F435204

General Info

Members Datasets Scaffolds Average Seq Length
402 228 804 313

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0309162|Ga0496112_0309162_302_1456
Length 377
Sequence VVILIGPIDYVDPFLVVVLLRATGRGRVTEIYPEDAALNRGKSLPNPYRTVTSWIMDSVPSITDIVDRLHVVALPMRVKFRGITVRELALIDGPAGWGEFGPFLEYEPPEAAAWLASAIEAAYSPPPATRRDRIPINATVPAVAAADVSEVLARFPGARTAKVKVAEPGQTLADDVARVDAVRAQVPTVRVDANGGWTVAEAVDLEYVEQPCKTVNELAEVRRRVDVPIAADESIRKADDPLRVVRSGAADVAVLKVAPLGGVVKLLAIAGQIDVPVVVSSALDSAVGIGRGLLAAGALPELRHACGLGTGGLFVEDVAEPLAPVDGHLPVAXXXPDPARLAALAAPAVRRQWWIDRITACFASGRADLMAEQQERP

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
210 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
211 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
212 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
213 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
214 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
215 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
216 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
217 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
218 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
219 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
220 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
221 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
222 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
223 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
224 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
225 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
226 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
227 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
228 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 0
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 0.25
Rhizoplane 10.2
Rhizosphere 66.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0309162 3300048915 Bacteria 1526
2 JGI24745J21846_1001472 3300002073 Bacteria 2287
3 Ga0055540_1002190 3300003792 Bacteria 10621
4 Ga0055540_1005091 3300003792 Bacteria 5673
5 Ga0070676_10011575 3300005328 Bacteria 4799
6 Ga0068869_100082625 3300005334 Bacteria 2401
7 Ga0068868_100025069 3300005338 Bacteria 4530
8 Ga0070660_100267510 3300005339 Bacteria 1397
9 Ga0070689_100051999 3300005340 Bacteria 3168
10 Ga0070689_100115238 3300005340 Bacteria 2142
11 Ga0070691_10001512 3300005341 Bacteria 9995
12 Ga0070668_100004640 3300005347 Bacteria 10179
13 Ga0070668_100315502 3300005347 Bacteria 1315
14 Ga0070669_100046670 3300005353 Bacteria 3159
15 Ga0070669_100271751 3300005353 Bacteria 1356
16 Ga0070675_100107409 3300005354 Bacteria 2357
17 Ga0070674_100191150 3300005356 Bacteria 1575
18 Ga0070674_100210204 3300005356 Bacteria 1508
19 Ga0070688_100024322 3300005365 Bacteria 3573
20 Ga0070688_100044117 3300005365 Bacteria 2750
21 Ga0070667_100002436 3300005367 Bacteria 16263
22 Ga0070667_100003582 3300005367 Bacteria 13217
23 Ga0070667_100148935 3300005367 Bacteria 2054
24 Ga0070667_100161867 3300005367 Bacteria 1971
25 Ga0070667_100266824 3300005367 Bacteria 1534
26 Ga0070714_100054636 3300005435 Bacteria 3412
27 Ga0070714_100455264 3300005435 Bacteria 1216
28 Ga0070710_10003482 3300005437 Bacteria 7456
29 Ga0070710_10027940 3300005437 Bacteria 3013
30 Ga0070710_10045984 3300005437 Bacteria 2429
31 Ga0070701_10000600 3300005438 Bacteria 12563
32 Ga0070701_10042441 3300005438 Bacteria 2322
33 Ga0070711_100009565 3300005439 Bacteria 5976
34 Ga0070711_100017335 3300005439 Bacteria 4583
35 Ga0070705_100019193 3300005440 Bacteria 3596
36 Ga0070700_100008312 3300005441 Bacteria 5649
37 Ga0070700_100061418 3300005441 Bacteria 2371
38 Ga0070694_100010420 3300005444 Bacteria 5736
39 Ga0070678_100017347 3300005456 Bacteria 4632
40 Ga0070678_100094264 3300005456 Bacteria 2304
41 Ga0070662_100026450 3300005457 Bacteria 4019
42 Ga0070662_100052011 3300005457 Bacteria 2960
43 Ga0070685_10088422 3300005466 Bacteria 1871
44 Ga0070697_100206340 3300005536 Bacteria 1672
45 Ga0070696_100009345 3300005546 Bacteria 6564
46 Ga0070665_100002411 3300005548 Bacteria 20609
47 Ga0070665_100011442 3300005548 Bacteria 8971
48 Ga0070665_100060719 3300005548 Bacteria 3789
49 Ga0070704_100000382 3300005549 Bacteria 20196
50 Ga0070704_100150210 3300005549 Bacteria 1831
51 Ga0068855_100613282 3300005563 Bacteria 1172
52 Ga0068854_100010542 3300005578 Bacteria 5996
53 Ga0068856_100287197 3300005614 Bacteria 1662
54 Ga0068852_100074322 3300005616 Bacteria 2993
55 Ga0068859_100004954 3300005617 Bacteria 13524
56 Ga0068859_100008300 3300005617 Bacteria 10524
57 Ga0068859_100128989 3300005617 Bacteria 2599
58 Ga0068866_10026355 3300005718 Bacteria 2744
59 Ga0068861_100023872 3300005719 Bacteria 4416
60 Ga0068861_100026367 3300005719 Bacteria 4224
61 Ga0068861_100065257 3300005719 Bacteria 2804
62 Ga0068863_100001051 3300005841 Bacteria 27597
63 Ga0068863_100028819 3300005841 Bacteria 5302
64 Ga0068858_100005490 3300005842 Bacteria 12416
65 Ga0068858_100010799 3300005842 Bacteria 8632
66 Ga0068858_100038206 3300005842 Bacteria 4452
67 Ga0068860_100000186 3300005843 Bacteria 98982
68 Ga0068862_100005177 3300005844 Bacteria 10958
69 Ga0081455_10033007 3300005937 Bacteria 4656
70 Ga0075365_10003191 3300006038 Bacteria 8374
71 Ga0075365_10139039 3300006038 Bacteria 1685
72 Ga0075363_100011579 3300006048 Bacteria 4228
73 Ga0075363_100014457 3300006048 Bacteria 3858
74 Ga0075363_100053673 3300006048 Bacteria 2154
75 Ga0075363_100073913 3300006048 Bacteria 1855
76 Ga0075364_10008835 3300006051 Bacteria 6031
77 Ga0075364_10019392 3300006051 Bacteria 4268
78 Ga0075364_10034610 3300006051 Bacteria 3260
79 Ga0075364_10069478 3300006051 Bacteria 2318
80 Ga0075364_10076772 3300006051 Bacteria 2205
81 Ga0075364_10086276 3300006051 Bacteria 2079
82 Ga0075364_10090915 3300006051 Bacteria 2025
83 Ga0070715_10004739 3300006163 Bacteria 4496
84 Ga0070715_10022525 3300006163 Bacteria 2458
85 Ga0070716_100127742 3300006173 Bacteria 1602
86 Ga0070712_100026549 3300006175 Bacteria 3859
87 Ga0075367_10012769 3300006178 Bacteria 4492
88 Ga0075367_10029021 3300006178 Bacteria 3161
89 Ga0075367_10044105 3300006178 Bacteria 2613
90 Ga0075367_10069538 3300006178 Bacteria 2114
91 Ga0075369_10006423 3300006186 Bacteria 4442
92 Ga0075369_10007818 3300006186 Bacteria 4090
93 Ga0075369_10008698 3300006186 Bacteria 3919
94 Ga0075369_10027977 3300006186 Bacteria 2360
95 Ga0075369_10036934 3300006186 Bacteria 2080
96 Ga0075369_10052227 3300006186 Bacteria 1772
97 Ga0075369_10054129 3300006186 Bacteria 1742
98 Ga0075369_10094724 3300006186 Bacteria 1335
99 Ga0075370_10000392 3300006353 Bacteria 16194
100 Ga0075370_10000398 3300006353 Bacteria 16078
101 Ga0075370_10016521 3300006353 Bacteria 3971
102 Ga0075428_100003662 3300006844 Bacteria 16848
103 Ga0075430_100051278 3300006846 Bacteria 3478
104 Ga0075431_100237855 3300006847 Bacteria 1853
105 Ga0068865_100040415 3300006881 Bacteria 3169
106 Ga0097620_100004954 3300006931 Bacteria 13524
107 Ga0097620_100008300 3300006931 Bacteria 10524
108 Ga0097620_100128990 3300006931 Bacteria 2599
109 Ga0105250_10063368 3300009092 Bacteria 1488
110 Ga0111539_10371853 3300009094 Bacteria 1664
111 Ga0105245_10390394 3300009098 Bacteria 1388
112 Ga0105247_10000011 3300009101 Bacteria 296480
113 Ga0105247_10001208 3300009101 Bacteria 19156
114 Ga0114129_10010447 3300009147 Bacteria 13240
115 Ga0105243_10007397 3300009148 Bacteria 8442
116 Ga0105243_10183638 3300009148 Bacteria 1821
117 Ga0105241_10086620 3300009174 Bacteria 2464
118 Ga0105242_10000903 3300009176 Bacteria 23039
119 Ga0105248_10000370 3300009177 Bacteria 52274
120 Ga0105248_10001286 3300009177 Bacteria 27975
121 Ga0105248_10150548 3300009177 Bacteria 2625
122 Ga0105248_10160707 3300009177 Bacteria 2534
123 Ga0105237_10010308 3300009545 Bacteria 9956
124 Ga0105237_10041302 3300009545 Bacteria 4652
125 Ga0105238_10078383 3300009551 Bacteria 3294
126 Ga0105238_10501009 3300009551 Bacteria 1215
127 Ga0105249_10000091 3300009553 Bacteria 126848
128 Ga0105249_10001187 3300009553 Bacteria 22997
129 Ga0105249_10126070 3300009553 Bacteria 2438
130 Ga0105239_10005756 3300010375 Bacteria 14457
131 Ga0105239_10054794 3300010375 Bacteria 4374
132 Ga0105239_10084093 3300010375 Bacteria 3505
133 Ga0157374_10003373 3300013296 Bacteria 13421
134 Ga0157374_10018292 3300013296 Bacteria 6183
135 Ga0157378_10004710 3300013297 Bacteria 11960
136 Ga0163162_10009689 3300013306 Bacteria 9373
137 Ga0163162_10010156 3300013306 Bacteria 9146
138 Ga0163162_10052082 3300013306 Bacteria 4110
139 Ga0163162_10212057 3300013306 Bacteria 2066
140 Ga0163162_10277019 3300013306 Bacteria 1809
141 Ga0157375_10002646 3300013308 Bacteria 15514
142 Ga0163163_10146763 3300014325 Bacteria 2403
143 Ga0163163_10174249 3300014325 Bacteria 2198
144 Ga0163163_10186043 3300014325 Bacteria 2125
145 Ga0157380_10000852 3300014326 Bacteria 19115
146 Ga0157377_10081209 3300014745 Bacteria 1896
147 Ga0157379_10042829 3300014968 Bacteria 4042
148 Ga0157379_10198637 3300014968 Bacteria 1813
149 Ga0163161_10001083 3300017792 Bacteria 20625
150 Ga0213876_10003772 3300021384 Bacteria 8592
151 Ga0213876_10021975 3300021384 Bacteria 3374
152 Ga0213875_10083351 3300021388 Bacteria 1492
153 Ga0209673_1023930 3300025273 Bacteria 2065
154 Ga0209051_1001486 3300025303 Bacteria 19702
155 Ga0209051_1001501 3300025303 Bacteria 19492
156 Ga0209051_1006170 3300025303 Bacteria 6806
157 Ga0207642_10154235 3300025899 Bacteria 1226
158 Ga0207710_10000006 3300025900 Bacteria 538831
159 Ga0207710_10002947 3300025900 Bacteria 7716
160 Ga0207688_10000257 3300025901 Bacteria 24012
161 Ga0207688_10003529 3300025901 Bacteria 8536
162 Ga0207680_10292747 3300025903 Bacteria 1133
163 Ga0207685_10020357 3300025905 Bacteria 2204
164 Ga0207645_10014483 3300025907 Bacteria 5275
165 Ga0207671_10029885 3300025914 Bacteria 4066
166 Ga0207671_10121875 3300025914 Bacteria 1994
167 Ga0207693_10002924 3300025915 Bacteria 14781
168 Ga0207693_10003989 3300025915 Bacteria 12541
169 Ga0207663_10005625 3300025916 Bacteria 6333
170 Ga0207662_10098524 3300025918 Bacteria 1809
171 Ga0207681_10037501 3300025923 Bacteria 3204
172 Ga0207650_10256288 3300025925 Bacteria 1418
173 Ga0207687_10000655 3300025927 Bacteria 23309
174 Ga0207687_10221299 3300025927 Bacteria 1491
175 Ga0207664_10077745 3300025929 Bacteria 2690
176 Ga0207690_10167460 3300025932 Bacteria 1643
177 Ga0207706_10020242 3300025933 Bacteria 5980
178 Ga0207686_10036384 3300025934 Bacteria 2963
179 Ga0207709_10006201 3300025935 Bacteria 6733
180 Ga0207670_10083952 3300025936 Bacteria 2235
181 Ga0207669_10101938 3300025937 Bacteria 1900
182 Ga0207704_10001319 3300025938 Bacteria 11096
183 Ga0207665_10014294 3300025939 Bacteria 5227
184 Ga0207665_10078231 3300025939 Bacteria 2271
185 Ga0207691_10083992 3300025940 Bacteria 2859
186 Ga0207711_10000080 3300025941 Bacteria 103331
187 Ga0207711_10047265 3300025941 Bacteria 3679
188 Ga0207689_10005414 3300025942 Bacteria 11426
189 Ga0207689_10056750 3300025942 Bacteria 3222
190 Ga0207667_10527746 3300025949 Bacteria 1195
191 Ga0207712_10000061 3300025961 Bacteria 136114
192 Ga0207712_10032505 3300025961 Bacteria 3523
193 Ga0207668_10000619 3300025972 Bacteria 22096
194 Ga0207640_10005911 3300025981 Bacteria 6681
195 Ga0207658_10000123 3300025986 Bacteria 84341
196 Ga0207658_10006504 3300025986 Bacteria 7976
197 Ga0207658_10007674 3300025986 Bacteria 7346
198 Ga0207658_10326133 3300025986 Bacteria 1330
199 Ga0207658_10456590 3300025986 Bacteria 1132
200 Ga0207703_10016311 3300026035 Bacteria 5791
201 Ga0207703_10041709 3300026035 Bacteria 3679
202 Ga0207639_10047662 3300026041 Bacteria 3240
203 Ga0207639_10228456 3300026041 Bacteria 1611
204 Ga0207708_10004354 3300026075 Bacteria 10433
205 Ga0207641_10001081 3300026088 Bacteria 27425
206 Ga0207641_10070257 3300026088 Bacteria 3008
207 Ga0207648_10000555 3300026089 Bacteria 41800
208 Ga0207648_10066169 3300026089 Bacteria 3152
209 Ga0207676_10176010 3300026095 Bacteria 1869
210 Ga0207675_100000629 3300026118 Bacteria 34577
211 Ga0207675_100156307 3300026118 Bacteria 2173
212 Ga0207675_100196391 3300026118 Bacteria 1937
213 Ga0207683_10000731 3300026121 Bacteria 29866
214 Ga0268266_10007503 3300028379 Bacteria 9829
215 Ga0268266_10052066 3300028379 Bacteria 3515
216 Ga0268266_10225714 3300028379 Bacteria 1723
217 Ga0268265_10000005 3300028380 Bacteria 535350
218 Ga0268264_10000177 3300028381 Bacteria 135644
219 Ga0268264_10004312 3300028381 Bacteria 12141
220 Ga0265327_10000004 3300031251 Bacteria 803973
221 Ga0265327_10000624 3300031251 Bacteria 58153
222 Ga0265327_10069977 3300031251 Bacteria 1759
223 Ga0307410_10181571 3300031852 Bacteria 1593
224 Ga0307409_100142604 3300031995 Bacteria 2067
225 Ga0307416_100016759 3300032002 Bacteria 5105
226 Ga0307414_10072300 3300032004 Bacteria 2491
227 Ga0373960_0025318 3300035121 Bacteria 1612
228 Ga0373931_0003935 3300035691 Bacteria 6722
229 Ga0436364_0480641 3300037853 Bacteria 3688
230 Ga0436365_0479579 3300039437 Bacteria 3451
231 Ga0436363_1287738 3300039450 Bacteria 2013
232 Ga0439461_0000386 3300041410 Bacteria 6298
233 Ga0439461_0012365 3300041410 Bacteria 1596
234 Ga0439465_0007406 3300041413 Bacteria 3487
235 Ga0439465_0014618 3300041413 Bacteria 2447
236 Ga0439431_0020569 3300041997 Bacteria 1578
237 Ga0439445_0002610 3300042004 Bacteria 4016
238 Ga0439445_0013818 3300042004 Bacteria 1958
239 Ga0439434_0010573 3300042435 Bacteria 2721
240 Ga0466969_0136471 3300044656 Bacteria 1135
241 Ga0466972_0005393 3300044658 Bacteria 6405
242 Ga0466972_0012243 3300044658 Bacteria 4313
243 Ga0466972_0048718 3300044658 Bacteria 2047
244 Ga0466972_0062965 3300044658 Bacteria 1777
245 Ga0466965_0006134 3300044683 Bacteria 5436
246 Ga0466965_0083994 3300044683 Bacteria 1612
247 Ga0466965_0098083 3300044683 Bacteria 1496
248 Ga0466966_0010352 3300044684 Bacteria 6192
249 Ga0466966_0019196 3300044684 Bacteria 4499
250 Ga0466961_0023506 3300044693 Bacteria 3965
251 Ga0466961_0067585 3300044693 Bacteria 2270
252 Ga0466971_0030012 3300044719 Bacteria 2432
253 Ga0466968_0004719 3300044735 Bacteria 5105
254 Ga0466968_0050907 3300044735 Bacteria 1768
255 Ga0466970_0006698 3300044765 Bacteria 5764
256 Ga0466970_0008427 3300044765 Bacteria 5188
257 Ga0466957_0008603 3300044842 Bacteria 5808
258 Ga0466957_0022358 3300044842 Bacteria 3731
259 Ga0466957_0088537 3300044842 Bacteria 1937
260 Ga0466960_0000280 3300044901 Bacteria 17752
261 Ga0466960_0001080 3300044901 Bacteria 9786
262 Ga0466960_0006698 3300044901 Bacteria 4635
263 Ga0466959_0036266 3300045049 Bacteria 3643
264 Ga0466959_0225133 3300045049 Bacteria 1299
265 Ga0466958_0002178 3300045836 Bacteria 9764
266 Ga0466958_0041728 3300045836 Bacteria 2761
267 Ga0466967_0009166 3300045976 Bacteria 7323
268 Ga0466967_0044159 3300045976 Bacteria 3864
269 Ga0466967_0051874 3300045976 Bacteria 3597
270 Ga0495603_0091320 3300046455 Bacteria 1780
271 Ga0495638_0007103 3300046460 Bacteria 8075
272 Ga0495638_0052431 3300046460 Bacteria 2541
273 Ga0495582_0013040 3300046473 Bacteria 4577
274 Ga0495606_0027537 3300046507 Bacteria 4028
275 Ga0495667_0184579 3300046559 Bacteria 1338
276 Ga0495668_0117046 3300046616 Bacteria 1457
277 Ga0495658_0070150 3300046683 Bacteria 2033
278 Ga0495674_0087381 3300047319 Bacteria 2668
279 Ga0495672_0004283 3300047320 Bacteria 11776
280 Ga0495673_0000473 3300047469 Bacteria 43497
281 Ga0495593_0022679 3300047673 Bacteria 3494
282 Ga0496100_0001754 3300048903 Bacteria 10820
283 Ga0496100_0017857 3300048903 Bacteria 4197
284 Ga0496100_0206969 3300048903 Bacteria 1433
285 Ga0496101_0000014 3300048904 Bacteria 253487
286 Ga0496101_0014192 3300048904 Bacteria 5351
287 Ga0496101_0021563 3300048904 Bacteria 4427
288 Ga0496101_0037526 3300048904 Bacteria 3438
289 Ga0496102_0000003 3300048905 Bacteria 592263
290 Ga0496102_0001526 3300048905 Bacteria 20433
291 Ga0496102_0005358 3300048905 Bacteria 10891
292 Ga0496102_0011183 3300048905 Bacteria 7728
293 Ga0496102_0030570 3300048905 Bacteria 4821
294 Ga0496102_0052455 3300048905 Bacteria 3716
295 Ga0496103_0000012 3300048906 Bacteria 301778
296 Ga0496103_0001559 3300048906 Bacteria 15172
297 Ga0496103_0005146 3300048906 Bacteria 7871
298 Ga0496103_0109933 3300048906 Bacteria 1750
299 Ga0496104_0155188 3300048907 Bacteria 2197
300 Ga0496104_0217121 3300048907 Bacteria 1824
301 Ga0496105_0209809 3300048908 Bacteria 1588
302 Ga0496106_0000292 3300048909 Bacteria 35222
303 Ga0496106_0044293 3300048909 Bacteria 3340
304 Ga0496106_0059889 3300048909 Bacteria 2885
305 Ga0496106_0136669 3300048909 Bacteria 1926
306 Ga0496107_0000414 3300048910 Bacteria 23207
307 Ga0496107_0258241 3300048910 Bacteria 1296
308 Ga0496107_0261030 3300048910 Bacteria 1289
309 Ga0496108_0002588 3300048911 Bacteria 14492
310 Ga0496108_0056233 3300048911 Bacteria 3305
311 Ga0496109_0000816 3300048912 Bacteria 25973
312 Ga0496109_0029394 3300048912 Bacteria 4921
313 Ga0496109_0107662 3300048912 Bacteria 2590
314 Ga0496110_0507231 3300048913 Bacteria 1098
315 Ga0496112_0096707 3300048915 Bacteria 2923
316 Ga0496112_0128104 3300048915 Bacteria 2509
317 Ga0496112_0176480 3300048915 Bacteria 2101
318 Ga0496113_0076288 3300048916 Bacteria 2560
319 Ga0496113_0315028 3300048916 Bacteria 1254
320 Ga0496114_0009048 3300048917 Bacteria 7896
321 Ga0496114_0188001 3300048917 Bacteria 1806
322 Ga0496116_0000040 3300048919 Bacteria 346900
323 Ga0496117_0000003 3300048920 Bacteria 1881097
324 Ga0496117_0001183 3300048920 Bacteria 39206
325 Ga0496118_0000001 3300048921 Bacteria 1881100
326 Ga0496118_0007598 3300048921 Bacteria 11427
327 Ga0496120_0029174 3300048923 Bacteria 3370
328 Ga0496121_0000611 3300048924 Bacteria 66753
329 Ga0496121_0001471 3300048924 Bacteria 39662
330 Ga0496122_0052928 3300048925 Bacteria 3065
331 Ga0496123_0012284 3300048926 Bacteria 7318
332 Ga0496125_0054317 3300048928 Bacteria 3274
333 Ga0496126_0000567 3300048929 Bacteria 70888
334 Ga0496126_0001187 3300048929 Bacteria 42635
335 Ga0496126_0009834 3300048929 Bacteria 10122
336 Ga0496126_0182818 3300048929 Bacteria 1780
337 Ga0501032_0001399 3300049569 Bacteria 19177
338 Ga0501032_0057349 3300049569 Bacteria 2617
339 Ga0501033_0025590 3300049570 Bacteria 4446
340 Ga0501034_0020935 3300049571 Bacteria 6676
341 Ga0501034_0122524 3300049571 Bacteria 2586
342 Ga0501036_0009551 3300049572 Bacteria 7978
343 Ga0501037_0002462 3300049573 Bacteria 13378
344 Ga0501038_0021320 3300049574 Bacteria 5816
345 Ga0501039_0002444 3300049575 Bacteria 13832
346 Ga0501043_0001466 3300049579 Bacteria 20632
347 Ga0501047_0027757 3300049581 Bacteria 5454
348 Ga0501070_0004156 3300049586 Bacteria 12454
349 Ga0501070_0010544 3300049586 Bacteria 7812
350 Ga0501073_0065794 3300049589 Bacteria 2527
351 Ga0501035_0000602 3300049822 Bacteria 39639
352 Ga0501044_0002618 3300049823 Bacteria 20449
353 Ga0501044_0003682 3300049823 Bacteria 17229
354 Ga0501044_0030941 3300049823 Bacteria 5636
355 nmdc:mga03n38_11739_c1 3300050490 Bacteria 3274
356 nmdc:mga03n38_24742_c1 3300050490 Bacteria 2458
357 nmdc:mga03n38_698_c2 3300050490 Bacteria 8043
358 nmdc:mga03n38_80710_c1 3300050490 Bacteria 1528
359 nmdc:mga00v17_26554_c1 3300050491 Bacteria 3376
360 nmdc:mga00v17_40100_c1 3300050491 Bacteria 2808
361 nmdc:mga00v17_74141_c1 3300050491 Bacteria 2114
362 nmdc:mga00v17_9093_c1 3300050491 Bacteria 5362
363 nmdc:mga00v17_94038_c1 3300050491 Bacteria 1885
364 nmdc:mga0yw44_126740_c1 3300050492 Bacteria 1649
365 nmdc:mga0yw44_3444_c1 3300050492 Bacteria 7021
366 nmdc:mga0yw44_53037_c1 3300050492 Bacteria 2461
367 nmdc:mga0yw44_685_c1 3300050492 Bacteria 12387
368 nmdc:mga0yw44_74304_c1 3300050492 Bacteria 2117
369 nmdc:mga06z11_21416_c1 3300050494 Bacteria 3004
370 nmdc:mga07m45_1337_c2 3300050496 Bacteria 9663
371 nmdc:mga07m45_44916_c1 3300050496 Bacteria 2480
372 nmdc:mga07m45_6000_c1 3300050496 Bacteria 6110
373 nmdc:mga07m45_7131_c1 3300050496 Bacteria 5692
374 nmdc:mga05p37_9126_c1 3300050507 Bacteria 11722
375 nmdc:mga0qj67_41420_c1 3300050509 Bacteria 3623
376 nmdc:mga06r32_150559_c1 3300050510 Bacteria 2305
377 nmdc:mga0sz30_102859_c1 3300050516 Bacteria 1249
378 nmdc:mga0sz30_11614_c1 3300050516 Bacteria 3406
379 nmdc:mga0sz30_6910_c1 3300050516 Bacteria 4237
380 Ga0500610_0082232 3300053079 Bacteria 1678
381 Ga0500643_000502 3300053087 Bacteria 27898
382 Ga0466962_0009264 3300061719 Bacteria 4717
383 2555228909 2554235227 Bacteria 3637389
384 2644487166 2643221687 Bacteria 6500351
385 2644635045 2643221715 Bacteria 6671032
386 2655033391 2654587600 Bacteria 3911798
387 2729906745 2728369276 Bacteria 5610032
388 2738702784 2738541274 Bacteria 6909446
389 2739329694 2738543028 Bacteria 6917070
390 2753035738 2751185725 Bacteria 5740550
391 2753326237 2751185792 Bacteria 5739090
392 2842135007 2842134933 Bacteria 5847019
393 2902794575 2902792274 Bacteria 7270173
394 2902803072 2902799365 Bacteria 5419524
395 2902813911 2902810491 Bacteria 6794147
396 2902839252 2902837492 Bacteria 6697721
397 2929213349 2929212328 Bacteria 7708288
398 2939586911 2939582691 Bacteria 7088898
399 2939664117 2939660829 Bacteria 3784848
400 2956940902 2956939328 Bacteria 3474458
401 2995729098 2995726249 Bacteria 3470435
402 3001120590 3001119090 Bacteria 3449530
403 Ga0496112_0309162
404 JGI24745J21846_1001472
405 Ga0055540_1002190
406 Ga0055540_1005091
407 Ga0070676_10011575
408 Ga0068869_100082625
409 Ga0068868_100025069
410 Ga0070660_100267510
411 Ga0070689_100051999
412 Ga0070689_100115238
413 Ga0070691_10001512
414 Ga0070668_100004640
415 Ga0070668_100315502
416 Ga0070669_100046670
417 Ga0070669_100271751
418 Ga0070675_100107409
419 Ga0070674_100191150
420 Ga0070674_100210204
421 Ga0070688_100024322
422 Ga0070688_100044117
423 Ga0070667_100002436
424 Ga0070667_100003582
425 Ga0070667_100148935
426 Ga0070667_100161867
427 Ga0070667_100266824
428 Ga0070714_100054636
429 Ga0070714_100455264
430 Ga0070710_10003482
431 Ga0070710_10027940
432 Ga0070710_10045984
433 Ga0070701_10000600
434 Ga0070701_10042441
435 Ga0070711_100009565
436 Ga0070711_100017335
437 Ga0070705_100019193
438 Ga0070700_100008312
439 Ga0070700_100061418
440 Ga0070694_100010420
441 Ga0070678_100017347
442 Ga0070678_100094264
443 Ga0070662_100026450
444 Ga0070662_100052011
445 Ga0070685_10088422
446 Ga0070697_100206340
447 Ga0070696_100009345
448 Ga0070665_100002411
449 Ga0070665_100011442
450 Ga0070665_100060719
451 Ga0070704_100000382
452 Ga0070704_100150210
453 Ga0068855_100613282
454 Ga0068854_100010542
455 Ga0068856_100287197
456 Ga0068852_100074322
457 Ga0068859_100004954
458 Ga0068859_100008300
459 Ga0068859_100128989
460 Ga0068866_10026355
461 Ga0068861_100023872
462 Ga0068861_100026367
463 Ga0068861_100065257
464 Ga0068863_100001051
465 Ga0068863_100028819
466 Ga0068858_100005490
467 Ga0068858_100010799
468 Ga0068858_100038206
469 Ga0068860_100000186
470 Ga0068862_100005177
471 Ga0081455_10033007
472 Ga0075365_10003191
473 Ga0075365_10139039
474 Ga0075363_100011579
475 Ga0075363_100014457
476 Ga0075363_100053673
477 Ga0075363_100073913
478 Ga0075364_10008835
479 Ga0075364_10019392
480 Ga0075364_10034610
481 Ga0075364_10069478
482 Ga0075364_10076772
483 Ga0075364_10086276
484 Ga0075364_10090915
485 Ga0070715_10004739
486 Ga0070715_10022525
487 Ga0070716_100127742
488 Ga0070712_100026549
489 Ga0075367_10012769
490 Ga0075367_10029021
491 Ga0075367_10044105
492 Ga0075367_10069538
493 Ga0075369_10006423
494 Ga0075369_10007818
495 Ga0075369_10008698
496 Ga0075369_10027977
497 Ga0075369_10036934
498 Ga0075369_10052227
499 Ga0075369_10054129
500 Ga0075369_10094724
501 Ga0075370_10000392
502 Ga0075370_10000398
503 Ga0075370_10016521
504 Ga0075428_100003662
505 Ga0075430_100051278
506 Ga0075431_100237855
507 Ga0068865_100040415
508 Ga0097620_100004954
509 Ga0097620_100008300
510 Ga0097620_100128990
511 Ga0105250_10063368
512 Ga0111539_10371853
513 Ga0105245_10390394
514 Ga0105247_10000011
515 Ga0105247_10001208
516 Ga0114129_10010447
517 Ga0105243_10007397
518 Ga0105243_10183638
519 Ga0105241_10086620
520 Ga0105242_10000903
521 Ga0105248_10000370
522 Ga0105248_10001286
523 Ga0105248_10150548
524 Ga0105248_10160707
525 Ga0105237_10010308
526 Ga0105237_10041302
527 Ga0105238_10078383
528 Ga0105238_10501009
529 Ga0105249_10000091
530 Ga0105249_10001187
531 Ga0105249_10126070
532 Ga0105239_10005756
533 Ga0105239_10054794
534 Ga0105239_10084093
535 Ga0157374_10003373
536 Ga0157374_10018292
537 Ga0157378_10004710
538 Ga0163162_10009689
539 Ga0163162_10010156
540 Ga0163162_10052082
541 Ga0163162_10212057
542 Ga0163162_10277019
543 Ga0157375_10002646
544 Ga0163163_10146763
545 Ga0163163_10174249
546 Ga0163163_10186043
547 Ga0157380_10000852
548 Ga0157377_10081209
549 Ga0157379_10042829
550 Ga0157379_10198637
551 Ga0163161_10001083
552 Ga0213876_10003772
553 Ga0213876_10021975
554 Ga0213875_10083351
555 Ga0209673_1023930
556 Ga0209051_1001486
557 Ga0209051_1001501
558 Ga0209051_1006170
559 Ga0207642_10154235
560 Ga0207710_10000006
561 Ga0207710_10002947
562 Ga0207688_10000257
563 Ga0207688_10003529
564 Ga0207680_10292747
565 Ga0207685_10020357
566 Ga0207645_10014483
567 Ga0207671_10029885
568 Ga0207671_10121875
569 Ga0207693_10002924
570 Ga0207693_10003989
571 Ga0207663_10005625
572 Ga0207662_10098524
573 Ga0207681_10037501
574 Ga0207650_10256288
575 Ga0207687_10000655
576 Ga0207687_10221299
577 Ga0207664_10077745
578 Ga0207690_10167460
579 Ga0207706_10020242
580 Ga0207686_10036384
581 Ga0207709_10006201
582 Ga0207670_10083952
583 Ga0207669_10101938
584 Ga0207704_10001319
585 Ga0207665_10014294
586 Ga0207665_10078231
587 Ga0207691_10083992
588 Ga0207711_10000080
589 Ga0207711_10047265
590 Ga0207689_10005414
591 Ga0207689_10056750
592 Ga0207667_10527746
593 Ga0207712_10000061
594 Ga0207712_10032505
595 Ga0207668_10000619
596 Ga0207640_10005911
597 Ga0207658_10000123
598 Ga0207658_10006504
599 Ga0207658_10007674
600 Ga0207658_10326133
601 Ga0207658_10456590
602 Ga0207703_10016311
603 Ga0207703_10041709
604 Ga0207639_10047662
605 Ga0207639_10228456
606 Ga0207708_10004354
607 Ga0207641_10001081
608 Ga0207641_10070257
609 Ga0207648_10000555
610 Ga0207648_10066169
611 Ga0207676_10176010
612 Ga0207675_100000629
613 Ga0207675_100156307
614 Ga0207675_100196391
615 Ga0207683_10000731
616 Ga0268266_10007503
617 Ga0268266_10052066
618 Ga0268266_10225714
619 Ga0268265_10000005
620 Ga0268264_10000177
621 Ga0268264_10004312
622 Ga0265327_10000004
623 Ga0265327_10000624
624 Ga0265327_10069977
625 Ga0307410_10181571
626 Ga0307409_100142604
627 Ga0307416_100016759
628 Ga0307414_10072300
629 Ga0373960_0025318
630 Ga0373931_0003935
631 Ga0436364_0480641
632 Ga0436365_0479579
633 Ga0436363_1287738
634 Ga0439461_0000386
635 Ga0439461_0012365
636 Ga0439465_0007406
637 Ga0439465_0014618
638 Ga0439431_0020569
639 Ga0439445_0002610
640 Ga0439445_0013818
641 Ga0439434_0010573
642 Ga0466969_0136471
643 Ga0466972_0005393
644 Ga0466972_0012243
645 Ga0466972_0048718
646 Ga0466972_0062965
647 Ga0466965_0006134
648 Ga0466965_0083994
649 Ga0466965_0098083
650 Ga0466966_0010352
651 Ga0466966_0019196
652 Ga0466961_0023506
653 Ga0466961_0067585
654 Ga0466971_0030012
655 Ga0466968_0004719
656 Ga0466968_0050907
657 Ga0466970_0006698
658 Ga0466970_0008427
659 Ga0466957_0008603
660 Ga0466957_0022358
661 Ga0466957_0088537
662 Ga0466960_0000280
663 Ga0466960_0001080
664 Ga0466960_0006698
665 Ga0466959_0036266
666 Ga0466959_0225133
667 Ga0466958_0002178
668 Ga0466958_0041728
669 Ga0466967_0009166
670 Ga0466967_0044159
671 Ga0466967_0051874
672 Ga0495603_0091320
673 Ga0495638_0007103
674 Ga0495638_0052431
675 Ga0495582_0013040
676 Ga0495606_0027537
677 Ga0495667_0184579
678 Ga0495668_0117046
679 Ga0495658_0070150
680 Ga0495674_0087381
681 Ga0495672_0004283
682 Ga0495673_0000473
683 Ga0495593_0022679
684 Ga0496100_0001754
685 Ga0496100_0017857
686 Ga0496100_0206969
687 Ga0496101_0000014
688 Ga0496101_0014192
689 Ga0496101_0021563
690 Ga0496101_0037526
691 Ga0496102_0000003
692 Ga0496102_0001526
693 Ga0496102_0005358
694 Ga0496102_0011183
695 Ga0496102_0030570
696 Ga0496102_0052455
697 Ga0496103_0000012
698 Ga0496103_0001559
699 Ga0496103_0005146
700 Ga0496103_0109933
701 Ga0496104_0155188
702 Ga0496104_0217121
703 Ga0496105_0209809
704 Ga0496106_0000292
705 Ga0496106_0044293
706 Ga0496106_0059889
707 Ga0496106_0136669
708 Ga0496107_0000414
709 Ga0496107_0258241
710 Ga0496107_0261030
711 Ga0496108_0002588
712 Ga0496108_0056233
713 Ga0496109_0000816
714 Ga0496109_0029394
715 Ga0496109_0107662
716 Ga0496110_0507231
717 Ga0496112_0096707
718 Ga0496112_0128104
719 Ga0496112_0176480
720 Ga0496113_0076288
721 Ga0496113_0315028
722 Ga0496114_0009048
723 Ga0496114_0188001
724 Ga0496116_0000040
725 Ga0496117_0000003
726 Ga0496117_0001183
727 Ga0496118_0000001
728 Ga0496118_0007598
729 Ga0496120_0029174
730 Ga0496121_0000611
731 Ga0496121_0001471
732 Ga0496122_0052928
733 Ga0496123_0012284
734 Ga0496125_0054317
735 Ga0496126_0000567
736 Ga0496126_0001187
737 Ga0496126_0009834
738 Ga0496126_0182818
739 Ga0501032_0001399
740 Ga0501032_0057349
741 Ga0501033_0025590
742 Ga0501034_0020935
743 Ga0501034_0122524
744 Ga0501036_0009551
745 Ga0501037_0002462
746 Ga0501038_0021320
747 Ga0501039_0002444
748 Ga0501043_0001466
749 Ga0501047_0027757
750 Ga0501070_0004156
751 Ga0501070_0010544
752 Ga0501073_0065794
753 Ga0501035_0000602
754 Ga0501044_0002618
755 Ga0501044_0003682
756 Ga0501044_0030941
757 nmdc:mga03n38_11739_c1
758 nmdc:mga03n38_24742_c1
759 nmdc:mga03n38_698_c2
760 nmdc:mga03n38_80710_c1
761 nmdc:mga00v17_26554_c1
762 nmdc:mga00v17_40100_c1
763 nmdc:mga00v17_74141_c1
764 nmdc:mga00v17_9093_c1
765 nmdc:mga00v17_94038_c1
766 nmdc:mga0yw44_126740_c1
767 nmdc:mga0yw44_3444_c1
768 nmdc:mga0yw44_53037_c1
769 nmdc:mga0yw44_685_c1
770 nmdc:mga0yw44_74304_c1
771 nmdc:mga06z11_21416_c1
772 nmdc:mga07m45_1337_c2
773 nmdc:mga07m45_44916_c1
774 nmdc:mga07m45_6000_c1
775 nmdc:mga07m45_7131_c1
776 nmdc:mga05p37_9126_c1
777 nmdc:mga0qj67_41420_c1
778 nmdc:mga06r32_150559_c1
779 nmdc:mga0sz30_102859_c1
780 nmdc:mga0sz30_11614_c1
781 nmdc:mga0sz30_6910_c1
782 Ga0500610_0082232
783 Ga0500643_000502
784 Ga0466962_0009264
785 2555228909
786 2644487166
787 2644635045
788 2655033391
789 2729906745
790 2738702784
791 2739329694
792 2753035738
793 2753326237
794 2842135007
795 2902794575
796 2902803072
797 2902813911
798 2902839252
799 2929213349
800 2939586911
801 2939664117
802 2956940902
803 2995729098
804 3001120590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18374

Enolase_like_N

Enolase N-terminal domain-like

71

122

0.99

PF13378

MR_MLE_C

Enolase C-terminal domain-like

144

336

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dhg-assembly1.cif.gz_A crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation 0.8671 69 281
2qvh-assembly1.cif.gz_A crystal structure of o-succinylbenzoate synthase complexed with o-succinyl benzoate (osb) 0.8639 20 295
3dg3-assembly1.cif.gz_A crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis 0.8615 69 283
4dhg-assembly2.cif.gz_D crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation 0.8529 69 281
3vdg-assembly1.cif.gz_A-2 crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate 0.8464 69 281
ID Description Score Start End Superfamily
2opjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9147 65 283 3.20.20.120
2opjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.8934 65 283 3.20.20.120
4m0xB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.8706 69 281 3.20.20.120
af_I1K3D5_202_436_3.20.20.120 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.8537 69 280 3.20.20.120
3u9iB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.8524 70 281 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2S9GQC1-F1-model_v4 O-succinylbenzoate synthase 0.993 83 153 GO:0009234
AF-X8C8H4-F1-model_v4 O-succinylbenzoate-CoA synthase 0.9899 120 281 GO:0003824
GO:0009234
AF-V7KGW6-F1-model_v4 deleted 0.9884 71 270
AF-A0A656KWP8-F1-model_v4 deleted 0.9833 96 258
AF-V7KGW6-F1-model_v4 deleted 0.9692 71 270

Map