F435271

General Info

Members Datasets Scaffolds Average Seq Length
403 231 806 262

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10008009|JGI24738J21930_100080091
Length 280
Sequence MNHPTKPLASSRFRGDPENLSTIVPTDPTARRVPPFGGFNATVLRLELKRMLRNRRTIIFTLIFPAAMFFAFGGTSXSQARVGSGNVSAYIMVSMALYGAALTAAAGGAMVALERSLGWSRQLRLTPLNPVAYILVKALVALVMGAIAVAVVNIAGIVQGQPEMPLHAWIACALVTLVCTLTFAALGVFVGYVVPGENAMQILGPGLALMSFLGGVFIPLTAGSAVWHVAVFTPMYGVAEVARSPLTHELPWYALVNAVAWFLVFVAGAAWRMSKDTARV

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
216 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2643221615 Nocardioides sp. Root224 Isolate Unclassified
221 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
222 2643221692 Nocardia sp. Root136 Isolate Unclassified
223 2738541305 Nocardioides sp. CF167 Isolate Unclassified
224 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
225 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
226 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
227 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
228 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
229 2919395869 Microbacterium resistens 2980 Isolate Unclassified
230 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
231 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0.5
Isolates 2.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 14.14
Rhizosphere 79.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10008009 3300002075 Bacteria 2415
2 JGI24740J21852_10015407 3300001979 Bacteria 2792
3 JGI24740J21852_10019513 3300001979 Bacteria 2387
4 JGI24735J21928_10012384 3300002067 Bacteria 2696
5 rootH1_10076822 3300003316 Bacteria 2316
6 Ga0070683_100302158 3300005329 Bacteria 1523
7 Ga0070683_100322649 3300005329 Bacteria 1470
8 Ga0070682_100011863 3300005337 Bacteria 4986
9 Ga0068868_100072967 3300005338 Bacteria 2739
10 Ga0070689_100178972 3300005340 Bacteria 1721
11 Ga0070692_10018455 3300005345 Bacteria 3356
12 Ga0070692_10103034 3300005345 Bacteria 1567
13 Ga0070671_100339118 3300005355 Bacteria 1282
14 Ga0070673_100235391 3300005364 Bacteria 1590
15 Ga0070709_10018329 3300005434 Bacteria 4029
16 Ga0070710_10003839 3300005437 Bacteria 7109
17 Ga0070701_10036255 3300005438 Bacteria 2484
18 Ga0070711_100075252 3300005439 Bacteria 2390
19 Ga0070678_100164975 3300005456 Bacteria 1799
20 Ga0070706_100008552 3300005467 Bacteria 9539
21 Ga0070698_100005832 3300005471 Bacteria 13468
22 Ga0070679_100187442 3300005530 Bacteria 2038
23 Ga0070684_100074576 3300005535 Bacteria 2991
24 Ga0070684_100348402 3300005535 Bacteria 1362
25 Ga0068853_100104427 3300005539 Bacteria 2509
26 Ga0070672_100123203 3300005543 Bacteria 2124
27 Ga0070665_100000151 3300005548 Bacteria 127579
28 Ga0068854_100185129 3300005578 Bacteria 1629
29 Ga0068856_100088345 3300005614 Bacteria 3082
30 Ga0068856_100275256 3300005614 Bacteria 1700
31 Ga0068852_100012902 3300005616 Bacteria 6370
32 Ga0068852_100233301 3300005616 Bacteria 1755
33 Ga0068860_100802078 3300005843 Bacteria 955
34 Ga0070717_10005280 3300006028 Bacteria 9419
35 Ga0070717_10064866 3300006028 Bacteria 3034
36 Ga0075365_10249839 3300006038 Bacteria 1246
37 Ga0075365_10302563 3300006038 Bacteria 1126
38 Ga0075365_10427007 3300006038 Bacteria 936
39 Ga0070715_10006276 3300006163 Bacteria 4028
40 Ga0070716_100010950 3300006173 Bacteria 4563
41 Ga0070712_100212541 3300006175 Bacteria 1526
42 Ga0070712_100329645 3300006175 Bacteria 1243
43 Ga0068865_100041811 3300006881 Bacteria 3122
44 Ga0111539_10015445 3300009094 Bacteria 9497
45 Ga0105245_10061498 3300009098 Bacteria 3386
46 Ga0105245_10424657 3300009098 Bacteria 1333
47 Ga0105243_10005136 3300009148 Bacteria 10258
48 Ga0105243_10021870 3300009148 Bacteria 4856
49 Ga0105243_10027132 3300009148 Bacteria 4386
50 Ga0105243_10492418 3300009148 Bacteria 1160
51 Ga0105242_10334151 3300009176 Bacteria 1394
52 Ga0105248_11031666 3300009177 Bacteria 929
53 Ga0105237_10426505 3300009545 Bacteria 1332
54 Ga0105238_10471239 3300009551 Bacteria 1254
55 Ga0105249_10132096 3300009553 Bacteria 2384
56 Ga0105239_10081240 3300010375 Bacteria 3568
57 Ga0157369_10382513 3300013105 Bacteria 1461
58 Ga0157369_10449307 3300013105 Bacteria 1335
59 Ga0157369_11184288 3300013105 Bacteria 780
60 Ga0171462_1005 3300013250 Bacteria 598379
61 Ga0157372_10106443 3300013307 Bacteria 3208
62 Ga0157372_10111102 3300013307 Bacteria 3140
63 Ga0157372_10149807 3300013307 Bacteria 2692
64 Ga0157372_10369774 3300013307 Bacteria 1671
65 Ga0157372_10455173 3300013307 Bacteria 1491
66 Ga0157375_10140975 3300013308 Bacteria 2538
67 Ga0157375_10302233 3300013308 Bacteria 1764
68 Ga0157375_10359766 3300013308 Bacteria 1621
69 Ga0157375_10773096 3300013308 Bacteria 1110
70 Ga0163163_10387893 3300014325 Bacteria 1454
71 Ga0157380_10009167 3300014326 Bacteria 7081
72 Ga0182008_10070001 3300014497 Bacteria 1726
73 Ga0157377_10031271 3300014745 Bacteria 2891
74 Ga0157376_10911980 3300014969 Bacteria 897
75 Ga0163161_10046906 3300017792 Bacteria 3119
76 Ga0163161_10281012 3300017792 Bacteria 1306
77 Ga0206351_10059937 3300020077 Bacteria 1156
78 Ga0154015_1336322 3300020610 Bacteria 2256
79 Ga0207655_1005250 3300025728 Bacteria 8888
80 Ga0207692_10049159 3300025898 Bacteria 2127
81 Ga0207692_10058706 3300025898 Bacteria 1983
82 Ga0207642_10024825 3300025899 Bacteria 2416
83 Ga0207688_10013438 3300025901 Bacteria 4449
84 Ga0207685_10057012 3300025905 Bacteria 1531
85 Ga0207699_10002543 3300025906 Bacteria 8604
86 Ga0207643_10009000 3300025908 Bacteria 5361
87 Ga0207705_10038705 3300025909 Bacteria 3415
88 Ga0207684_10002209 3300025910 Bacteria 19867
89 Ga0207707_10408893 3300025912 Bacteria 1164
90 Ga0207671_10483113 3300025914 Bacteria 987
91 Ga0207693_10034823 3300025915 Bacteria 3971
92 Ga0207693_10307542 3300025915 Bacteria 1241
93 Ga0207663_10039811 3300025916 Bacteria 2851
94 Ga0207657_10115141 3300025919 Bacteria 2216
95 Ga0207652_10053580 3300025921 Bacteria 3465
96 Ga0207659_10087391 3300025926 Bacteria 2320
97 Ga0207687_10318862 3300025927 Bacteria 1257
98 Ga0207700_10008137 3300025928 Bacteria 6474
99 Ga0207664_10000495 3300025929 Bacteria 28038
100 Ga0207709_10003085 3300025935 Bacteria 10053
101 Ga0207709_10009370 3300025935 Bacteria 5387
102 Ga0207709_10158643 3300025935 Bacteria 1575
103 Ga0207704_10070226 3300025938 Bacteria 2217
104 Ga0207665_10020615 3300025939 Bacteria 4332
105 Ga0207691_10001309 3300025940 Bacteria 24825
106 Ga0207711_10110811 3300025941 Bacteria 2441
107 Ga0207661_10065578 3300025944 Bacteria 2948
108 Ga0207661_10156065 3300025944 Bacteria 1977
109 Ga0207661_10275921 3300025944 Bacteria 1501
110 Ga0207640_10048734 3300025981 Bacteria 2740
111 Ga0207640_10367110 3300025981 Bacteria 1162
112 Ga0207677_10052468 3300026023 Bacteria 2770
113 Ga0207703_10051914 3300026035 Bacteria 3326
114 Ga0207678_10116250 3300026067 Bacteria 2282
115 Ga0207708_10011997 3300026075 Bacteria 6457
116 Ga0207702_10260465 3300026078 Bacteria 1633
117 Ga0207702_10392290 3300026078 Bacteria 1337
118 Ga0207648_10001262 3300026089 Bacteria 28251
119 Ga0207675_100002583 3300026118 Bacteria 17935
120 Ga0207675_100112060 3300026118 Bacteria 2575
121 Ga0207683_10029999 3300026121 Bacteria 4711
122 Ga0207683_10368017 3300026121 Bacteria 1320
123 Ga0207683_10738755 3300026121 Bacteria 913
124 Ga0207698_10144774 3300026142 Bacteria 2053
125 Ga0268266_10005038 3300028379 Bacteria 12470
126 Ga0268264_10492745 3300028381 Bacteria 1194
127 Ga0265338_10004057 3300028800 Bacteria 20069
128 Ga0307408_100143094 3300031548 Bacteria 1879
129 Ga0307516_10019469 3300031730 Bacteria 7032
130 Ga0307516_10123582 3300031730 Bacteria 2375
131 Ga0307516_10375087 3300031730 Bacteria 1085
132 Ga0307405_10132599 3300031731 Bacteria 1724
133 Ga0307413_10336518 3300031824 Bacteria 1159
134 Ga0307406_10008775 3300031901 Bacteria 5651
135 Ga0307407_10043342 3300031903 Bacteria 2529
136 Ga0307416_100034667 3300032002 Bacteria 3844
137 Ga0307416_100174850 3300032002 Bacteria 2004
138 Ga0307414_10088071 3300032004 Bacteria 2297
139 Ga0307411_10068476 3300032005 Bacteria 2393
140 Ga0307415_100006280 3300032126 Bacteria 6387
141 Ga0307415_100020502 3300032126 Bacteria 4038
142 Ga0307415_100030700 3300032126 Bacteria 3453
143 Ga0373954_0135775 3300035118 Bacteria 1199
144 Ga0373946_0011478 3300035171 Bacteria 3307
145 Ga0373931_0259522 3300035691 Bacteria 1060
146 Ga0373935_0211055 3300035692 Bacteria 1345
147 Ga0373935_0232934 3300035692 Bacteria 1283
148 Ga0373935_0358989 3300035692 Bacteria 1040
149 Ga0373933_0042515 3300035724 Bacteria 2686
150 Ga0373947_0074192 3300035725 Bacteria 2092
151 Ga0373937_0042472 3300036401 Bacteria 4148
152 Ga0373925_0004146 3300037068 Bacteria 10990
153 Ga0373925_0122905 3300037068 Bacteria 2016
154 Ga0373925_0331914 3300037068 Bacteria 1232
155 Ga0395899_0110906 3300037312 Bacteria 1973
156 Ga0395900_0016786 3300037418 Bacteria 7468
157 Ga0395900_0027655 3300037418 Bacteria 5810
158 Ga0395900_0051367 3300037418 Bacteria 4247
159 Ga0395898_0021584 3300037466 Bacteria 6526
160 Ga0395898_0127892 3300037466 Bacteria 2434
161 Ga0395898_0396808 3300037466 Bacteria 1315
162 Ga0395898_0551360 3300037466 Bacteria 1095
163 Ga0395901_0024635 3300038443 Bacteria 6179
164 Ga0395901_0447712 3300038443 Bacteria 1321
165 Ga0451787_020072 3300041441 Bacteria 1249
166 Ga0451793_0557620 3300041452 Bacteria 1367
167 Ga0451800_0832002 3300041459 Bacteria 894
168 Ga0451853_0415050 3300041512 Bacteria 2426
169 Ga0466972_0017112 3300044658 Bacteria 3626
170 Ga0466972_0039088 3300044658 Bacteria 2317
171 Ga0466965_0169735 3300044683 Bacteria 1147
172 Ga0466966_0037332 3300044684 Bacteria 3133
173 Ga0466966_0134447 3300044684 Bacteria 1513
174 Ga0466966_0270105 3300044684 Bacteria 1023
175 Ga0466961_0035501 3300044693 Bacteria 3202
176 Ga0466961_0084172 3300044693 Bacteria 2011
177 Ga0466961_0319164 3300044693 Bacteria 947
178 Ga0466963_0006187 3300044694 Bacteria 7067
179 Ga0466963_0030406 3300044694 Bacteria 3485
180 Ga0466964_0159515 3300044706 Bacteria 1053
181 Ga0466971_0028243 3300044719 Bacteria 2511
182 Ga0466971_0063152 3300044719 Bacteria 1676
183 Ga0466971_0083782 3300044719 Bacteria 1456
184 Ga0466970_0000403 3300044765 Bacteria 21038
185 Ga0466970_0004171 3300044765 Bacteria 7108
186 Ga0466970_0011583 3300044765 Bacteria 4498
187 Ga0466970_0025711 3300044765 Bacteria 3084
188 Ga0466970_0057816 3300044765 Bacteria 2075
189 Ga0466957_0031404 3300044842 Bacteria 3174
190 Ga0466957_0033117 3300044842 Bacteria 3099
191 Ga0466960_0000310 3300044901 Bacteria 16844
192 Ga0466960_0030867 3300044901 Bacteria 2469
193 Ga0466960_0125296 3300044901 Bacteria 1350
194 Ga0466960_0145494 3300044901 Bacteria 1262
195 Ga0466959_0081892 3300045049 Bacteria 2326
196 Ga0466959_0169021 3300045049 Bacteria 1534
197 Ga0466958_0355947 3300045836 Bacteria 943
198 Ga0466958_0382703 3300045836 Bacteria 907
199 Ga0466967_0002896 3300045976 Bacteria 10926
200 Ga0466967_0038411 3300045976 Bacteria 4106
201 Ga0466967_0092788 3300045976 Bacteria 2746
202 Ga0466967_0106152 3300045976 Bacteria 2574
203 Ga0466967_0181841 3300045976 Bacteria 1984
204 Ga0466967_0196893 3300045976 Bacteria 1907
205 Ga0466967_0243324 3300045976 Bacteria 1717
206 Ga0466967_0278847 3300045976 Bacteria 1603
207 Ga0466967_0403085 3300045976 Bacteria 1331
208 Ga0466967_0418703 3300045976 Bacteria 1305
209 Ga0466967_0577232 3300045976 Bacteria 1108
210 Ga0495603_0017606 3300046455 Bacteria 4327
211 Ga0495603_0232771 3300046455 Bacteria 1062
212 Ga0495629_0003029 3300046459 Bacteria 12770
213 Ga0495641_0012059 3300046461 Bacteria 4868
214 Ga0495641_0045755 3300046461 Bacteria 2014
215 Ga0495651_0030861 3300046462 Bacteria 4179
216 Ga0495651_0040271 3300046462 Bacteria 3634
217 Ga0495653_0031811 3300046463 Bacteria 4192
218 Ga0495653_0085414 3300046463 Bacteria 2321
219 Ga0495580_0179870 3300046472 Bacteria 1460
220 Ga0495582_0022452 3300046473 Bacteria 3453
221 Ga0495582_0061747 3300046473 Bacteria 2070
222 Ga0495662_0012063 3300046476 Bacteria 4223
223 Ga0495664_0065794 3300046477 Bacteria 2161
224 Ga0495664_0386958 3300046477 Bacteria 841
225 Ga0495608_0002117 3300046511 Bacteria 14299
226 Ga0495618_0129357 3300046514 Bacteria 1616
227 Ga0495618_0151282 3300046514 Bacteria 1482
228 Ga0495630_0010674 3300046517 Bacteria 6631
229 Ga0495652_0005101 3300046529 Bacteria 12414
230 Ga0495665_0010408 3300046531 Bacteria 5032
231 Ga0495640_0053517 3300046533 Bacteria 2767
232 Ga0495645_0110017 3300046543 Bacteria 1950
233 Ga0495667_0006437 3300046559 Bacteria 7966
234 Ga0495667_0321250 3300046559 Bacteria 979
235 Ga0495634_0097287 3300046642 Bacteria 1905
236 Ga0495634_0141207 3300046642 Bacteria 1529
237 Ga0495635_0003312 3300046663 Bacteria 11134
238 Ga0495635_0032209 3300046663 Bacteria 3637
239 Ga0495657_0012276 3300046675 Bacteria 6365
240 Ga0495599_0020542 3300046678 Bacteria 4113
241 Ga0495599_0073252 3300046678 Bacteria 2138
242 Ga0495599_0099949 3300046678 Bacteria 1808
243 Ga0495623_0155795 3300046679 Bacteria 1346
244 Ga0495646_0011064 3300046680 Bacteria 5731
245 Ga0495647_0063689 3300046681 Bacteria 1460
246 Ga0495658_0179971 3300046683 Bacteria 1311
247 Ga0495613_0075281 3300046689 Bacteria 2457
248 Ga0495649_0189733 3300046694 Bacteria 1070
249 Ga0495600_0027909 3300046809 Bacteria 3650
250 Ga0495581_0040102 3300047315 Bacteria 2710
251 Ga0495604_0037138 3300047317 Bacteria 3838
252 Ga0495674_0005889 3300047319 Bacteria 11761
253 Ga0495674_0020909 3300047319 Bacteria 6058
254 Ga0495674_0125476 3300047319 Bacteria 2166
255 Ga0495676_0180311 3300047321 Bacteria 1480
256 Ga0495680_0004304 3300047322 Bacteria 13657
257 Ga0495680_0036035 3300047322 Bacteria 3977
258 Ga0495684_0013614 3300047471 Bacteria 6263
259 Ga0495593_0013489 3300047673 Bacteria 4660
260 Ga0495602_0021573 3300048088 Bacteria 6333
261 Ga0496100_0139879 3300048903 Bacteria 1714
262 Ga0496100_0155920 3300048903 Bacteria 1633
263 Ga0496101_0030853 3300048904 Bacteria 3763
264 Ga0496101_0132014 3300048904 Bacteria 1897
265 Ga0496101_0136799 3300048904 Bacteria 1865
266 Ga0496101_0160947 3300048904 Bacteria 1721
267 Ga0496101_0262964 3300048904 Bacteria 1346
268 Ga0496102_0080196 3300048905 Bacteria 3006
269 Ga0496102_0184487 3300048905 Bacteria 1966
270 Ga0496102_0455241 3300048905 Bacteria 1200
271 Ga0496103_0004301 3300048906 Bacteria 8655
272 Ga0496104_0006177 3300048907 Bacteria 10520
273 Ga0496104_0074982 3300048907 Bacteria 3221
274 Ga0496104_0077428 3300048907 Bacteria 3169
275 Ga0496105_0002415 3300048908 Bacteria 13531
276 Ga0496105_0013553 3300048908 Bacteria 6476
277 Ga0496105_0214927 3300048908 Bacteria 1566
278 Ga0496105_0331965 3300048908 Bacteria 1217
279 Ga0496105_0341649 3300048908 Bacteria 1197
280 Ga0496106_0464886 3300048909 Bacteria 1016
281 Ga0496107_0023405 3300048910 Bacteria 4368
282 Ga0496107_0024022 3300048910 Bacteria 4309
283 Ga0496108_0010061 3300048911 Bacteria 7673
284 Ga0496108_0071613 3300048911 Bacteria 2925
285 Ga0496108_0109773 3300048911 Bacteria 2358
286 Ga0496108_0138072 3300048911 Bacteria 2099
287 Ga0496108_0140387 3300048911 Bacteria 2081
288 Ga0496108_0148333 3300048911 Bacteria 2023
289 Ga0496108_0165467 3300048911 Bacteria 1912
290 Ga0496108_0240782 3300048911 Bacteria 1574
291 Ga0496109_0014091 3300048912 Bacteria 6950
292 Ga0496109_0213319 3300048912 Bacteria 1815
293 Ga0496109_0278215 3300048912 Bacteria 1577
294 Ga0496109_0429644 3300048912 Bacteria 1248
295 Ga0496109_0584588 3300048912 Bacteria 1052
296 Ga0496110_0049593 3300048913 Bacteria 3683
297 Ga0496110_0104513 3300048913 Bacteria 2541
298 Ga0496110_0415998 3300048913 Bacteria 1225
299 Ga0496110_0953112 3300048913 Bacteria 765
300 Ga0496112_0008834 3300048915 Bacteria 9040
301 Ga0496112_0379420 3300048915 Bacteria 1355
302 Ga0496113_0067988 3300048916 Bacteria 2703
303 Ga0496114_0007668 3300048917 Bacteria 8534
304 Ga0496114_0060173 3300048917 Bacteria 3174
305 Ga0496114_0119912 3300048917 Bacteria 2262
306 Ga0496114_0143815 3300048917 Bacteria 2066
307 Ga0496114_0184867 3300048917 Bacteria 1821
308 Ga0496114_0398253 3300048917 Bacteria 1219
309 Ga0496114_0426535 3300048917 Bacteria 1175
310 Ga0496114_0516062 3300048917 Bacteria 1057
311 Ga0496115_0012442 3300048918 Bacteria 6405
312 Ga0496115_0029133 3300048918 Bacteria 4334
313 Ga0496115_0084420 3300048918 Bacteria 2589
314 Ga0496115_0089119 3300048918 Bacteria 2519
315 Ga0496119_0005013 3300048922 Bacteria 12909
316 Ga0496119_0179072 3300048922 Bacteria 1113
317 Ga0496126_0001681 3300048929 Bacteria 33084
318 Ga0501034_0002149 3300049571 Bacteria 24475
319 Ga0501034_0033319 3300049571 Bacteria 5228
320 Ga0501034_0054614 3300049571 Bacteria 4021
321 Ga0501036_0013395 3300049572 Bacteria 6815
322 Ga0501036_0065700 3300049572 Bacteria 3069
323 Ga0501037_0009499 3300049573 Bacteria 7137
324 Ga0501037_0011427 3300049573 Bacteria 6534
325 Ga0501038_0008765 3300049574 Bacteria 9277
326 Ga0501038_0024202 3300049574 Bacteria 5418
327 Ga0501042_0397722 3300049578 Bacteria 998
328 Ga0501043_0023842 3300049579 Bacteria 4799
329 Ga0501043_0512632 3300049579 Bacteria 895
330 Ga0501046_0000193 3300049580 Bacteria 62517
331 Ga0501046_0003891 3300049580 Bacteria 13653
332 Ga0501046_0029865 3300049580 Bacteria 4429
333 Ga0501046_0476110 3300049580 Bacteria 896
334 Ga0501047_0030725 3300049581 Bacteria 5177
335 Ga0501047_0075987 3300049581 Bacteria 3232
336 Ga0501048_0013374 3300049582 Bacteria 6090
337 Ga0501048_0033333 3300049582 Bacteria 3721
338 Ga0501048_0422897 3300049582 Bacteria 953
339 Ga0501067_0002399 3300049583 Bacteria 10349
340 Ga0501067_0005429 3300049583 Bacteria 7077
341 Ga0501067_0007458 3300049583 Bacteria 6077
342 Ga0501067_0048517 3300049583 Bacteria 2354
343 Ga0501067_0149372 3300049583 Bacteria 1302
344 Ga0501067_0175662 3300049583 Bacteria 1193
345 Ga0501068_0001425 3300049584 Bacteria 12697
346 Ga0501068_0023927 3300049584 Bacteria 3582
347 Ga0501069_0042900 3300049585 Bacteria 2503
348 Ga0501069_0097167 3300049585 Bacteria 1669
349 Ga0501069_0202547 3300049585 Bacteria 1150
350 Ga0501070_0001846 3300049586 Bacteria 18695
351 Ga0501070_0001880 3300049586 Bacteria 18565
352 Ga0501070_0018420 3300049586 Bacteria 5859
353 Ga0501070_0019307 3300049586 Bacteria 5716
354 Ga0501070_0032744 3300049586 Bacteria 4349
355 Ga0501070_0128556 3300049586 Bacteria 2093
356 Ga0501070_0221288 3300049586 Bacteria 1552
357 Ga0501070_0346628 3300049586 Bacteria 1206
358 Ga0501071_0033630 3300049587 Bacteria 3642
359 Ga0501072_0074000 3300049588 Bacteria 2693
360 Ga0501073_0006388 3300049589 Bacteria 8772
361 Ga0501073_0023627 3300049589 Bacteria 4411
362 Ga0501073_0141003 3300049589 Bacteria 1670
363 Ga0501074_0014384 3300049590 Bacteria 5759
364 Ga0501074_0014575 3300049590 Bacteria 5720
365 Ga0501074_0307387 3300049590 Bacteria 1126
366 Ga0501076_0084829 3300049592 Bacteria 2545
367 Ga0501077_0044158 3300049593 Bacteria 2832
368 Ga0501079_0497576 3300049741 Bacteria 958
369 Ga0501080_0003208 3300049742 Bacteria 14423
370 Ga0501080_0055108 3300049742 Bacteria 3703
371 Ga0501083_0010564 3300049744 Bacteria 6499
372 Ga0501035_0003234 3300049822 Bacteria 15607
373 Ga0501035_0035133 3300049822 Bacteria 4549
374 Ga0501035_0678980 3300049822 Bacteria 832
375 Ga0501044_0001815 3300049823 Bacteria 24871
376 Ga0501044_0092403 3300049823 Bacteria 3051
377 Ga0501044_0445882 3300049823 Bacteria 1201
378 nmdc:mga0yw44_22554_c1 3300050492 Bacteria 3532
379 nmdc:mga08y16_184783_c1 3300050511 Bacteria 2164
380 Ga0495619_0026239 3300053085 Bacteria 3747
381 Ga0495619_0185326 3300053085 Bacteria 1440
382 Ga0500556_0000598 3300053104 Bacteria 23494
383 Ga0500593_000164 3300053117 Bacteria 26696
384 Ga0500573_0013896 3300053140 Bacteria 4548
385 Ga0500579_120343 3300053143 Bacteria 1276
386 Ga0500600_0011631 3300053149 Bacteria 5343
387 Ga0501082_0231961 3300060353 Bacteria 1606
388 Ga0466962_0022377 3300061719 Bacteria 3038
389 Ga0466962_0073671 3300061719 Bacteria 1632
390 Ga0530510_0135083 3300061734 Bacteria 1816
391 Ga0530510_0142996 3300061734 Bacteria 1763
392 2644093725 2643221615 Bacteria 5487866
393 2644323568 2643221657 Bacteria 5490246
394 2644516849 2643221692 Bacteria 7282860
395 2738871487 2738541305 Bacteria 4910150
396 2739606395 2739367654 Bacteria 6049412
397 2809198761 2808606439 Bacteria 5952208
398 2812333582 2811994874 Bacteria 5367947
399 2812352669 2811994878 Bacteria 5992952
400 2895660948 2895660088 Bacteria 3782833
401 2919397007 2919395869 Bacteria 3704152
402 2919715747 2919713450 Bacteria 7431245
403 8004215380 8004212874 Bacteria 2861420
404 JGI24738J21930_10008009
405 JGI24740J21852_10015407
406 JGI24740J21852_10019513
407 JGI24735J21928_10012384
408 rootH1_10076822
409 Ga0070683_100302158
410 Ga0070683_100322649
411 Ga0070682_100011863
412 Ga0068868_100072967
413 Ga0070689_100178972
414 Ga0070692_10018455
415 Ga0070692_10103034
416 Ga0070671_100339118
417 Ga0070673_100235391
418 Ga0070709_10018329
419 Ga0070710_10003839
420 Ga0070701_10036255
421 Ga0070711_100075252
422 Ga0070678_100164975
423 Ga0070706_100008552
424 Ga0070698_100005832
425 Ga0070679_100187442
426 Ga0070684_100074576
427 Ga0070684_100348402
428 Ga0068853_100104427
429 Ga0070672_100123203
430 Ga0070665_100000151
431 Ga0068854_100185129
432 Ga0068856_100088345
433 Ga0068856_100275256
434 Ga0068852_100012902
435 Ga0068852_100233301
436 Ga0068860_100802078
437 Ga0070717_10005280
438 Ga0070717_10064866
439 Ga0075365_10249839
440 Ga0075365_10302563
441 Ga0075365_10427007
442 Ga0070715_10006276
443 Ga0070716_100010950
444 Ga0070712_100212541
445 Ga0070712_100329645
446 Ga0068865_100041811
447 Ga0111539_10015445
448 Ga0105245_10061498
449 Ga0105245_10424657
450 Ga0105243_10005136
451 Ga0105243_10021870
452 Ga0105243_10027132
453 Ga0105243_10492418
454 Ga0105242_10334151
455 Ga0105248_11031666
456 Ga0105237_10426505
457 Ga0105238_10471239
458 Ga0105249_10132096
459 Ga0105239_10081240
460 Ga0157369_10382513
461 Ga0157369_10449307
462 Ga0157369_11184288
463 Ga0171462_1005
464 Ga0157372_10106443
465 Ga0157372_10111102
466 Ga0157372_10149807
467 Ga0157372_10369774
468 Ga0157372_10455173
469 Ga0157375_10140975
470 Ga0157375_10302233
471 Ga0157375_10359766
472 Ga0157375_10773096
473 Ga0163163_10387893
474 Ga0157380_10009167
475 Ga0182008_10070001
476 Ga0157377_10031271
477 Ga0157376_10911980
478 Ga0163161_10046906
479 Ga0163161_10281012
480 Ga0206351_10059937
481 Ga0154015_1336322
482 Ga0207655_1005250
483 Ga0207692_10049159
484 Ga0207692_10058706
485 Ga0207642_10024825
486 Ga0207688_10013438
487 Ga0207685_10057012
488 Ga0207699_10002543
489 Ga0207643_10009000
490 Ga0207705_10038705
491 Ga0207684_10002209
492 Ga0207707_10408893
493 Ga0207671_10483113
494 Ga0207693_10034823
495 Ga0207693_10307542
496 Ga0207663_10039811
497 Ga0207657_10115141
498 Ga0207652_10053580
499 Ga0207659_10087391
500 Ga0207687_10318862
501 Ga0207700_10008137
502 Ga0207664_10000495
503 Ga0207709_10003085
504 Ga0207709_10009370
505 Ga0207709_10158643
506 Ga0207704_10070226
507 Ga0207665_10020615
508 Ga0207691_10001309
509 Ga0207711_10110811
510 Ga0207661_10065578
511 Ga0207661_10156065
512 Ga0207661_10275921
513 Ga0207640_10048734
514 Ga0207640_10367110
515 Ga0207677_10052468
516 Ga0207703_10051914
517 Ga0207678_10116250
518 Ga0207708_10011997
519 Ga0207702_10260465
520 Ga0207702_10392290
521 Ga0207648_10001262
522 Ga0207675_100002583
523 Ga0207675_100112060
524 Ga0207683_10029999
525 Ga0207683_10368017
526 Ga0207683_10738755
527 Ga0207698_10144774
528 Ga0268266_10005038
529 Ga0268264_10492745
530 Ga0265338_10004057
531 Ga0307408_100143094
532 Ga0307516_10019469
533 Ga0307516_10123582
534 Ga0307516_10375087
535 Ga0307405_10132599
536 Ga0307413_10336518
537 Ga0307406_10008775
538 Ga0307407_10043342
539 Ga0307416_100034667
540 Ga0307416_100174850
541 Ga0307414_10088071
542 Ga0307411_10068476
543 Ga0307415_100006280
544 Ga0307415_100020502
545 Ga0307415_100030700
546 Ga0373954_0135775
547 Ga0373946_0011478
548 Ga0373931_0259522
549 Ga0373935_0211055
550 Ga0373935_0232934
551 Ga0373935_0358989
552 Ga0373933_0042515
553 Ga0373947_0074192
554 Ga0373937_0042472
555 Ga0373925_0004146
556 Ga0373925_0122905
557 Ga0373925_0331914
558 Ga0395899_0110906
559 Ga0395900_0016786
560 Ga0395900_0027655
561 Ga0395900_0051367
562 Ga0395898_0021584
563 Ga0395898_0127892
564 Ga0395898_0396808
565 Ga0395898_0551360
566 Ga0395901_0024635
567 Ga0395901_0447712
568 Ga0451787_020072
569 Ga0451793_0557620
570 Ga0451800_0832002
571 Ga0451853_0415050
572 Ga0466972_0017112
573 Ga0466972_0039088
574 Ga0466965_0169735
575 Ga0466966_0037332
576 Ga0466966_0134447
577 Ga0466966_0270105
578 Ga0466961_0035501
579 Ga0466961_0084172
580 Ga0466961_0319164
581 Ga0466963_0006187
582 Ga0466963_0030406
583 Ga0466964_0159515
584 Ga0466971_0028243
585 Ga0466971_0063152
586 Ga0466971_0083782
587 Ga0466970_0000403
588 Ga0466970_0004171
589 Ga0466970_0011583
590 Ga0466970_0025711
591 Ga0466970_0057816
592 Ga0466957_0031404
593 Ga0466957_0033117
594 Ga0466960_0000310
595 Ga0466960_0030867
596 Ga0466960_0125296
597 Ga0466960_0145494
598 Ga0466959_0081892
599 Ga0466959_0169021
600 Ga0466958_0355947
601 Ga0466958_0382703
602 Ga0466967_0002896
603 Ga0466967_0038411
604 Ga0466967_0092788
605 Ga0466967_0106152
606 Ga0466967_0181841
607 Ga0466967_0196893
608 Ga0466967_0243324
609 Ga0466967_0278847
610 Ga0466967_0403085
611 Ga0466967_0418703
612 Ga0466967_0577232
613 Ga0495603_0017606
614 Ga0495603_0232771
615 Ga0495629_0003029
616 Ga0495641_0012059
617 Ga0495641_0045755
618 Ga0495651_0030861
619 Ga0495651_0040271
620 Ga0495653_0031811
621 Ga0495653_0085414
622 Ga0495580_0179870
623 Ga0495582_0022452
624 Ga0495582_0061747
625 Ga0495662_0012063
626 Ga0495664_0065794
627 Ga0495664_0386958
628 Ga0495608_0002117
629 Ga0495618_0129357
630 Ga0495618_0151282
631 Ga0495630_0010674
632 Ga0495652_0005101
633 Ga0495665_0010408
634 Ga0495640_0053517
635 Ga0495645_0110017
636 Ga0495667_0006437
637 Ga0495667_0321250
638 Ga0495634_0097287
639 Ga0495634_0141207
640 Ga0495635_0003312
641 Ga0495635_0032209
642 Ga0495657_0012276
643 Ga0495599_0020542
644 Ga0495599_0073252
645 Ga0495599_0099949
646 Ga0495623_0155795
647 Ga0495646_0011064
648 Ga0495647_0063689
649 Ga0495658_0179971
650 Ga0495613_0075281
651 Ga0495649_0189733
652 Ga0495600_0027909
653 Ga0495581_0040102
654 Ga0495604_0037138
655 Ga0495674_0005889
656 Ga0495674_0020909
657 Ga0495674_0125476
658 Ga0495676_0180311
659 Ga0495680_0004304
660 Ga0495680_0036035
661 Ga0495684_0013614
662 Ga0495593_0013489
663 Ga0495602_0021573
664 Ga0496100_0139879
665 Ga0496100_0155920
666 Ga0496101_0030853
667 Ga0496101_0132014
668 Ga0496101_0136799
669 Ga0496101_0160947
670 Ga0496101_0262964
671 Ga0496102_0080196
672 Ga0496102_0184487
673 Ga0496102_0455241
674 Ga0496103_0004301
675 Ga0496104_0006177
676 Ga0496104_0074982
677 Ga0496104_0077428
678 Ga0496105_0002415
679 Ga0496105_0013553
680 Ga0496105_0214927
681 Ga0496105_0331965
682 Ga0496105_0341649
683 Ga0496106_0464886
684 Ga0496107_0023405
685 Ga0496107_0024022
686 Ga0496108_0010061
687 Ga0496108_0071613
688 Ga0496108_0109773
689 Ga0496108_0138072
690 Ga0496108_0140387
691 Ga0496108_0148333
692 Ga0496108_0165467
693 Ga0496108_0240782
694 Ga0496109_0014091
695 Ga0496109_0213319
696 Ga0496109_0278215
697 Ga0496109_0429644
698 Ga0496109_0584588
699 Ga0496110_0049593
700 Ga0496110_0104513
701 Ga0496110_0415998
702 Ga0496110_0953112
703 Ga0496112_0008834
704 Ga0496112_0379420
705 Ga0496113_0067988
706 Ga0496114_0007668
707 Ga0496114_0060173
708 Ga0496114_0119912
709 Ga0496114_0143815
710 Ga0496114_0184867
711 Ga0496114_0398253
712 Ga0496114_0426535
713 Ga0496114_0516062
714 Ga0496115_0012442
715 Ga0496115_0029133
716 Ga0496115_0084420
717 Ga0496115_0089119
718 Ga0496119_0005013
719 Ga0496119_0179072
720 Ga0496126_0001681
721 Ga0501034_0002149
722 Ga0501034_0033319
723 Ga0501034_0054614
724 Ga0501036_0013395
725 Ga0501036_0065700
726 Ga0501037_0009499
727 Ga0501037_0011427
728 Ga0501038_0008765
729 Ga0501038_0024202
730 Ga0501042_0397722
731 Ga0501043_0023842
732 Ga0501043_0512632
733 Ga0501046_0000193
734 Ga0501046_0003891
735 Ga0501046_0029865
736 Ga0501046_0476110
737 Ga0501047_0030725
738 Ga0501047_0075987
739 Ga0501048_0013374
740 Ga0501048_0033333
741 Ga0501048_0422897
742 Ga0501067_0002399
743 Ga0501067_0005429
744 Ga0501067_0007458
745 Ga0501067_0048517
746 Ga0501067_0149372
747 Ga0501067_0175662
748 Ga0501068_0001425
749 Ga0501068_0023927
750 Ga0501069_0042900
751 Ga0501069_0097167
752 Ga0501069_0202547
753 Ga0501070_0001846
754 Ga0501070_0001880
755 Ga0501070_0018420
756 Ga0501070_0019307
757 Ga0501070_0032744
758 Ga0501070_0128556
759 Ga0501070_0221288
760 Ga0501070_0346628
761 Ga0501071_0033630
762 Ga0501072_0074000
763 Ga0501073_0006388
764 Ga0501073_0023627
765 Ga0501073_0141003
766 Ga0501074_0014384
767 Ga0501074_0014575
768 Ga0501074_0307387
769 Ga0501076_0084829
770 Ga0501077_0044158
771 Ga0501079_0497576
772 Ga0501080_0003208
773 Ga0501080_0055108
774 Ga0501083_0010564
775 Ga0501035_0003234
776 Ga0501035_0035133
777 Ga0501035_0678980
778 Ga0501044_0001815
779 Ga0501044_0092403
780 Ga0501044_0445882
781 nmdc:mga0yw44_22554_c1
782 nmdc:mga08y16_184783_c1
783 Ga0495619_0026239
784 Ga0495619_0185326
785 Ga0500556_0000598
786 Ga0500593_000164
787 Ga0500573_0013896
788 Ga0500579_120343
789 Ga0500600_0011631
790 Ga0501082_0231961
791 Ga0466962_0022377
792 Ga0466962_0073671
793 Ga0530510_0135083
794 Ga0530510_0142996
795 2644093725
796 2644323568
797 2644516849
798 2738871487
799 2739606395
800 2809198761
801 2812333582
802 2812352669
803 2895660948
804 2919397007
805 2919715747
806 8004215380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

40

246

0.81

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

75

271

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.686 26 242
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6734 26 243
7jr7-assembly1.cif.gz_B cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.6479 29 238
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.6359 23 240
6eti-assembly1.cif.gz_A structure of inhibitor-bound abcg2 0.6317 29 236
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7669 79 237 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7434 73 235 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6582 49 236 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5231 79 237 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5195 73 235 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A5P8KBN2-F1-model_v4 ATP-binding cassette domain-containing protein 0.8967 140 237 GO:0005524
GO:0016020
GO:0016887
GO:0046677
GO:0140359
AF-A0A1M4UGC5-F1-model_v4 ABC-2 type transport system permease protein 0.8956 79 236 GO:0005886
GO:0140359
AF-A0A7X6K4G1-F1-model_v4 deleted 0.892 140 243
AF-A0A5C8HJR3-F1-model_v4 Transport permease protein 0.8908 9 244 GO:0043190
GO:0140359
AF-A0A426UCU6-F1-model_v4 SseB family protein 0.8887 140 237 GO:0016020
GO:0140359

Map