F435285

General Info

Members Datasets Scaffolds Average Seq Length
403 254 806 314

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10161550|Ga0070658_101615501
Length 337
Sequence MITNKMDRLAARKIKFSVLIRSLAFTALITTVVTDAQAQKWPEKPVRIVTPFAPGGGTDVFARILAQRFSEVFGQQFFVDNRPGAGSTTGTEFVARAPADGYTFLMTSASFSFNPGLYPKLRYDSMKDFAPVSQVVAVPIVIAVLPTFPANSLQDLIKLAKSKPGQILYSSAGPGSAMHLAGALFSVVSKSDLTHVPYKGAPAAAMAVLGGEAIVTFATIETVLPLVHGKKLRPLAVSTSERAAALPDVPTAAEAGIKGYEVTGWYGLLAPASTPAAIVEQLSSEVRKALATPVLQERTAQEGAKPVGSTPPEFERFLRDEIAKWTRIIRDLGLKLD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 2738543013 Variovorax sp. BT01 Isolate Unclassified
250 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
251 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
252 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
253 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
254 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 2.48
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10161550 3300005327 Bacteria 1879
2 MBSR1b_contig_3104135 2162886012 Bacteria 1675
3 Ga0065715_10156171 3300005293 Bacteria 1675
4 Ga0065707_10003618 3300005295 Bacteria 3827
5 Ga0065707_10095302 3300005295 Bacteria 3392
6 Ga0070676_10056036 3300005328 Bacteria 2328
7 Ga0070676_10064212 3300005328 Bacteria 2188
8 Ga0070683_100005693 3300005329 Bacteria 10408
9 Ga0070690_100000075 3300005330 Bacteria 48451
10 Ga0070690_100065284 3300005330 Bacteria 2353
11 Ga0070670_100053130 3300005331 Unclassified 3479
12 Ga0070670_100185601 3300005331 Bacteria 1806
13 Ga0070677_10033628 3300005333 Bacteria 1976
14 Ga0068869_100000841 3300005334 Bacteria 17573
15 Ga0070666_10106628 3300005335 Bacteria 1935
16 Ga0070680_100001183 3300005336 Bacteria 18770
17 Ga0070680_100234605 3300005336 Bacteria 1550
18 Ga0070682_100002153 3300005337 Bacteria 10935
19 Ga0070682_100096810 3300005337 Bacteria 1941
20 Ga0068868_100000329 3300005338 Bacteria 31993
21 Ga0068868_100002518 3300005338 Bacteria 12728
22 Ga0070689_100000481 3300005340 Bacteria 23552
23 Ga0070691_10000399 3300005341 Bacteria 15765
24 Ga0070687_100000014 3300005343 Bacteria 57432
25 Ga0070687_100038910 3300005343 Bacteria 2386
26 Ga0070692_10000041 3300005345 Bacteria 24940
27 Ga0070668_100045839 3300005347 Bacteria 3354
28 Ga0070675_100094138 3300005354 Bacteria 2513
29 Ga0070675_100094178 3300005354 Unclassified 2513
30 Ga0070675_100190160 3300005354 Bacteria 1778
31 Ga0070671_100009799 3300005355 Bacteria 7689
32 Ga0070671_100044930 3300005355 Bacteria 3671
33 Ga0070674_100071789 3300005356 Bacteria 2450
34 Ga0070674_100183140 3300005356 Bacteria 1606
35 Ga0070673_100094900 3300005364 Bacteria 2446
36 Ga0070688_100002512 3300005365 Bacteria 9275
37 Ga0070688_100258007 3300005365 Bacteria 1244
38 Ga0070659_100089483 3300005366 Bacteria 2466
39 Ga0070667_100115327 3300005367 Bacteria 2333
40 Ga0070710_10089385 3300005437 Bacteria 1814
41 Ga0070701_10000641 3300005438 Bacteria 12213
42 Ga0070705_100000466 3300005440 Bacteria 23326
43 Ga0070705_100040468 3300005440 Bacteria 2651
44 Ga0070705_100065952 3300005440 Bacteria 2169
45 Ga0070705_100123054 3300005440 Bacteria 1678
46 Ga0070705_100314177 3300005440 Bacteria 1128
47 Ga0070700_100001345 3300005441 Bacteria 12219
48 Ga0070700_100035129 3300005441 Bacteria 3031
49 Ga0070694_100000099 3300005444 Bacteria 41966
50 Ga0070694_100041891 3300005444 Bacteria 3056
51 Ga0070694_100080201 3300005444 Bacteria 2267
52 Ga0070708_100101993 3300005445 Bacteria 2629
53 Ga0070708_100354514 3300005445 Bacteria 1383
54 Ga0070678_100001132 3300005456 Bacteria 14056
55 Ga0070662_100351526 3300005457 Bacteria 1208
56 Ga0070681_10004404 3300005458 Bacteria 13417
57 Ga0070681_10004819 3300005458 Bacteria 12930
58 Ga0070681_10011584 3300005458 Bacteria 8729
59 Ga0070681_10027655 3300005458 Bacteria 5701
60 Ga0070681_10363831 3300005458 Bacteria 1357
61 Ga0068867_100000174 3300005459 Bacteria 41996
62 Ga0068867_100014730 3300005459 Bacteria 5542
63 Ga0070706_100053953 3300005467 Bacteria 3711
64 Ga0070706_100226144 3300005467 Bacteria 1746
65 Ga0070706_100258324 3300005467 Bacteria 1626
66 Ga0070706_100427593 3300005467 Bacteria 1232
67 Ga0070707_100019501 3300005468 Bacteria 6389
68 Ga0070707_100025802 3300005468 Bacteria 5578
69 Ga0070707_100089003 3300005468 Bacteria 2987
70 Ga0070698_100014139 3300005471 Bacteria 8437
71 Ga0070699_100355534 3300005518 Bacteria 1320
72 Ga0070679_100110766 3300005530 Bacteria 2731
73 Ga0070684_100059589 3300005535 Bacteria 3338
74 Ga0070684_100075311 3300005535 Bacteria 2977
75 Ga0070697_100053213 3300005536 Bacteria 3290
76 Ga0068853_100050967 3300005539 Bacteria 3562
77 Ga0070672_100014809 3300005543 Bacteria 5534
78 Ga0070686_100000134 3300005544 Bacteria 51357
79 Ga0070686_100023855 3300005544 Bacteria 3662
80 Ga0070695_100000018 3300005545 Bacteria 63499
81 Ga0070695_100019646 3300005545 Bacteria 4116
82 Ga0070695_100133358 3300005545 Bacteria 1714
83 Ga0070696_100000384 3300005546 Bacteria 27119
84 Ga0070693_100000021 3300005547 Bacteria 59618
85 Ga0070693_100026437 3300005547 Bacteria 3133
86 Ga0070665_100261695 3300005548 Bacteria 1731
87 Ga0070704_100000043 3300005549 Bacteria 42411
88 Ga0070704_100026089 3300005549 Bacteria 3856
89 Ga0070704_100056903 3300005549 Bacteria 2778
90 Ga0070704_100226593 3300005549 Bacteria 1522
91 Ga0068855_100001327 3300005563 Bacteria 30611
92 Ga0068855_100016737 3300005563 Bacteria 8818
93 Ga0070664_100005855 3300005564 Bacteria 9918
94 Ga0070664_100345409 3300005564 Bacteria 1353
95 Ga0068857_100064214 3300005577 Bacteria 3264
96 Ga0068854_100039302 3300005578 Bacteria 3332
97 Ga0068854_100088844 3300005578 Bacteria 2295
98 Ga0068854_100199087 3300005578 Bacteria 1574
99 Ga0068856_100029979 3300005614 Bacteria 5317
100 Ga0070702_100000007 3300005615 Bacteria 65238
101 Ga0070702_100100663 3300005615 Bacteria 1771
102 Ga0068852_100321968 3300005616 Bacteria 1502
103 Ga0068859_100003085 3300005617 Bacteria 16902
104 Ga0068864_100171914 3300005618 Bacteria 1976
105 Ga0068864_100218328 3300005618 Bacteria 1758
106 Ga0068861_100001082 3300005719 Bacteria 16840
107 Ga0068861_100031457 3300005719 Bacteria 3899
108 Ga0068861_100135961 3300005719 Bacteria 2000
109 Ga0068851_10006074 3300005834 Bacteria 5510
110 Ga0068863_100030123 3300005841 Bacteria 5183
111 Ga0068863_100451298 3300005841 Bacteria 1262
112 Ga0068858_100000334 3300005842 Bacteria 49778
113 Ga0068858_100141732 3300005842 Bacteria 2257
114 Ga0068860_100001410 3300005843 Bacteria 26069
115 Ga0068860_100122660 3300005843 Bacteria 2489
116 Ga0068862_100000688 3300005844 Bacteria 34533
117 Ga0081455_10012806 3300005937 Bacteria 8335
118 Ga0075365_10064254 3300006038 Bacteria 2458
119 Ga0070715_10054505 3300006163 Bacteria 1732
120 Ga0097621_100000593 3300006237 Bacteria 25510
121 Ga0097621_100080198 3300006237 Bacteria 2714
122 Ga0097621_100120316 3300006237 Bacteria 2226
123 Ga0068871_100000157 3300006358 Bacteria 44850
124 Ga0068871_100145631 3300006358 Bacteria 2016
125 Ga0068871_100308537 3300006358 Bacteria 1390
126 Ga0075428_100000333 3300006844 Bacteria 46836
127 Ga0075428_100009114 3300006844 Bacteria 11011
128 Ga0075428_100432425 3300006844 Bacteria 1410
129 Ga0075430_100043179 3300006846 Bacteria 3811
130 Ga0075430_100157641 3300006846 Bacteria 1889
131 Ga0075433_10106348 3300006852 Bacteria 2487
132 Ga0075429_100000046 3300006880 Bacteria 56781
133 Ga0075429_100039770 3300006880 Bacteria 4093
134 Ga0075429_100505732 3300006880 Bacteria 1059
135 Ga0068865_100000296 3300006881 Bacteria 27405
136 Ga0068865_100078513 3300006881 Bacteria 2361
137 Ga0075436_100045259 3300006914 Bacteria 3035
138 Ga0097620_100003085 3300006931 Bacteria 16902
139 Ga0075435_100303727 3300007076 Bacteria 1365
140 Ga0099794_10014830 3300007265 Bacteria 3425
141 Ga0099795_10014963 3300007788 Bacteria 2418
142 Ga0105240_10202247 3300009093 Bacteria 2327
143 Ga0111539_10033102 3300009094 Bacteria 6276
144 Ga0111539_10154144 3300009094 Bacteria 2689
145 Ga0111539_10155063 3300009094 Bacteria 2680
146 Ga0111539_10208279 3300009094 Bacteria 2279
147 Ga0111539_10334040 3300009094 Bacteria 1764
148 Ga0105245_10777670 3300009098 Bacteria 994
149 Ga0114129_10000177 3300009147 Bacteria 70549
150 Ga0114129_10079986 3300009147 Bacteria 4544
151 Ga0114129_10231622 3300009147 Bacteria 2488
152 Ga0114129_10456490 3300009147 Bacteria 1675
153 Ga0105243_10000466 3300009148 Bacteria 41868
154 Ga0105243_10096197 3300009148 Bacteria 2449
155 Ga0105241_10230210 3300009174 Bacteria 1562
156 Ga0105242_10000191 3300009176 Bacteria 47337
157 Ga0105242_10063614 3300009176 Bacteria 3039
158 Ga0105248_10058994 3300009177 Unclassified 4310
159 Ga0105248_10185244 3300009177 Bacteria 2346
160 Ga0105248_10417956 3300009177 Bacteria 1510
161 Ga0105249_10000555 3300009553 Bacteria 34420
162 Ga0105249_10125456 3300009553 Bacteria 2444
163 Ga0105249_10273801 3300009553 Bacteria 1683
164 Ga0099796_10020378 3300010159 Bacteria 2026
165 Ga0105239_10242489 3300010375 Bacteria 2023
166 Ga0105246_10394488 3300011119 Bacteria 1147
167 Ga0157370_10081836 3300013104 Bacteria 3038
168 Ga0157374_10114612 3300013296 Bacteria 2595
169 Ga0157378_10000196 3300013297 Bacteria 58849
170 Ga0157378_10011239 3300013297 Bacteria 7832
171 Ga0157378_10071444 3300013297 Bacteria 3117
172 Ga0157378_10449025 3300013297 Bacteria 1279
173 Ga0163162_10251459 3300013306 Bacteria 1899
174 Ga0163162_10487256 3300013306 Bacteria 1364
175 Ga0157372_10094461 3300013307 Bacteria 3405
176 Ga0157375_10011582 3300013308 Bacteria 7791
177 Ga0157377_10048961 3300014745 Bacteria 2374
178 Ga0157376_10010676 3300014969 Bacteria 6733
179 Ga0157376_10089210 3300014969 Bacteria 2665
180 Ga0157376_10330157 3300014969 Bacteria 1453
181 Ga0207666_1011591 3300025271 Bacteria 1221
182 Ga0207697_10054413 3300025315 Bacteria 1658
183 Ga0207656_10025455 3300025321 Unclassified 2402
184 Ga0207685_10049446 3300025905 Bacteria 1615
185 Ga0207643_10008699 3300025908 Bacteria 5444
186 Ga0207643_10030540 3300025908 Bacteria 3000
187 Ga0207643_10089135 3300025908 Bacteria 1796
188 Ga0207643_10141450 3300025908 Bacteria 1437
189 Ga0207705_10132947 3300025909 Bacteria 1853
190 Ga0207684_10094032 3300025910 Bacteria 2557
191 Ga0207660_10000284 3300025917 Bacteria 33488
192 Ga0207660_10045040 3300025917 Bacteria 3107
193 Ga0207662_10000063 3300025918 Bacteria 46662
194 Ga0207662_10023323 3300025918 Bacteria 3555
195 Ga0207649_10049075 3300025920 Unclassified 2605
196 Ga0207646_10130635 3300025922 Bacteria 2260
197 Ga0207646_10136396 3300025922 Bacteria 2209
198 Ga0207646_10437342 3300025922 Bacteria 1180
199 Ga0207681_10050087 3300025923 Bacteria 2825
200 Ga0207650_10012814 3300025925 Bacteria 5793
201 Ga0207650_10295738 3300025925 Bacteria 1321
202 Ga0207659_10043053 3300025926 Unclassified 3169
203 Ga0207659_10067048 3300025926 Bacteria 2606
204 Ga0207659_10168611 3300025926 Bacteria 1725
205 Ga0207687_10005404 3300025927 Bacteria 8446
206 Ga0207644_10032626 3300025931 Unclassified 3634
207 Ga0207706_10194100 3300025933 Bacteria 1781
208 Ga0207686_10000623 3300025934 Bacteria 22054
209 Ga0207686_10074509 3300025934 Bacteria 2193
210 Ga0207709_10002977 3300025935 Bacteria 10317
211 Ga0207670_10001140 3300025936 Bacteria 14016
212 Ga0207670_10014698 3300025936 Bacteria 4655
213 Ga0207669_10177846 3300025937 Bacteria 1522
214 Ga0207665_10156807 3300025939 Bacteria 1634
215 Ga0207691_10024246 3300025940 Bacteria 5706
216 Ga0207691_10054113 3300025940 Unclassified 3662
217 Ga0207711_10171205 3300025941 Unclassified 1970
218 Ga0207711_10372027 3300025941 Unclassified 1325
219 Ga0207689_10000214 3300025942 Bacteria 51325
220 Ga0207689_10035555 3300025942 Bacteria 4138
221 Ga0207661_10080734 3300025944 Unclassified 2684
222 Ga0207679_10009855 3300025945 Bacteria 6134
223 Ga0207667_10112202 3300025949 Bacteria 2811
224 Ga0207651_10028783 3300025960 Bacteria 3510
225 Ga0207651_10158479 3300025960 Bacteria 1771
226 Ga0207712_10000849 3300025961 Bacteria 22242
227 Ga0207712_10048663 3300025961 Bacteria 2950
228 Ga0207640_10107462 3300025981 Bacteria 1970
229 Ga0207640_10195142 3300025981 Bacteria 1529
230 Ga0207640_10233482 3300025981 Bacteria 1417
231 Ga0207658_10227288 3300025986 Bacteria 1573
232 Ga0207677_10017345 3300026023 Unclassified 4290
233 Ga0207703_10007007 3300026035 Bacteria 8969
234 Ga0207703_10189881 3300026035 Bacteria 1819
235 Ga0207708_10000117 3300026075 Bacteria 60989
236 Ga0207708_10015786 3300026075 Bacteria 5669
237 Ga0207708_10042778 3300026075 Bacteria 3452
238 Ga0207708_10073238 3300026075 Bacteria 2625
239 Ga0207702_10009950 3300026078 Bacteria 7974
240 Ga0207641_10577887 3300026088 Bacteria 1098
241 Ga0207648_10000293 3300026089 Bacteria 54504
242 Ga0207648_10004320 3300026089 Bacteria 14631
243 Ga0207648_10023222 3300026089 Bacteria 5562
244 Ga0207648_10187529 3300026089 Bacteria 1832
245 Ga0207676_10093619 3300026095 Bacteria 2474
246 Ga0207674_10195903 3300026116 Bacteria 1970
247 Ga0207675_100000218 3300026118 Bacteria 53850
248 Ga0207675_100032595 3300026118 Bacteria 4853
249 Ga0207675_100037542 3300026118 Bacteria 4518
250 Ga0207675_100039345 3300026118 Bacteria 4413
251 Ga0207683_10004495 3300026121 Bacteria 12034
252 Ga0207683_10073924 3300026121 Bacteria 3016
253 Ga0207698_10132078 3300026142 Bacteria 2135
254 Ga0209179_1001620 3300027512 Bacteria 2824
255 Ga0210002_1014864 3300027617 Bacteria 1224
256 Ga0209971_1002327 3300027682 Bacteria 4594
257 Ga0209974_10011110 3300027876 Bacteria 3030
258 Ga0207428_10000517 3300027907 Bacteria 46100
259 Ga0207428_10050405 3300027907 Bacteria 3331
260 Ga0268266_10216690 3300028379 Bacteria 1758
261 Ga0268265_10063594 3300028380 Bacteria 2839
262 Ga0268264_10000609 3300028381 Bacteria 42936
263 Ga0268264_10212062 3300028381 Bacteria 1778
264 Ga0265334_10004730 3300028573 Bacteria 5990
265 Ga0265318_10006033 3300028577 Bacteria 5619
266 Ga0265330_10002001 3300031235 Bacteria 11302
267 Ga0265332_10001552 3300031238 Bacteria 12630
268 Ga0265332_10014904 3300031238 Bacteria 3436
269 Ga0265328_10001472 3300031239 Bacteria 10850
270 Ga0265328_10003399 3300031239 Bacteria 7035
271 Ga0265320_10005980 3300031240 Bacteria 7734
272 Ga0265320_10010558 3300031240 Bacteria 5489
273 Ga0265325_10036834 3300031241 Bacteria 2590
274 Ga0265329_10009086 3300031242 Bacteria 3729
275 Ga0265340_10028185 3300031247 Bacteria 2827
276 Ga0265331_10000638 3300031250 Bacteria 30301
277 Ga0265331_10006681 3300031250 Bacteria 6773
278 Ga0265316_10019949 3300031344 Bacteria 5718
279 Ga0265313_10045481 3300031595 Bacteria 2137
280 Ga0265314_10000675 3300031711 Bacteria 41616
281 Ga0265314_10006709 3300031711 Bacteria 10110
282 Ga0265342_10003763 3300031712 Bacteria 12237
283 Ga0265342_10043937 3300031712 Bacteria 2695
284 Ga0307415_100027683 3300032126 Unclassified 3595
285 Ga0373926_0004235 3300035083 Bacteria 4688
286 Ga0373926_0056727 3300035083 Bacteria 1422
287 Ga0373926_0093543 3300035083 Bacteria 1119
288 Ga0373944_0010573 3300035089 Bacteria 2517
289 Ga0373949_0021951 3300035090 Bacteria 1469
290 Ga0373951_0015749 3300035091 Bacteria 1704
291 Ga0373923_0012186 3300035111 Bacteria 3171
292 Ga0373932_0003120 3300035112 Bacteria 4033
293 Ga0373932_0022298 3300035112 Bacteria 1681
294 Ga0373936_0032419 3300035113 Bacteria 2066
295 Ga0373945_0009856 3300035116 Bacteria 3134
296 Ga0373945_0075611 3300035116 Bacteria 1282
297 Ga0373954_0002668 3300035118 Bacteria 7507
298 Ga0373956_0163490 3300035119 Bacteria 1049
299 Ga0373957_0074247 3300035120 Bacteria 1335
300 Ga0373943_0025555 3300035170 Bacteria 2760
301 Ga0373943_0029554 3300035170 Bacteria 2589
302 Ga0373942_0001205 3300035207 Bacteria 6822
303 Ga0373942_0114690 3300035207 Bacteria 836
304 Ga0373962_0014476 3300035242 Bacteria 2010
305 Ga0373962_0055190 3300035242 Bacteria 1154
306 Ga0373924_0008405 3300035410 Bacteria 3750
307 Ga0373931_0000197 3300035691 Bacteria 25739
308 Ga0373931_0129531 3300035691 Bacteria 1451
309 Ga0373931_0239325 3300035691 Bacteria 1100
310 Ga0373935_0247482 3300035692 Bacteria 1246
311 Ga0373927_0012018 3300035695 Bacteria 5758
312 Ga0373927_0087199 3300035695 Bacteria 2026
313 Ga0373947_0035807 3300035725 Bacteria 2940
314 Ga0373947_0095896 3300035725 Bacteria 1856
315 Ga0373937_0019578 3300036401 Bacteria 6058
316 Ga0373937_0020626 3300036401 Bacteria 5908
317 Ga0373937_0052086 3300036401 Bacteria 3752
318 Ga0373937_0121536 3300036401 Bacteria 2434
319 Ga0373925_0003212 3300037068 Bacteria 12774
320 Ga0373925_0027748 3300037068 Bacteria 4144
321 Ga0395899_0001844 3300037312 Bacteria 17542
322 Ga0395905_0009526 3300037471 Bacteria 9488
323 Ga0395905_0083979 3300037471 Bacteria 2983
324 Ga0395901_0693693 3300038443 Bacteria 1016
325 Ga0439435_0051809 3300042436 Bacteria 1177
326 Ga0451577_0073919 3300042876 Bacteria 3041
327 Ga0451577_0213429 3300042876 Bacteria 1744
328 Ga0466960_0138787 3300044901 Bacteria 1290
329 Ga0451576_0004641 3300045051 Bacteria 17714
330 Ga0451576_0009887 3300045051 Bacteria 11018
331 Ga0495592_0002154 3300046454 Bacteria 13866
332 Ga0495592_0050108 3300046454 Bacteria 3103
333 Ga0495603_0001454 3300046455 Bacteria 13776
334 Ga0495590_0007609 3300046457 Bacteria 4163
335 Ga0495653_0014863 3300046463 Bacteria 6350
336 Ga0495580_0097898 3300046472 Bacteria 2040
337 Ga0495582_0016047 3300046473 Bacteria 4107
338 Ga0495639_0010264 3300046475 Bacteria 4030
339 Ga0495594_0059842 3300046499 Bacteria 2107
340 Ga0495628_0000277 3300046516 Bacteria 45973
341 Ga0495630_0058511 3300046517 Bacteria 2889
342 Ga0495642_0033880 3300046528 Bacteria 2055
343 Ga0495652_0023138 3300046529 Bacteria 5509
344 Ga0495640_0112603 3300046533 Bacteria 1776
345 Ga0495586_0005602 3300046535 Bacteria 6721
346 Ga0495598_0008319 3300046537 Bacteria 2413
347 Ga0495621_0004995 3300046539 Bacteria 3780
348 Ga0495645_0017513 3300046543 Bacteria 5132
349 Ga0495667_0130429 3300046559 Bacteria 1621
350 Ga0495667_0257659 3300046559 Bacteria 1110
351 Ga0495659_0010017 3300046664 Bacteria 3034
352 Ga0495599_0002617 3300046678 Bacteria 10488
353 Ga0495647_0000404 3300046681 Bacteria 12359
354 Ga0495669_0068556 3300046684 Bacteria 1614
355 Ga0495600_0003687 3300046809 Bacteria 9048
356 Ga0495600_0254396 3300046809 Bacteria 1117
357 Ga0495581_0171871 3300047315 Bacteria 1267
358 Ga0495680_0076042 3300047322 Bacteria 2547
359 Ga0495684_0169371 3300047471 Bacteria 1625
360 Ga0496100_0112749 3300048903 Bacteria 1892
361 Ga0496102_0111909 3300048905 Bacteria 2546
362 Ga0496108_0112697 3300048911 Bacteria 2327
363 Ga0496108_0128932 3300048911 Bacteria 2174
364 Ga0496109_0128406 3300048912 Bacteria 2365
365 Ga0496110_0093495 3300048913 Bacteria 2692
366 Ga0496110_0342085 3300048913 Bacteria 1363
367 Ga0496111_0218732 3300048914 Bacteria 1415
368 Ga0496114_0095768 3300048917 Bacteria 2526
369 Ga0496114_0218371 3300048917 Unclassified 1673
370 Ga0501034_0010572 3300049571 Bacteria 9604
371 Ga0501046_0079851 3300049580 Bacteria 2529
372 Ga0501047_0001536 3300049581 Bacteria 22571
373 Ga0501069_0004850 3300049585 Bacteria 6966
374 Ga0501070_0007516 3300049586 Bacteria 9259
375 Ga0501073_0000778 3300049589 Bacteria 22693
376 Ga0501074_0019509 3300049590 Bacteria 4923
377 Ga0501079_0004640 3300049741 Bacteria 10176
378 Ga0501080_0022290 3300049742 Bacteria 5866
379 Ga0501080_0274620 3300049742 Bacteria 1533
380 Ga0501083_0000259 3300049744 Bacteria 33650
381 Ga0501044_0074441 3300049823 Bacteria 3450
382 nmdc:mga00v17_371167_c1 3300050491 Bacteria 930
383 nmdc:mga06z11_121695_c1 3300050494 Bacteria 1456
384 nmdc:mga05p37_344_c1 3300050507 Bacteria 49898
385 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
386 nmdc:mga05p37_61369_c1 3300050507 Bacteria 4628
387 nmdc:mga09592_26073_c1 3300050508 Bacteria 4841
388 nmdc:mga09592_6349_c1 3300050508 Bacteria 9634
389 nmdc:mga08y16_281060_c1 3300050511 Bacteria 1717
390 nmdc:mga08y16_39661_c1 3300050511 Bacteria 4940
391 nmdc:mga08y16_45825_c1 3300050511 Bacteria 4581
392 nmdc:mga08y16_9255_c1 3300050511 Bacteria 10335
393 nmdc:mga0a205_189337_c1 3300050515 Bacteria 1950
394 Ga0495601_0003338 3300053077 Bacteria 9187
395 Ga0495601_0028895 3300053077 Bacteria 3437
396 Ga0500647_0180414 3300053091 Bacteria 969
397 Ga0500590_034467 3300053148 Bacteria 2621
398 2739252109 2738543013 Bacteria 5618633
399 2881416511 2881412998 Bacteria 6492157
400 2883579932 2883577096 Bacteria 4709178
401 2894773444 2894772417 Bacteria 5305674
402 2929200646 2929199973 Bacteria 7260745
403 8055915368 8055909800 Bacteria 7278581
404 Ga0070658_10161550
405 MBSR1b_contig_3104135
406 Ga0065715_10156171
407 Ga0065707_10003618
408 Ga0065707_10095302
409 Ga0070676_10056036
410 Ga0070676_10064212
411 Ga0070683_100005693
412 Ga0070690_100000075
413 Ga0070690_100065284
414 Ga0070670_100053130
415 Ga0070670_100185601
416 Ga0070677_10033628
417 Ga0068869_100000841
418 Ga0070666_10106628
419 Ga0070680_100001183
420 Ga0070680_100234605
421 Ga0070682_100002153
422 Ga0070682_100096810
423 Ga0068868_100000329
424 Ga0068868_100002518
425 Ga0070689_100000481
426 Ga0070691_10000399
427 Ga0070687_100000014
428 Ga0070687_100038910
429 Ga0070692_10000041
430 Ga0070668_100045839
431 Ga0070675_100094138
432 Ga0070675_100094178
433 Ga0070675_100190160
434 Ga0070671_100009799
435 Ga0070671_100044930
436 Ga0070674_100071789
437 Ga0070674_100183140
438 Ga0070673_100094900
439 Ga0070688_100002512
440 Ga0070688_100258007
441 Ga0070659_100089483
442 Ga0070667_100115327
443 Ga0070710_10089385
444 Ga0070701_10000641
445 Ga0070705_100000466
446 Ga0070705_100040468
447 Ga0070705_100065952
448 Ga0070705_100123054
449 Ga0070705_100314177
450 Ga0070700_100001345
451 Ga0070700_100035129
452 Ga0070694_100000099
453 Ga0070694_100041891
454 Ga0070694_100080201
455 Ga0070708_100101993
456 Ga0070708_100354514
457 Ga0070678_100001132
458 Ga0070662_100351526
459 Ga0070681_10004404
460 Ga0070681_10004819
461 Ga0070681_10011584
462 Ga0070681_10027655
463 Ga0070681_10363831
464 Ga0068867_100000174
465 Ga0068867_100014730
466 Ga0070706_100053953
467 Ga0070706_100226144
468 Ga0070706_100258324
469 Ga0070706_100427593
470 Ga0070707_100019501
471 Ga0070707_100025802
472 Ga0070707_100089003
473 Ga0070698_100014139
474 Ga0070699_100355534
475 Ga0070679_100110766
476 Ga0070684_100059589
477 Ga0070684_100075311
478 Ga0070697_100053213
479 Ga0068853_100050967
480 Ga0070672_100014809
481 Ga0070686_100000134
482 Ga0070686_100023855
483 Ga0070695_100000018
484 Ga0070695_100019646
485 Ga0070695_100133358
486 Ga0070696_100000384
487 Ga0070693_100000021
488 Ga0070693_100026437
489 Ga0070665_100261695
490 Ga0070704_100000043
491 Ga0070704_100026089
492 Ga0070704_100056903
493 Ga0070704_100226593
494 Ga0068855_100001327
495 Ga0068855_100016737
496 Ga0070664_100005855
497 Ga0070664_100345409
498 Ga0068857_100064214
499 Ga0068854_100039302
500 Ga0068854_100088844
501 Ga0068854_100199087
502 Ga0068856_100029979
503 Ga0070702_100000007
504 Ga0070702_100100663
505 Ga0068852_100321968
506 Ga0068859_100003085
507 Ga0068864_100171914
508 Ga0068864_100218328
509 Ga0068861_100001082
510 Ga0068861_100031457
511 Ga0068861_100135961
512 Ga0068851_10006074
513 Ga0068863_100030123
514 Ga0068863_100451298
515 Ga0068858_100000334
516 Ga0068858_100141732
517 Ga0068860_100001410
518 Ga0068860_100122660
519 Ga0068862_100000688
520 Ga0081455_10012806
521 Ga0075365_10064254
522 Ga0070715_10054505
523 Ga0097621_100000593
524 Ga0097621_100080198
525 Ga0097621_100120316
526 Ga0068871_100000157
527 Ga0068871_100145631
528 Ga0068871_100308537
529 Ga0075428_100000333
530 Ga0075428_100009114
531 Ga0075428_100432425
532 Ga0075430_100043179
533 Ga0075430_100157641
534 Ga0075433_10106348
535 Ga0075429_100000046
536 Ga0075429_100039770
537 Ga0075429_100505732
538 Ga0068865_100000296
539 Ga0068865_100078513
540 Ga0075436_100045259
541 Ga0097620_100003085
542 Ga0075435_100303727
543 Ga0099794_10014830
544 Ga0099795_10014963
545 Ga0105240_10202247
546 Ga0111539_10033102
547 Ga0111539_10154144
548 Ga0111539_10155063
549 Ga0111539_10208279
550 Ga0111539_10334040
551 Ga0105245_10777670
552 Ga0114129_10000177
553 Ga0114129_10079986
554 Ga0114129_10231622
555 Ga0114129_10456490
556 Ga0105243_10000466
557 Ga0105243_10096197
558 Ga0105241_10230210
559 Ga0105242_10000191
560 Ga0105242_10063614
561 Ga0105248_10058994
562 Ga0105248_10185244
563 Ga0105248_10417956
564 Ga0105249_10000555
565 Ga0105249_10125456
566 Ga0105249_10273801
567 Ga0099796_10020378
568 Ga0105239_10242489
569 Ga0105246_10394488
570 Ga0157370_10081836
571 Ga0157374_10114612
572 Ga0157378_10000196
573 Ga0157378_10011239
574 Ga0157378_10071444
575 Ga0157378_10449025
576 Ga0163162_10251459
577 Ga0163162_10487256
578 Ga0157372_10094461
579 Ga0157375_10011582
580 Ga0157377_10048961
581 Ga0157376_10010676
582 Ga0157376_10089210
583 Ga0157376_10330157
584 Ga0207666_1011591
585 Ga0207697_10054413
586 Ga0207656_10025455
587 Ga0207685_10049446
588 Ga0207643_10008699
589 Ga0207643_10030540
590 Ga0207643_10089135
591 Ga0207643_10141450
592 Ga0207705_10132947
593 Ga0207684_10094032
594 Ga0207660_10000284
595 Ga0207660_10045040
596 Ga0207662_10000063
597 Ga0207662_10023323
598 Ga0207649_10049075
599 Ga0207646_10130635
600 Ga0207646_10136396
601 Ga0207646_10437342
602 Ga0207681_10050087
603 Ga0207650_10012814
604 Ga0207650_10295738
605 Ga0207659_10043053
606 Ga0207659_10067048
607 Ga0207659_10168611
608 Ga0207687_10005404
609 Ga0207644_10032626
610 Ga0207706_10194100
611 Ga0207686_10000623
612 Ga0207686_10074509
613 Ga0207709_10002977
614 Ga0207670_10001140
615 Ga0207670_10014698
616 Ga0207669_10177846
617 Ga0207665_10156807
618 Ga0207691_10024246
619 Ga0207691_10054113
620 Ga0207711_10171205
621 Ga0207711_10372027
622 Ga0207689_10000214
623 Ga0207689_10035555
624 Ga0207661_10080734
625 Ga0207679_10009855
626 Ga0207667_10112202
627 Ga0207651_10028783
628 Ga0207651_10158479
629 Ga0207712_10000849
630 Ga0207712_10048663
631 Ga0207640_10107462
632 Ga0207640_10195142
633 Ga0207640_10233482
634 Ga0207658_10227288
635 Ga0207677_10017345
636 Ga0207703_10007007
637 Ga0207703_10189881
638 Ga0207708_10000117
639 Ga0207708_10015786
640 Ga0207708_10042778
641 Ga0207708_10073238
642 Ga0207702_10009950
643 Ga0207641_10577887
644 Ga0207648_10000293
645 Ga0207648_10004320
646 Ga0207648_10023222
647 Ga0207648_10187529
648 Ga0207676_10093619
649 Ga0207674_10195903
650 Ga0207675_100000218
651 Ga0207675_100032595
652 Ga0207675_100037542
653 Ga0207675_100039345
654 Ga0207683_10004495
655 Ga0207683_10073924
656 Ga0207698_10132078
657 Ga0209179_1001620
658 Ga0210002_1014864
659 Ga0209971_1002327
660 Ga0209974_10011110
661 Ga0207428_10000517
662 Ga0207428_10050405
663 Ga0268266_10216690
664 Ga0268265_10063594
665 Ga0268264_10000609
666 Ga0268264_10212062
667 Ga0265334_10004730
668 Ga0265318_10006033
669 Ga0265330_10002001
670 Ga0265332_10001552
671 Ga0265332_10014904
672 Ga0265328_10001472
673 Ga0265328_10003399
674 Ga0265320_10005980
675 Ga0265320_10010558
676 Ga0265325_10036834
677 Ga0265329_10009086
678 Ga0265340_10028185
679 Ga0265331_10000638
680 Ga0265331_10006681
681 Ga0265316_10019949
682 Ga0265313_10045481
683 Ga0265314_10000675
684 Ga0265314_10006709
685 Ga0265342_10003763
686 Ga0265342_10043937
687 Ga0307415_100027683
688 Ga0373926_0004235
689 Ga0373926_0056727
690 Ga0373926_0093543
691 Ga0373944_0010573
692 Ga0373949_0021951
693 Ga0373951_0015749
694 Ga0373923_0012186
695 Ga0373932_0003120
696 Ga0373932_0022298
697 Ga0373936_0032419
698 Ga0373945_0009856
699 Ga0373945_0075611
700 Ga0373954_0002668
701 Ga0373956_0163490
702 Ga0373957_0074247
703 Ga0373943_0025555
704 Ga0373943_0029554
705 Ga0373942_0001205
706 Ga0373942_0114690
707 Ga0373962_0014476
708 Ga0373962_0055190
709 Ga0373924_0008405
710 Ga0373931_0000197
711 Ga0373931_0129531
712 Ga0373931_0239325
713 Ga0373935_0247482
714 Ga0373927_0012018
715 Ga0373927_0087199
716 Ga0373947_0035807
717 Ga0373947_0095896
718 Ga0373937_0019578
719 Ga0373937_0020626
720 Ga0373937_0052086
721 Ga0373937_0121536
722 Ga0373925_0003212
723 Ga0373925_0027748
724 Ga0395899_0001844
725 Ga0395905_0009526
726 Ga0395905_0083979
727 Ga0395901_0693693
728 Ga0439435_0051809
729 Ga0451577_0073919
730 Ga0451577_0213429
731 Ga0466960_0138787
732 Ga0451576_0004641
733 Ga0451576_0009887
734 Ga0495592_0002154
735 Ga0495592_0050108
736 Ga0495603_0001454
737 Ga0495590_0007609
738 Ga0495653_0014863
739 Ga0495580_0097898
740 Ga0495582_0016047
741 Ga0495639_0010264
742 Ga0495594_0059842
743 Ga0495628_0000277
744 Ga0495630_0058511
745 Ga0495642_0033880
746 Ga0495652_0023138
747 Ga0495640_0112603
748 Ga0495586_0005602
749 Ga0495598_0008319
750 Ga0495621_0004995
751 Ga0495645_0017513
752 Ga0495667_0130429
753 Ga0495667_0257659
754 Ga0495659_0010017
755 Ga0495599_0002617
756 Ga0495647_0000404
757 Ga0495669_0068556
758 Ga0495600_0003687
759 Ga0495600_0254396
760 Ga0495581_0171871
761 Ga0495680_0076042
762 Ga0495684_0169371
763 Ga0496100_0112749
764 Ga0496102_0111909
765 Ga0496108_0112697
766 Ga0496108_0128932
767 Ga0496109_0128406
768 Ga0496110_0093495
769 Ga0496110_0342085
770 Ga0496111_0218732
771 Ga0496114_0095768
772 Ga0496114_0218371
773 Ga0501034_0010572
774 Ga0501046_0079851
775 Ga0501047_0001536
776 Ga0501069_0004850
777 Ga0501070_0007516
778 Ga0501073_0000778
779 Ga0501074_0019509
780 Ga0501079_0004640
781 Ga0501080_0022290
782 Ga0501080_0274620
783 Ga0501083_0000259
784 Ga0501044_0074441
785 nmdc:mga00v17_371167_c1
786 nmdc:mga06z11_121695_c1
787 nmdc:mga05p37_344_c1
788 nmdc:mga05p37_355_c1
789 nmdc:mga05p37_61369_c1
790 nmdc:mga09592_26073_c1
791 nmdc:mga09592_6349_c1
792 nmdc:mga08y16_281060_c1
793 nmdc:mga08y16_39661_c1
794 nmdc:mga08y16_45825_c1
795 nmdc:mga08y16_9255_c1
796 nmdc:mga0a205_189337_c1
797 Ga0495601_0003338
798 Ga0495601_0028895
799 Ga0500647_0180414
800 Ga0500590_034467
801 2739252109
802 2881416511
803 2883579932
804 2894773444
805 2929200646
806 8055915368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

61

334

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9668 27 322
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9636 27 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.958 26 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9548 26 322
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9433 29 319
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9547 125 241 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9464 125 246 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9455 25 322 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9401 25 322 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9369 125 246 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A157SPL6-F1-model_v4 Putattive exported protein 0.9786 25 322
AF-A0A439F197-F1-model_v4 deleted 0.9784 80 322
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9778 55 322
AF-A0A1F4DK31-F1-model_v4 LacI family transcriptional regulator 0.9771 18 322
AF-A0A1H7LIE8-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.977 20 322

Map