F435228

General Info

Members Datasets Scaffolds Average Seq Length
402 220 804 330

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0139285|Ga0501044_0139285_1280_2311
Length 343
Sequence MTETTQKTELEAVADAIRAHDRFVVVSHENPDGDALGSLLATHLALFQLGKDSVMYLAGETPLPAEYRFLDLAGLRRALPGDHAERVLVAVDCAQESRLGPGWEELLAKAPLTVDIDHHHDNTRFGDVNLVVPEASSTGELLADVFRELGVRLTAELAEPLYTALVTDTGRFQYANTTPKALRLAADLVEAGADAHKVFQVVYESVEFAKLKLLARALQRAEIHEGGRVVVSYLVRDDFAEVGAAEPYSEGIIDYLRAVDGAALAALIREPPSAGGQLRKVSLRSSTDEVDVSSIARKSGGXGHRQAAGFSSERSVAEITEFIVREFRSVTGETERPAVGSGG

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20.15
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 18.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0139285 3300049823 Bacteria 2415
2 JGI24742J22300_10010453 3300002244 Unclassified 1537
3 Ga0070683_100010660 3300005329 Bacteria 7902
4 Ga0070683_100033669 3300005329 Bacteria 4673
5 Ga0070690_100005734 3300005330 Bacteria 6994
6 Ga0070677_10076293 3300005333 Unclassified 1423
7 Ga0070680_100055640 3300005336 Bacteria 3233
8 Ga0070680_100103790 3300005336 Bacteria 2362
9 Ga0070680_100106635 3300005336 Bacteria 2330
10 Ga0070682_100011772 3300005337 Bacteria 5002
11 Ga0070682_100075668 3300005337 Bacteria 2166
12 Ga0068868_100026785 3300005338 Unclassified 4396
13 Ga0070660_100009902 3300005339 Bacteria 6722
14 Ga0070660_100127147 3300005339 Unclassified 2037
15 Ga0070689_100061734 3300005340 Unclassified 2915
16 Ga0070691_10110603 3300005341 Bacteria 1374
17 Ga0070661_100091534 3300005344 Bacteria 2253
18 Ga0070692_10020141 3300005345 Bacteria 3230
19 Ga0070668_100034276 3300005347 Bacteria 3869
20 Ga0070669_100311532 3300005353 Bacteria 1269
21 Ga0070675_100217355 3300005354 Unclassified 1663
22 Ga0070674_100126445 3300005356 Unclassified 1900
23 Ga0070673_100178181 3300005364 Unclassified 1818
24 Ga0070659_100054394 3300005366 Bacteria 3152
25 Ga0070709_10039647 3300005434 Unclassified 2891
26 Ga0070714_100202629 3300005435 Unclassified 1816
27 Ga0070710_10033882 3300005437 Unclassified 2775
28 Ga0070701_10005898 3300005438 Bacteria 5111
29 Ga0070711_100006848 3300005439 Bacteria 6899
30 Ga0070700_100007469 3300005441 Bacteria 5906
31 Ga0070694_100047499 3300005444 Unclassified 2885
32 Ga0070708_100041394 3300005445 Bacteria 4039
33 Ga0070663_100018281 3300005455 Bacteria 4591
34 Ga0070681_10010772 3300005458 Bacteria 9036
35 Ga0068867_100010996 3300005459 Bacteria 6381
36 Ga0068867_100168854 3300005459 Bacteria 1731
37 Ga0070685_10027118 3300005466 Bacteria 3164
38 Ga0070706_100260743 3300005467 Bacteria 1618
39 Ga0070707_100207313 3300005468 Bacteria 1911
40 Ga0070679_100027597 3300005530 Bacteria 5589
41 Ga0070679_100045082 3300005530 Bacteria 4394
42 Ga0070684_100187449 3300005535 Bacteria 1882
43 Ga0070697_100027408 3300005536 Bacteria 4558
44 Ga0070672_100004936 3300005543 Bacteria 8782
45 Ga0070686_100019522 3300005544 Bacteria 3996
46 Ga0070695_100067083 3300005545 Unclassified 2340
47 Ga0070696_100120902 3300005546 Unclassified 1895
48 Ga0070693_100103600 3300005547 Unclassified 1738
49 Ga0070665_100003419 3300005548 Bacteria 16959
50 Ga0070665_100220931 3300005548 Bacteria 1895
51 Ga0068855_100005352 3300005563 Bacteria 15656
52 Ga0068855_100115414 3300005563 Bacteria 3078
53 Ga0070664_100067600 3300005564 Bacteria 3054
54 Ga0068854_100321823 3300005578 Unclassified 1257
55 Ga0068856_100030805 3300005614 Bacteria 5246
56 Ga0068856_100244868 3300005614 Unclassified 1808
57 Ga0070702_100015435 3300005615 Unclassified 3900
58 Ga0068852_100008885 3300005616 Bacteria 7432
59 Ga0068859_100315498 3300005617 Unclassified 1657
60 Ga0068864_100183108 3300005618 Unclassified 1916
61 Ga0068866_10005511 3300005718 Bacteria 5228
62 Ga0068858_100086022 3300005842 Unclassified 2925
63 Ga0075432_10019857 3300006058 Bacteria 2297
64 Ga0070712_100175451 3300006175 Unclassified 1666
65 Ga0097621_100055999 3300006237 Bacteria 3220
66 Ga0097621_100154245 3300006237 Bacteria 1971
67 Ga0068871_100006377 3300006358 Bacteria 8339
68 Ga0075433_10017294 3300006852 Bacteria 5969
69 Ga0075433_10330519 3300006852 Bacteria 1348
70 Ga0075434_100013806 3300006871 Bacteria 7702
71 Ga0075434_100031031 3300006871 Bacteria 5267
72 Ga0068865_100065685 3300006881 Unclassified 2557
73 Ga0075436_100001566 3300006914 Bacteria 15598
74 Ga0097620_100315494 3300006931 Unclassified 1657
75 Ga0075435_100007518 3300007076 Bacteria 7776
76 Ga0105240_10058319 3300009093 Bacteria 4820
77 Ga0105240_10276291 3300009093 Bacteria 1932
78 Ga0105245_10023305 3300009098 Bacteria 5433
79 Ga0105245_10071082 3300009098 Unclassified 3160
80 Ga0105245_10134746 3300009098 Unclassified 2320
81 Ga0105247_10192412 3300009101 Unclassified 1366
82 Ga0114129_10013022 3300009147 Bacteria 11847
83 Ga0105243_10336536 3300009148 Unclassified 1381
84 Ga0105241_10101879 3300009174 Unclassified 2284
85 Ga0105242_10460473 3300009176 Unclassified 1201
86 Ga0105248_10034471 3300009177 Bacteria 5660
87 Ga0105248_10344773 3300009177 Bacteria 1677
88 Ga0105238_10193378 3300009551 Bacteria 2010
89 Ga0105249_10001347 3300009553 Bacteria 21460
90 Ga0105249_10140429 3300009553 Bacteria 2316
91 Ga0105239_10009547 3300010375 Bacteria 10917
92 Ga0105239_10086664 3300010375 Unclassified 3452
93 Ga0105246_10116534 3300011119 Bacteria 1972
94 Ga0157370_10016647 3300013104 Bacteria 7439
95 Ga0157370_10062047 3300013104 Bacteria 3546
96 Ga0157369_10015472 3300013105 Bacteria 8596
97 Ga0157369_10065773 3300013105 Bacteria 3901
98 Ga0157369_10191779 3300013105 Bacteria 2147
99 Ga0157369_10505708 3300013105 Bacteria 1250
100 Ga0157374_10007016 3300013296 Bacteria 9591
101 Ga0157374_10198782 3300013296 Unclassified 1963
102 Ga0157378_10006940 3300013297 Bacteria 9880
103 Ga0163162_10011880 3300013306 Bacteria 8494
104 Ga0163162_10399161 3300013306 Unclassified 1508
105 Ga0157372_10271022 3300013307 Bacteria 1972
106 Ga0157375_10111172 3300013308 Unclassified 2838
107 Ga0157375_10172625 3300013308 Bacteria 2310
108 Ga0157380_10186130 3300014326 Unclassified 1829
109 Ga0157377_10004788 3300014745 Bacteria 6276
110 Ga0157376_10043956 3300014969 Bacteria 3669
111 Ga0206356_10005950 3300020070 Bacteria 1682
112 Ga0206356_10625028 3300020070 Bacteria 4042
113 Ga0206354_10171663 3300020081 Bacteria 1594
114 Ga0206353_11427553 3300020082 Bacteria 2558
115 Ga0206353_11717398 3300020082 Bacteria 3542
116 Ga0206353_11788903 3300020082 Bacteria 6607
117 Ga0207688_10065715 3300025901 Unclassified 2050
118 Ga0207699_10015849 3300025906 Unclassified 3926
119 Ga0207705_10005937 3300025909 Bacteria 9083
120 Ga0207705_10076250 3300025909 Bacteria 2437
121 Ga0207654_10031320 3300025911 Bacteria 2928
122 Ga0207654_10040644 3300025911 Unclassified 2621
123 Ga0207707_10008921 3300025912 Bacteria 8709
124 Ga0207693_10001176 3300025915 Bacteria 23358
125 Ga0207693_10015488 3300025915 Bacteria 6117
126 Ga0207693_10062055 3300025915 Unclassified 2928
127 Ga0207663_10181615 3300025916 Unclassified 1503
128 Ga0207660_10013947 3300025917 Bacteria 5274
129 Ga0207660_10071979 3300025917 Bacteria 2517
130 Ga0207660_10092461 3300025917 Bacteria 2245
131 Ga0207657_10014652 3300025919 Bacteria 7640
132 Ga0207657_10033954 3300025919 Bacteria 4594
133 Ga0207649_10120283 3300025920 Bacteria 1769
134 Ga0207652_10008538 3300025921 Bacteria 8245
135 Ga0207652_10030697 3300025921 Bacteria 4503
136 Ga0207659_10155924 3300025926 Unclassified 1788
137 Ga0207687_10012584 3300025927 Bacteria 5526
138 Ga0207687_10210408 3300025927 Unclassified 1525
139 Ga0207687_10289457 3300025927 Bacteria 1316
140 Ga0207644_10032152 3300025931 Unclassified 3659
141 Ga0207644_10069118 3300025931 Bacteria 2578
142 Ga0207690_10208528 3300025932 Unclassified 1488
143 Ga0207686_10015963 3300025934 Bacteria 4208
144 Ga0207686_10277858 3300025934 Unclassified 1235
145 Ga0207709_10083424 3300025935 Bacteria 2066
146 Ga0207709_10152517 3300025935 Unclassified 1602
147 Ga0207709_10157180 3300025935 Unclassified 1582
148 Ga0207709_10157625 3300025935 Bacteria 1580
149 Ga0207669_10066596 3300025937 Unclassified 2240
150 Ga0207704_10005166 3300025938 Bacteria 6012
151 Ga0207691_10007187 3300025940 Bacteria 10741
152 Ga0207711_10151872 3300025941 Unclassified 2090
153 Ga0207661_10008982 3300025944 Bacteria 7160
154 Ga0207661_10088310 3300025944 Bacteria 2577
155 Ga0207661_10090825 3300025944 Bacteria 2544
156 Ga0207661_10154015 3300025944 Bacteria 1989
157 Ga0207661_10164059 3300025944 Bacteria 1929
158 Ga0207712_10148331 3300025961 Unclassified 1809
159 Ga0207677_10010112 3300026023 Bacteria 5327
160 Ga0207678_10004730 3300026067 Bacteria 12226
161 Ga0207678_10603079 3300026067 Bacteria 963
162 Ga0207708_10001288 3300026075 Bacteria 18839
163 Ga0207702_10049234 3300026078 Bacteria 3555
164 Ga0207702_10089693 3300026078 Bacteria 2689
165 Ga0207702_10234644 3300026078 Unclassified 1716
166 Ga0207648_10000136 3300026089 Bacteria 73368
167 Ga0207648_10093582 3300026089 Bacteria 2628
168 Ga0207683_10000371 3300026121 Bacteria 41225
169 Ga0207683_10011898 3300026121 Bacteria 7425
170 Ga0207698_10263168 3300026142 Bacteria 1585
171 Ga0265322_10005219 3300028654 Bacteria 3844
172 Ga0265338_10012446 3300028800 Bacteria 9698
173 Ga0265338_10051453 3300028800 Unclassified 3708
174 Ga0265338_10253960 3300028800 Bacteria 1296
175 Ga0265325_10016017 3300031241 Bacteria 4197
176 Ga0265329_10005422 3300031242 Bacteria 5155
177 Ga0265340_10049742 3300031247 Bacteria 2035
178 Ga0265339_10042291 3300031249 Bacteria 2523
179 Ga0265327_10014009 3300031251 Bacteria 5280
180 Ga0265327_10020347 3300031251 Bacteria 4047
181 Ga0265316_10006791 3300031344 Bacteria 10883
182 Ga0265313_10015119 3300031595 Bacteria 4517
183 Ga0265314_10070648 3300031711 Bacteria 2339
184 Ga0265342_10086899 3300031712 Bacteria 1797
185 Ga0373946_0091422 3300035171 Bacteria 1349
186 Ga0373937_0226578 3300036401 Unclassified 1760
187 Ga0395899_0020351 3300037312 Bacteria 5032
188 Ga0395899_0178675 3300037312 Unclassified 1491
189 Ga0395900_0018624 3300037418 Bacteria 7081
190 Ga0395900_0337745 3300037418 Bacteria 1483
191 Ga0395900_0441547 3300037418 Bacteria 1259
192 Ga0395898_0059698 3300037466 Bacteria 3709
193 Ga0395898_0059758 3300037466 Bacteria 3707
194 Ga0395898_0077501 3300037466 Bacteria 3209
195 Ga0395898_0117230 3300037466 Bacteria 2551
196 Ga0395898_0335006 3300037466 Unclassified 1443
197 Ga0395898_0575152 3300037466 Bacteria 1069
198 Ga0395905_0005221 3300037471 Bacteria 13294
199 Ga0395905_0017850 3300037471 Bacteria 6741
200 Ga0395905_0038167 3300037471 Bacteria 4506
201 Ga0395901_0001778 3300038443 Bacteria 22243
202 Ga0395901_0008954 3300038443 Bacteria 10136
203 Ga0395901_0078772 3300038443 Bacteria 3441
204 Ga0395901_0192310 3300038443 Bacteria 2140
205 Ga0395901_0240096 3300038443 Bacteria 1890
206 Ga0395901_0277822 3300038443 Bacteria 1741
207 Ga0439446_0050654 3300042156 Bacteria 1240
208 Ga0466963_0007736 3300044694 Bacteria 6422
209 Ga0466963_0048444 3300044694 Bacteria 2808
210 Ga0466963_0056356 3300044694 Bacteria 2615
211 Ga0466964_0010815 3300044706 Bacteria 3446
212 Ga0466964_0021424 3300044706 Bacteria 2500
213 Ga0451576_0194207 3300045051 Bacteria 2120
214 Ga0466958_0056802 3300045836 Bacteria 2379
215 Ga0466967_0036184 3300045976 Bacteria 4212
216 Ga0466967_0056270 3300045976 Bacteria 3467
217 Ga0466967_0059291 3300045976 Bacteria 3387
218 Ga0495592_0049898 3300046454 Bacteria 3110
219 Ga0495603_0017515 3300046455 Unclassified 4335
220 Ga0495603_0031071 3300046455 Bacteria 3215
221 Ga0495651_0192091 3300046462 Unclassified 1436
222 Ga0495653_0035458 3300046463 Bacteria 3937
223 Ga0495580_0050232 3300046472 Bacteria 2949
224 Ga0495582_0025840 3300046473 Unclassified 3217
225 Ga0495582_0043424 3300046473 Unclassified 2476
226 Ga0495582_0077921 3300046473 Bacteria 1838
227 Ga0495582_0134109 3300046473 Bacteria 1400
228 Ga0495662_0020998 3300046476 Bacteria 3158
229 Ga0495664_0154292 3300046477 Bacteria 1393
230 Ga0495584_0054772 3300046491 Unclassified 2007
231 Ga0495608_0136265 3300046511 Unclassified 1569
232 Ga0495618_0057284 3300046514 Bacteria 2467
233 Ga0495628_0027655 3300046516 Bacteria 4612
234 Ga0495652_0075984 3300046529 Bacteria 2788
235 Ga0495665_0178334 3300046531 Unclassified 1105
236 Ga0495640_0012742 3300046533 Bacteria 6419
237 Ga0495667_0046190 3300046559 Bacteria 2880
238 Ga0495634_0094367 3300046642 Bacteria 1939
239 Ga0495659_0065921 3300046664 Bacteria 1348
240 Ga0495623_0053086 3300046679 Bacteria 2560
241 Ga0495613_0017257 3300046689 Bacteria 5379
242 Ga0495613_0172845 3300046689 Bacteria 1533
243 Ga0495613_0246086 3300046689 Bacteria 1249
244 Ga0495600_0168296 3300046809 Bacteria 1415
245 Ga0495581_0009645 3300047315 Bacteria 5584
246 Ga0495581_0058465 3300047315 Bacteria 2227
247 Ga0495674_0000944 3300047319 Bacteria 27747
248 Ga0495674_0111624 3300047319 Bacteria 2317
249 Ga0495674_0392927 3300047319 Bacteria 1121
250 Ga0495676_0031375 3300047321 Bacteria 4496
251 Ga0495676_0036492 3300047321 Bacteria 4104
252 Ga0495680_0000491 3300047322 Bacteria 44586
253 Ga0495680_0097870 3300047322 Bacteria 2190
254 Ga0495684_0034251 3300047471 Bacteria 3897
255 Ga0496100_0011860 3300048903 Bacteria 4975
256 Ga0496100_0017110 3300048903 Bacteria 4274
257 Ga0496100_0019682 3300048903 Bacteria 4032
258 Ga0496100_0021953 3300048903 Bacteria 3854
259 Ga0496100_0106632 3300048903 Unclassified 1940
260 Ga0496100_0120490 3300048903 Unclassified 1835
261 Ga0496101_0004404 3300048904 Bacteria 8853
262 Ga0496101_0006382 3300048904 Bacteria 7588
263 Ga0496101_0023288 3300048904 Unclassified 4277
264 Ga0496101_0045709 3300048904 Bacteria 3137
265 Ga0496101_0154239 3300048904 Bacteria 1758
266 Ga0496101_0306446 3300048904 Unclassified 1245
267 Ga0496102_0026664 3300048905 Bacteria 5157
268 Ga0496102_0060363 3300048905 Bacteria 3468
269 Ga0496102_0107755 3300048905 Unclassified 2594
270 Ga0496103_0067736 3300048906 Bacteria 2230
271 Ga0496103_0144289 3300048906 Unclassified 1523
272 Ga0496104_0001034 3300048907 Bacteria 23804
273 Ga0496104_0002034 3300048907 Bacteria 17569
274 Ga0496104_0003577 3300048907 Bacteria 13415
275 Ga0496104_0020881 3300048907 Bacteria 6006
276 Ga0496104_0066013 3300048907 Unclassified 3435
277 Ga0496104_0067296 3300048907 Bacteria 3403
278 Ga0496104_0111647 3300048907 Unclassified 2621
279 Ga0496104_0505143 3300048907 Bacteria 1120
280 Ga0496105_0000050 3300048908 Bacteria 93402
281 Ga0496105_0010091 3300048908 Bacteria 7415
282 Ga0496105_0030063 3300048908 Unclassified 4450
283 Ga0496105_0039372 3300048908 Bacteria 3896
284 Ga0496105_0043140 3300048908 Bacteria 3720
285 Ga0496105_0049088 3300048908 Bacteria 3484
286 Ga0496105_0165494 3300048908 Unclassified 1814
287 Ga0496105_0169546 3300048908 Bacteria 1790
288 Ga0496106_0003308 3300048909 Bacteria 12017
289 Ga0496106_0028289 3300048909 Bacteria 4175
290 Ga0496106_0036254 3300048909 Bacteria 3689
291 Ga0496107_0002187 3300048910 Bacteria 12564
292 Ga0496107_0051476 3300048910 Bacteria 2970
293 Ga0496107_0126027 3300048910 Bacteria 1889
294 Ga0496108_0003667 3300048911 Bacteria 12319
295 Ga0496108_0005215 3300048911 Bacteria 10498
296 Ga0496108_0021220 3300048911 Bacteria 5337
297 Ga0496108_0030770 3300048911 Bacteria 4448
298 Ga0496108_0092424 3300048911 Bacteria 2573
299 Ga0496109_0001247 3300048912 Bacteria 21102
300 Ga0496109_0001424 3300048912 Bacteria 19854
301 Ga0496109_0002945 3300048912 Bacteria 14249
302 Ga0496109_0004651 3300048912 Bacteria 11458
303 Ga0496109_0006229 3300048912 Bacteria 10032
304 Ga0496109_0022108 3300048912 Bacteria 5629
305 Ga0496109_0214549 3300048912 Bacteria 1810
306 Ga0496110_0000090 3300048913 Bacteria 48256
307 Ga0496110_0002214 3300048913 Bacteria 14529
308 Ga0496110_0005481 3300048913 Bacteria 9950
309 Ga0496110_0031497 3300048913 Bacteria 4576
310 Ga0496110_0067811 3300048913 Bacteria 3157
311 Ga0496110_0621831 3300048913 Bacteria 979
312 Ga0496111_0000078 3300048914 Bacteria 40619
313 Ga0496111_0000240 3300048914 Bacteria 26236
314 Ga0496111_0010294 3300048914 Bacteria 6267
315 Ga0496111_0030334 3300048914 Bacteria 3845
316 Ga0496112_0015217 3300048915 Bacteria 7170
317 Ga0496112_0028350 3300048915 Bacteria 5404
318 Ga0496112_0098840 3300048915 Bacteria 2888
319 Ga0496112_0536341 3300048915 Bacteria 1104
320 Ga0496113_0015494 3300048916 Bacteria 5242
321 Ga0496113_0142280 3300048916 Unclassified 1888
322 Ga0496113_0144775 3300048916 Bacteria 1871
323 Ga0496114_0001055 3300048917 Bacteria 20710
324 Ga0496114_0002175 3300048917 Bacteria 14929
325 Ga0496114_0003237 3300048917 Bacteria 12491
326 Ga0496114_0085835 3300048917 Bacteria 2666
327 Ga0496114_0119045 3300048917 Bacteria 2270
328 Ga0496114_0149163 3300048917 Unclassified 2028
329 Ga0496114_0159139 3300048917 Unclassified 1962
330 Ga0496115_0001930 3300048918 Bacteria 14798
331 Ga0496115_0003007 3300048918 Bacteria 12105
332 Ga0496115_0003301 3300048918 Bacteria 11584
333 Ga0496115_0124846 3300048918 Bacteria 2120
334 Ga0496115_0130654 3300048918 Bacteria 2070
335 Ga0496115_0284518 3300048918 Bacteria 1357
336 Ga0501031_0011061 3300049568 Bacteria 5881
337 Ga0501033_0002606 3300049570 Bacteria 15195
338 Ga0501036_0085776 3300049572 Bacteria 2661
339 Ga0501036_0104809 3300049572 Bacteria 2391
340 Ga0501036_0385561 3300049572 Bacteria 1169
341 Ga0501037_0002116 3300049573 Bacteria 14379
342 Ga0501038_0001738 3300049574 Bacteria 20249
343 Ga0501039_0034121 3300049575 Bacteria 3927
344 Ga0501039_0067376 3300049575 Bacteria 2779
345 Ga0501040_0007206 3300049576 Bacteria 7200
346 Ga0501040_0047536 3300049576 Bacteria 2930
347 Ga0501041_0100198 3300049577 Bacteria 1793
348 Ga0501042_0009923 3300049578 Bacteria 6362
349 Ga0501042_0084466 3300049578 Bacteria 2276
350 Ga0501042_0183749 3300049578 Bacteria 1508
351 Ga0501043_0001426 3300049579 Bacteria 20883
352 Ga0501046_0009699 3300049580 Bacteria 8305
353 Ga0501047_0133362 3300049581 Bacteria 2364
354 Ga0501048_0008064 3300049582 Bacteria 7974
355 Ga0501067_0001229 3300049583 Bacteria 13920
356 Ga0501067_0040735 3300049583 Bacteria 2579
357 Ga0501068_0000470 3300049584 Bacteria 20365
358 Ga0501068_0087049 3300049584 Bacteria 1924
359 Ga0501069_0000321 3300049585 Bacteria 21720
360 Ga0501069_0003463 3300049585 Bacteria 8122
361 Ga0501069_0025367 3300049585 Bacteria 3239
362 Ga0501069_0034647 3300049585 Bacteria 2780
363 Ga0501070_0000190 3300049586 Bacteria 57730
364 Ga0501070_0001965 3300049586 Bacteria 18128
365 Ga0501072_0009029 3300049588 Bacteria 7576
366 Ga0501074_0007408 3300049590 Bacteria 7938
367 Ga0501074_0079818 3300049590 Bacteria 2348
368 Ga0501075_0009976 3300049591 Bacteria 6658
369 Ga0501075_0064987 3300049591 Bacteria 2752
370 Ga0501075_0112827 3300049591 Bacteria 2067
371 Ga0501075_0159805 3300049591 Bacteria 1719
372 Ga0501076_0010935 3300049592 Bacteria 6749
373 Ga0501076_0093540 3300049592 Bacteria 2419
374 Ga0501076_0216712 3300049592 Bacteria 1565
375 Ga0501077_0005513 3300049593 Bacteria 7696
376 Ga0501077_0006243 3300049593 Bacteria 7287
377 Ga0501077_0182291 3300049593 Bacteria 1334
378 Ga0501079_0038644 3300049741 Bacteria 3680
379 Ga0501079_0039326 3300049741 Bacteria 3648
380 Ga0501079_0102200 3300049741 Bacteria 2223
381 Ga0501080_0003557 3300049742 Bacteria 13706
382 Ga0501080_0184780 3300049742 Bacteria 1917
383 Ga0501080_0416452 3300049742 Bacteria 1207
384 Ga0501081_0111296 3300049743 Bacteria 1943
385 Ga0501083_0011363 3300049744 Bacteria 6245
386 Ga0501035_0017380 3300049822 Bacteria 6632
387 Ga0501035_0261804 3300049822 Bacteria 1466
388 Ga0501045_0002560 3300049824 Bacteria 12395
389 nmdc:mga05p37_10836_c1 3300050507 Bacteria 10825
390 nmdc:mga0n895_179971_c1 3300050512 Bacteria 2145
391 nmdc:mga0n895_279604_c2 3300050512 Bacteria 1289
392 nmdc:mga08x19_403023_c1 3300050514 Bacteria 960
393 nmdc:mga0a205_65652_c1 3300050515 Bacteria 3506
394 nmdc:mga0a205_68354_c1 3300050515 Bacteria 3432
395 Ga0495601_0073587 3300053077 Bacteria 2185
396 Ga0495595_0195981 3300053084 Bacteria 1005
397 Ga0495619_0012401 3300053085 Bacteria 5367
398 Ga0501084_0020475 3300054114 Bacteria 5516
399 Ga0501084_0041532 3300054114 Bacteria 3848
400 Ga0501084_0221439 3300054114 Bacteria 1597
401 Ga0501082_0019734 3300060353 Bacteria 5812
402 Ga0501082_0047827 3300060353 Bacteria 3686
403 Ga0501044_0139285
404 JGI24742J22300_10010453
405 Ga0070683_100010660
406 Ga0070683_100033669
407 Ga0070690_100005734
408 Ga0070677_10076293
409 Ga0070680_100055640
410 Ga0070680_100103790
411 Ga0070680_100106635
412 Ga0070682_100011772
413 Ga0070682_100075668
414 Ga0068868_100026785
415 Ga0070660_100009902
416 Ga0070660_100127147
417 Ga0070689_100061734
418 Ga0070691_10110603
419 Ga0070661_100091534
420 Ga0070692_10020141
421 Ga0070668_100034276
422 Ga0070669_100311532
423 Ga0070675_100217355
424 Ga0070674_100126445
425 Ga0070673_100178181
426 Ga0070659_100054394
427 Ga0070709_10039647
428 Ga0070714_100202629
429 Ga0070710_10033882
430 Ga0070701_10005898
431 Ga0070711_100006848
432 Ga0070700_100007469
433 Ga0070694_100047499
434 Ga0070708_100041394
435 Ga0070663_100018281
436 Ga0070681_10010772
437 Ga0068867_100010996
438 Ga0068867_100168854
439 Ga0070685_10027118
440 Ga0070706_100260743
441 Ga0070707_100207313
442 Ga0070679_100027597
443 Ga0070679_100045082
444 Ga0070684_100187449
445 Ga0070697_100027408
446 Ga0070672_100004936
447 Ga0070686_100019522
448 Ga0070695_100067083
449 Ga0070696_100120902
450 Ga0070693_100103600
451 Ga0070665_100003419
452 Ga0070665_100220931
453 Ga0068855_100005352
454 Ga0068855_100115414
455 Ga0070664_100067600
456 Ga0068854_100321823
457 Ga0068856_100030805
458 Ga0068856_100244868
459 Ga0070702_100015435
460 Ga0068852_100008885
461 Ga0068859_100315498
462 Ga0068864_100183108
463 Ga0068866_10005511
464 Ga0068858_100086022
465 Ga0075432_10019857
466 Ga0070712_100175451
467 Ga0097621_100055999
468 Ga0097621_100154245
469 Ga0068871_100006377
470 Ga0075433_10017294
471 Ga0075433_10330519
472 Ga0075434_100013806
473 Ga0075434_100031031
474 Ga0068865_100065685
475 Ga0075436_100001566
476 Ga0097620_100315494
477 Ga0075435_100007518
478 Ga0105240_10058319
479 Ga0105240_10276291
480 Ga0105245_10023305
481 Ga0105245_10071082
482 Ga0105245_10134746
483 Ga0105247_10192412
484 Ga0114129_10013022
485 Ga0105243_10336536
486 Ga0105241_10101879
487 Ga0105242_10460473
488 Ga0105248_10034471
489 Ga0105248_10344773
490 Ga0105238_10193378
491 Ga0105249_10001347
492 Ga0105249_10140429
493 Ga0105239_10009547
494 Ga0105239_10086664
495 Ga0105246_10116534
496 Ga0157370_10016647
497 Ga0157370_10062047
498 Ga0157369_10015472
499 Ga0157369_10065773
500 Ga0157369_10191779
501 Ga0157369_10505708
502 Ga0157374_10007016
503 Ga0157374_10198782
504 Ga0157378_10006940
505 Ga0163162_10011880
506 Ga0163162_10399161
507 Ga0157372_10271022
508 Ga0157375_10111172
509 Ga0157375_10172625
510 Ga0157380_10186130
511 Ga0157377_10004788
512 Ga0157376_10043956
513 Ga0206356_10005950
514 Ga0206356_10625028
515 Ga0206354_10171663
516 Ga0206353_11427553
517 Ga0206353_11717398
518 Ga0206353_11788903
519 Ga0207688_10065715
520 Ga0207699_10015849
521 Ga0207705_10005937
522 Ga0207705_10076250
523 Ga0207654_10031320
524 Ga0207654_10040644
525 Ga0207707_10008921
526 Ga0207693_10001176
527 Ga0207693_10015488
528 Ga0207693_10062055
529 Ga0207663_10181615
530 Ga0207660_10013947
531 Ga0207660_10071979
532 Ga0207660_10092461
533 Ga0207657_10014652
534 Ga0207657_10033954
535 Ga0207649_10120283
536 Ga0207652_10008538
537 Ga0207652_10030697
538 Ga0207659_10155924
539 Ga0207687_10012584
540 Ga0207687_10210408
541 Ga0207687_10289457
542 Ga0207644_10032152
543 Ga0207644_10069118
544 Ga0207690_10208528
545 Ga0207686_10015963
546 Ga0207686_10277858
547 Ga0207709_10083424
548 Ga0207709_10152517
549 Ga0207709_10157180
550 Ga0207709_10157625
551 Ga0207669_10066596
552 Ga0207704_10005166
553 Ga0207691_10007187
554 Ga0207711_10151872
555 Ga0207661_10008982
556 Ga0207661_10088310
557 Ga0207661_10090825
558 Ga0207661_10154015
559 Ga0207661_10164059
560 Ga0207712_10148331
561 Ga0207677_10010112
562 Ga0207678_10004730
563 Ga0207678_10603079
564 Ga0207708_10001288
565 Ga0207702_10049234
566 Ga0207702_10089693
567 Ga0207702_10234644
568 Ga0207648_10000136
569 Ga0207648_10093582
570 Ga0207683_10000371
571 Ga0207683_10011898
572 Ga0207698_10263168
573 Ga0265322_10005219
574 Ga0265338_10012446
575 Ga0265338_10051453
576 Ga0265338_10253960
577 Ga0265325_10016017
578 Ga0265329_10005422
579 Ga0265340_10049742
580 Ga0265339_10042291
581 Ga0265327_10014009
582 Ga0265327_10020347
583 Ga0265316_10006791
584 Ga0265313_10015119
585 Ga0265314_10070648
586 Ga0265342_10086899
587 Ga0373946_0091422
588 Ga0373937_0226578
589 Ga0395899_0020351
590 Ga0395899_0178675
591 Ga0395900_0018624
592 Ga0395900_0337745
593 Ga0395900_0441547
594 Ga0395898_0059698
595 Ga0395898_0059758
596 Ga0395898_0077501
597 Ga0395898_0117230
598 Ga0395898_0335006
599 Ga0395898_0575152
600 Ga0395905_0005221
601 Ga0395905_0017850
602 Ga0395905_0038167
603 Ga0395901_0001778
604 Ga0395901_0008954
605 Ga0395901_0078772
606 Ga0395901_0192310
607 Ga0395901_0240096
608 Ga0395901_0277822
609 Ga0439446_0050654
610 Ga0466963_0007736
611 Ga0466963_0048444
612 Ga0466963_0056356
613 Ga0466964_0010815
614 Ga0466964_0021424
615 Ga0451576_0194207
616 Ga0466958_0056802
617 Ga0466967_0036184
618 Ga0466967_0056270
619 Ga0466967_0059291
620 Ga0495592_0049898
621 Ga0495603_0017515
622 Ga0495603_0031071
623 Ga0495651_0192091
624 Ga0495653_0035458
625 Ga0495580_0050232
626 Ga0495582_0025840
627 Ga0495582_0043424
628 Ga0495582_0077921
629 Ga0495582_0134109
630 Ga0495662_0020998
631 Ga0495664_0154292
632 Ga0495584_0054772
633 Ga0495608_0136265
634 Ga0495618_0057284
635 Ga0495628_0027655
636 Ga0495652_0075984
637 Ga0495665_0178334
638 Ga0495640_0012742
639 Ga0495667_0046190
640 Ga0495634_0094367
641 Ga0495659_0065921
642 Ga0495623_0053086
643 Ga0495613_0017257
644 Ga0495613_0172845
645 Ga0495613_0246086
646 Ga0495600_0168296
647 Ga0495581_0009645
648 Ga0495581_0058465
649 Ga0495674_0000944
650 Ga0495674_0111624
651 Ga0495674_0392927
652 Ga0495676_0031375
653 Ga0495676_0036492
654 Ga0495680_0000491
655 Ga0495680_0097870
656 Ga0495684_0034251
657 Ga0496100_0011860
658 Ga0496100_0017110
659 Ga0496100_0019682
660 Ga0496100_0021953
661 Ga0496100_0106632
662 Ga0496100_0120490
663 Ga0496101_0004404
664 Ga0496101_0006382
665 Ga0496101_0023288
666 Ga0496101_0045709
667 Ga0496101_0154239
668 Ga0496101_0306446
669 Ga0496102_0026664
670 Ga0496102_0060363
671 Ga0496102_0107755
672 Ga0496103_0067736
673 Ga0496103_0144289
674 Ga0496104_0001034
675 Ga0496104_0002034
676 Ga0496104_0003577
677 Ga0496104_0020881
678 Ga0496104_0066013
679 Ga0496104_0067296
680 Ga0496104_0111647
681 Ga0496104_0505143
682 Ga0496105_0000050
683 Ga0496105_0010091
684 Ga0496105_0030063
685 Ga0496105_0039372
686 Ga0496105_0043140
687 Ga0496105_0049088
688 Ga0496105_0165494
689 Ga0496105_0169546
690 Ga0496106_0003308
691 Ga0496106_0028289
692 Ga0496106_0036254
693 Ga0496107_0002187
694 Ga0496107_0051476
695 Ga0496107_0126027
696 Ga0496108_0003667
697 Ga0496108_0005215
698 Ga0496108_0021220
699 Ga0496108_0030770
700 Ga0496108_0092424
701 Ga0496109_0001247
702 Ga0496109_0001424
703 Ga0496109_0002945
704 Ga0496109_0004651
705 Ga0496109_0006229
706 Ga0496109_0022108
707 Ga0496109_0214549
708 Ga0496110_0000090
709 Ga0496110_0002214
710 Ga0496110_0005481
711 Ga0496110_0031497
712 Ga0496110_0067811
713 Ga0496110_0621831
714 Ga0496111_0000078
715 Ga0496111_0000240
716 Ga0496111_0010294
717 Ga0496111_0030334
718 Ga0496112_0015217
719 Ga0496112_0028350
720 Ga0496112_0098840
721 Ga0496112_0536341
722 Ga0496113_0015494
723 Ga0496113_0142280
724 Ga0496113_0144775
725 Ga0496114_0001055
726 Ga0496114_0002175
727 Ga0496114_0003237
728 Ga0496114_0085835
729 Ga0496114_0119045
730 Ga0496114_0149163
731 Ga0496114_0159139
732 Ga0496115_0001930
733 Ga0496115_0003007
734 Ga0496115_0003301
735 Ga0496115_0124846
736 Ga0496115_0130654
737 Ga0496115_0284518
738 Ga0501031_0011061
739 Ga0501033_0002606
740 Ga0501036_0085776
741 Ga0501036_0104809
742 Ga0501036_0385561
743 Ga0501037_0002116
744 Ga0501038_0001738
745 Ga0501039_0034121
746 Ga0501039_0067376
747 Ga0501040_0007206
748 Ga0501040_0047536
749 Ga0501041_0100198
750 Ga0501042_0009923
751 Ga0501042_0084466
752 Ga0501042_0183749
753 Ga0501043_0001426
754 Ga0501046_0009699
755 Ga0501047_0133362
756 Ga0501048_0008064
757 Ga0501067_0001229
758 Ga0501067_0040735
759 Ga0501068_0000470
760 Ga0501068_0087049
761 Ga0501069_0000321
762 Ga0501069_0003463
763 Ga0501069_0025367
764 Ga0501069_0034647
765 Ga0501070_0000190
766 Ga0501070_0001965
767 Ga0501072_0009029
768 Ga0501074_0007408
769 Ga0501074_0079818
770 Ga0501075_0009976
771 Ga0501075_0064987
772 Ga0501075_0112827
773 Ga0501075_0159805
774 Ga0501076_0010935
775 Ga0501076_0093540
776 Ga0501076_0216712
777 Ga0501077_0005513
778 Ga0501077_0006243
779 Ga0501077_0182291
780 Ga0501079_0038644
781 Ga0501079_0039326
782 Ga0501079_0102200
783 Ga0501080_0003557
784 Ga0501080_0184780
785 Ga0501080_0416452
786 Ga0501081_0111296
787 Ga0501083_0011363
788 Ga0501035_0017380
789 Ga0501035_0261804
790 Ga0501045_0002560
791 nmdc:mga05p37_10836_c1
792 nmdc:mga0n895_179971_c1
793 nmdc:mga0n895_279604_c2
794 nmdc:mga08x19_403023_c1
795 nmdc:mga0a205_65652_c1
796 nmdc:mga0a205_68354_c1
797 Ga0495601_0073587
798 Ga0495595_0195981
799 Ga0495619_0012401
800 Ga0501084_0020475
801 Ga0501084_0041532
802 Ga0501084_0221439
803 Ga0501082_0019734
804 Ga0501082_0047827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01368

DHH

DHH family

22

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.9206 11 331
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.8962 11 331
4py9-assembly1.cif.gz_A crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 0.8904 8 330
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.8896 11 331
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.8766 11 331
ID Description Score Start End Superfamily
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8941 11 200 3.90.1640.10
4py9A01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8834 8 204 3.90.1640.10
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8775 212 329 3.10.310.30
3devB01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8655 10 204 3.90.1640.10
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8635 11 200 3.90.1640.10
ID Description Score Start End GO Terms
AF-A0A7V9MAP7-F1-model_v4 DHHA1 domain-containing protein 0.9519 220 331 GO:0003676
AF-A0A7C8ARF2-F1-model_v4 deleted 0.9452 10 324
AF-K1GI14-F1-model_v4 DHHA1 domain-containing protein 0.9444 164 326 GO:0003676
AF-A0A6S6TFC5-F1-model_v4 FIG146085: 3'-to-5' oligoribonuclease A, Bacillus type 0.9443 11 328 GO:0003676
AF-A0A1V5NM93-F1-model_v4 Bifunctional oligoribonuclease and PAP phosphatase NrnA (EC 3.1.-.-) 0.9431 151 331 GO:0003676
GO:0016787

Map