ga0105240_10021839
486 Ga0105240_10047605
487 Ga0105240_10071172
488 Ga0111539_10017564
489 Ga0111539_10235576
490 Ga0111539_10406804
491 Ga0105245_10001729
492 Ga0105247_10015658
493 Ga0114129_10015003
494 Ga0114129_10024730
495 Ga0114129_10047492
496 Ga0114129_10468481
497 Ga0105243_10229334
498 Ga0105241_10156999
499 Ga0105242_10030016
500 Ga0105248_10002143
501 Ga0105248_10068027
502 Ga0105248_10182595
503 Ga0105237_10000083
504 Ga0105237_10000430
505 Ga0105237_10001273
506 Ga0105237_10011191
507 Ga0105237_10105085
508 Ga0105238_10052307
509 Ga0105239_10000779
510 Ga0157372_10003291
511 Ga0157375_10004498
512 Ga0157375_10063395
513 Ga0163163_10000002
514 Ga0163163_10116733
515 Ga0163163_10160897
516 Ga0157380_10180251
517 Ga0157377_10042066
518 Ga0157379_10017446
519 Ga0157379_10138180
520 Ga0182006_1000664
521 Ga0182005_1001098
522 Ga0163161_10015490
523 Ga0206350_10485993
524 Ga0214544_1013066
525 Ga0214542_1012973
526 Ga0214545_1012971
527 Ga0214543_1013381
528 Ga0213874_10000524
529 Ga0224712_10005552
530 Ga0224712_10011780
531 Ga0207656_10001996
532 Ga0207653_10016146
533 Ga0207692_10028489
534 Ga0207710_10004694
535 Ga0207685_10011565
536 Ga0207699_10042540
537 Ga0207695_10001549
538 Ga0207695_10040838
539 Ga0207695_10072150
540 Ga0207671_10000523
541 Ga0207671_10001490
542 Ga0207671_10011937
543 Ga0207671_10012336
544 Ga0207693_10002115
545 Ga0207693_10002799
546 Ga0207663_10017628
547 Ga0207660_10143374
548 Ga0207646_10075197
549 Ga0207694_10084618
550 Ga0207650_10068768
551 Ga0207687_10000962
552 Ga0207700_10283147
553 Ga0207665_10000135
554 Ga0207665_10030362
555 Ga0207665_10033933
556 Ga0207691_10152606
557 Ga0207691_10195396
558 Ga0207711_10006664
559 Ga0207711_10307799
560 Ga0207661_10003577
561 Ga0207667_10002926
562 Ga0207651_10023460
563 Ga0207712_10179677
564 Ga0207668_10010664
565 Ga0207708_10000366
566 Ga0207641_10043441
567 Ga0207641_10095642
568 Ga0207641_10297811
569 Ga0207641_10343896
570 Ga0207648_10007065
571 Ga0207675_100042651
572 Ga0207683_10171177
573 Ga0207428_10016411
574 Ga0207428_10018498
575 Ga0268266_10000001
576 Ga0268266_10081062
577 Ga0268266_10226502
578 Ga0268264_10014860
579 Ga0268264_10049335
580 Ga0307515_10050170
581 Ga0265338_10055134
582 Ga0265338_10058058
583 Ga0265338_10100489
584 Ga0265762_1000713
585 Ga0265325_10009962
586 Ga0265340_10033281
587 Ga0265327_10000539
588 Ga0265316_10023756
589 Ga0307513_10291645
590 Ga0307516_10002759
591 Ga0307516_10003200
592 Ga0307405_10111904
593 Ga0307410_10015366
594 Ga0307410_10069624
595 Ga0307406_10006436
596 Ga0307412_10023748
597 Ga0307412_10040751
598 Ga0307416_100007314
599 Ga0307416_100061335
600 Ga0307414_10010957
601 Ga0307411_10030222
602 Ga0307415_100009417
603 Ga0307510_10001159
604 Ga0373934_0002824
605 Ga0373923_0012750
606 Ga0373953_0001046
607 Ga0373954_0025806
608 Ga0373956_0005038
609 Ga0373957_0006578
610 Ga0373955_0004854
611 Ga0373955_0019412
612 Ga0373955_0021528
613 Ga0373924_0006217
614 Ga0373931_0060304
615 Ga0373935_0057810
616 Ga0373935_0088099
617 Ga0373927_0054041
618 Ga0373933_0003562
619 Ga0373933_0004772
620 Ga0373937_0018743
621 Ga0395905_0216928
622 Ga0436365_1855810
623 Ga0436363_0331733
624 Ga0439436_0000001
625 Ga0439465_0002335
626 Ga0439449_0019350
627 Ga0495617_000019
628 Ga0495617_013316
629 Ga0495592_0010172
630 Ga0495592_0036960
631 Ga0495638_0000311
632 Ga0495651_0020168
633 Ga0495653_0022255
634 Ga0495650_0003338
635 Ga0495650_0037310
636 Ga0495584_0000515
637 Ga0495585_0000001
638 Ga0495585_0009116
639 Ga0495607_0000263
640 Ga0495606_0000097
641 Ga0495606_0001761
642 Ga0495608_0001166
643 Ga0495610_0008289
644 Ga0495616_0000001
645 Ga0495618_0026616
646 Ga0495620_0000183
647 Ga0495620_0007636
648 Ga0495628_0061902
649 Ga0495630_0068547
650 Ga0495631_0000306
651 Ga0495631_0000392
652 Ga0495637_0019807
653 Ga0495644_0016334
654 Ga0495648_0000651
655 Ga0495652_0010023
656 Ga0495652_0102643
657 Ga0495665_0037731
658 Ga0495587_0001403
659 Ga0495587_0001524
660 Ga0495609_0010081
661 Ga0495597_0004445
662 Ga0495622_0014719
663 Ga0495622_0094441
664 Ga0495667_0025639
665 Ga0495668_0013618
666 Ga0495611_0000001
667 Ga0495611_0000008
668 Ga0495625_0000001
669 Ga0495625_0039407
670 Ga0495625_0041588
671 Ga0495625_0086071
672 Ga0495635_0005960
673 Ga0495635_0053820
674 Ga0495661_0011344
675 Ga0495657_0008402
676 Ga0495657_0009144
677 Ga0495599_0014730
678 Ga0495623_0001294
679 Ga0495623_0025889
680 Ga0495646_0021835
681 Ga0495670_0000499
682 Ga0495670_0005574
683 Ga0495670_0006152
684 Ga0495671_0000642
685 Ga0495649_0092848
686 Ga0495600_0008267
687 Ga0495600_0052034
688 Ga0495660_0000008
689 Ga0495604_0004956
690 Ga0495604_0033042
691 Ga0495674_0001195
692 Ga0495674_0025264
693 Ga0495674_0085712
694 Ga0495674_0113977
695 Ga0495676_0099875
696 Ga0495680_0001745
697 Ga0495683_0002575
698 Ga0495687_010554
699 Ga0495679_000001
700 Ga0495673_0000030
701 Ga0495673_0001339
702 Ga0495684_0098059
703 Ga0495684_0122525
704 Ga0495686_0000077
705 Ga0495686_0000984
706 Ga0495686_0003937
707 Ga0495593_0013818
708 Ga0495602_0004451
709 Ga0495602_0012903
710 Ga0495602_0018615
711 Ga0496106_0000005
712 Ga0496106_0000519
713 Ga0496106_0146687
714 Ga0496107_0233718
715 Ga0496109_0047214
716 Ga0496109_0114559
717 Ga0496111_0070309
718 Ga0496112_0000528
719 Ga0496112_0019964
720 Ga0496112_0066829
721 Ga0496112_0082018
722 Ga0496112_0170284
723 Ga0496113_0045164
724 Ga0496114_0056011
725 Ga0496119_0044629
726 Ga0496120_0094718
727 Ga0496121_0000083
728 Ga0496121_0001280
729 Ga0496122_0013403
730 Ga0496123_0011515
731 Ga0496125_0000343
732 Ga0495678_000023
733 Ga0501038_0000563
734 Ga0501067_0001920
735 Ga0501073_0017609
736 Ga0501198_003510
737 Ga0501202_001192
738 Ga0501209_018691
739 Ga0501217_001738
740 Ga0501223_000438
741 Ga0501224_001946
742 Ga0501227_000957
743 Ga0501221_013783
744 Ga0501225_0002857
745 Ga0501225_0017378
746 Ga0501229_004158
747 Ga0501212_003911
748 Ga0501226_001535
749 nmdc:mga00v17_32484_c1
750 nmdc:mga05p37_23731_c1
751 nmdc:mga05p37_76289_c1
752 nmdc:mga09592_3558_c1
753 nmdc:mga09592_36330_c1
754 nmdc:mga0qj67_23966_c1
755 nmdc:mga0qj67_49853_c1
756 nmdc:mga06r32_255723_c1
757 nmdc:mga06r32_292763_c1
758 nmdc:mga06r32_48962_c1
759 nmdc:mga06r32_7195_c1
760 nmdc:mga08y16_15510_c1
761 nmdc:mga08y16_215541_c1
762 nmdc:mga08y16_23502_c1
763 nmdc:mga08y16_312734_c1
764 nmdc:mga08y16_72571_c1
765 nmdc:mga0a205_29676_c1
766 Ga0495601_0015650
767 Ga0495612_0018978
768 Ga0495595_0004431
769 Ga0495619_0003375
770 Ga0495619_0008427
771 Ga0500643_000002
772 Ga0500583_0036732
773 Ga0500583_0059172
774 Ga0500566_0013238
775 Ga0500555_000054
776 Ga0500569_001448
777 Ga0500595_003021
778 Ga0500595_003558
779 Ga0500614_000610
780 Ga0500559_0015978
781 Ga0500619_026775
782 Ga0500620_010758
783 Ga0500637_0012311
784 Ga0500611_000037
785 Ga0500645_000772
786 Ga0500645_000923
787 Ga0590077_013237
788 Ga0466962_0045498
789 2617375742
790 2692320323
791 2721027559
792 2735836874
793 2739226281
794 2776285050
795 2824736635
796 2842919200
797 2847424085
798 2894239421
799 2919455342
800 2919455863
801 2929205811
802 2953994514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06441

EHN

Epoxide hydrolase N terminus

39

145

0.96

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

131

278

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.9094 37 425
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.9002 37 425
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.8953 36 425
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.8842 36 425
3g0i-assembly1.cif.gz_B complex of aspergillus niger epoxide hydrolase with valpromide (2-propylpentanamide) 0.8836 31 423
ID Description Score Start End Superfamily
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8953 36 425 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8878 37 425 3.40.50.1820
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8842 36 425 3.40.50.1820
af_Q23068_49_452_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8766 37 423 3.40.50.1820
4qlaB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.876 30 425 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6S7BQI6-F1-model_v4 Epoxide hydrolase 0.9954 235 423 GO:0004301
GO:0097176
AF-A0A3D9RJX7-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9892 197 423 GO:0004301
GO:0097176
AF-A0A526YHX5-F1-model_v4 Alpha/beta hydrolase 0.9888 152 287 GO:0004301
GO:0097176
AF-A0A2V9HKC8-F1-model_v4 Multidrug MFS transporter 0.9874 36 422 GO:0004301
GO:0009056
GO:0097176
AF-A0A2V8PGR5-F1-model_v4 Multidrug MFS transporter 0.9869 167 425 GO:0004301
GO:0097176

Map