F435286

General Info

Members Datasets Scaffolds Average Seq Length
403 237 398 120

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10626794|Ga0070658_106267941
Length 121
Sequence MPRYVDGFVVPVPKRKLAAYKAMARRGAKVWIEHGALEYVECMADDVKWGKRTSFPRSVKMKRPTETVFFSYIVYKSRRDRDRIMKKVMADPRLADMMDMKSLPFDARRMVMGGFKVVVAK

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 1.49
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10626794 3300005327 Bacteria 933
2 Ga0070676_10519359 3300005328 Bacteria 848
3 Ga0070683_100004225 3300005329 Bacteria 11777
4 Ga0070690_100098795 3300005330 Bacteria 1933
5 Ga0070690_100468004 3300005330 Bacteria 937
6 Ga0070677_10634647 3300005333 Unclassified 595
7 Ga0068869_100153191 3300005334 Bacteria 1789
8 Ga0068869_100216673 3300005334 Bacteria 1516
9 Ga0070666_10022167 3300005335 Bacteria 4122
10 Ga0070666_10088326 3300005335 Bacteria 2127
11 Ga0070680_100619419 3300005336 Bacteria 929
12 Ga0070680_100954544 3300005336 Bacteria 740
13 Ga0068868_100451215 3300005338 Bacteria 1119
14 Ga0070660_100061492 3300005339 Bacteria 2916
15 Ga0070660_100729123 3300005339 Bacteria 832
16 Ga0070689_100138471 3300005340 Bacteria 1956
17 Ga0070689_101576806 3300005340 Bacteria 596
18 Ga0070691_10704345 3300005341 Bacteria 606
19 Ga0070661_100018079 3300005344 Bacteria 5007
20 Ga0070661_100101614 3300005344 Bacteria 2139
21 Ga0070661_100468992 3300005344 Bacteria 1004
22 Ga0070692_11182911 3300005345 Bacteria 544
23 Ga0070669_100483300 3300005353 Bacteria 1025
24 Ga0070675_100275577 3300005354 Bacteria 1477
25 Ga0070675_102219168 3300005354 Bacteria 506
26 Ga0070671_100072562 3300005355 Bacteria 2875
27 Ga0070671_100127713 3300005355 Bacteria 2141
28 Ga0070671_100709446 3300005355 Bacteria 873
29 Ga0070673_100408026 3300005364 Unclassified 1216
30 Ga0070673_101647215 3300005364 Bacteria 607
31 Ga0070688_100189551 3300005365 Bacteria 1432
32 Ga0070659_100342072 3300005366 Bacteria 1254
33 Ga0070659_100366208 3300005366 Bacteria 1212
34 Ga0070667_100050335 3300005367 Bacteria 3511
35 Ga0070667_100128235 3300005367 Bacteria 2212
36 Ga0070709_11502036 3300005434 Unclassified 547
37 Ga0070705_100234709 3300005440 Bacteria 1278
38 Ga0070705_101314615 3300005440 Bacteria 600
39 Ga0070678_100222548 3300005456 Bacteria 1569
40 Ga0070678_100652513 3300005456 Bacteria 944
41 Ga0070662_100073291 3300005457 Bacteria 2530
42 Ga0068867_101634053 3300005459 Unclassified 603
43 Ga0070706_100508186 3300005467 Bacteria 1121
44 Ga0070699_100178927 3300005518 Bacteria 1881
45 Ga0070699_100636581 3300005518 Bacteria 973
46 Ga0070684_100474439 3300005535 Bacteria 1157
47 Ga0070697_100606897 3300005536 Bacteria 962
48 Ga0068853_100001459 3300005539 Bacteria 17148
49 Ga0068853_100773613 3300005539 Bacteria 918
50 Ga0068853_101788006 3300005539 Bacteria 596
51 Ga0070686_100118154 3300005544 Bacteria 1817
52 Ga0070695_100040396 3300005545 Bacteria 2953
53 Ga0070695_101156303 3300005545 Bacteria 635
54 Ga0070695_101807810 3300005545 Bacteria 513
55 Ga0070696_100121020 3300005546 Bacteria 1894
56 Ga0070696_100221634 3300005546 Bacteria 1419
57 Ga0070696_100229128 3300005546 Bacteria 1397
58 Ga0070696_100417357 3300005546 Bacteria 1053
59 Ga0070696_100431351 3300005546 Bacteria 1037
60 Ga0070693_100002180 3300005547 Bacteria 8972
61 Ga0070665_100274694 3300005548 Bacteria 1687
62 Ga0070665_100373043 3300005548 Bacteria 1434
63 Ga0070665_100504132 3300005548 Bacteria 1222
64 Ga0070665_101935865 3300005548 Bacteria 595
65 Ga0070704_100370332 3300005549 Bacteria 1214
66 Ga0070704_100945008 3300005549 Bacteria 777
67 Ga0070704_101762544 3300005549 Bacteria 573
68 Ga0068855_100027022 3300005563 Bacteria 6867
69 Ga0068855_100366548 3300005563 Bacteria 1584
70 Ga0068855_100393981 3300005563 Bacteria 1519
71 Ga0068855_100549664 3300005563 Bacteria 1250
72 Ga0070664_100096886 3300005564 Bacteria 2560
73 Ga0068857_100009937 3300005577 Bacteria 8261
74 Ga0068857_101473243 3300005577 Bacteria 663
75 Ga0068856_100043830 3300005614 Bacteria 4401
76 Ga0068856_100540455 3300005614 Bacteria 1186
77 Ga0070702_100215536 3300005615 Bacteria 1280
78 Ga0068852_100003363 3300005616 Bacteria 11160
79 Ga0068852_100197122 3300005616 Bacteria 1904
80 Ga0068852_101124615 3300005616 Bacteria 806
81 Ga0068859_100243320 3300005617 Bacteria 1888
82 Ga0068864_100076657 3300005618 Bacteria 2922
83 Ga0068866_11012163 3300005718 Bacteria 591
84 Ga0068851_10727570 3300005834 Bacteria 612
85 Ga0068863_100015895 3300005841 Bacteria 7218
86 Ga0068863_101079376 3300005841 Bacteria 807
87 Ga0068858_100663224 3300005842 Bacteria 1014
88 Ga0068860_100003747 3300005843 Bacteria 15641
89 Ga0068860_100095158 3300005843 Bacteria 2839
90 Ga0068860_100165938 3300005843 Bacteria 2131
91 Ga0081539_10117295 3300005985 Bacteria 1328
92 Ga0081539_10192168 3300005985 Bacteria 949
93 Ga0075365_10768883 3300006038 Unclassified 680
94 Ga0070716_101761206 3300006173 Bacteria 512
95 Ga0075362_10385878 3300006177 Bacteria 705
96 Ga0097621_100017657 3300006237 Bacteria 5425
97 Ga0097621_100018306 3300006237 Bacteria 5345
98 Ga0097621_100106401 3300006237 Bacteria 2366
99 Ga0097621_100596602 3300006237 Bacteria 1009
100 Ga0097621_101688380 3300006237 Bacteria 603
101 Ga0097621_102094470 3300006237 Bacteria 541
102 Ga0068871_100023825 3300006358 Bacteria 4741
103 Ga0068871_100593790 3300006358 Bacteria 1006
104 Ga0068871_100602170 3300006358 Bacteria 999
105 Ga0068871_100776660 3300006358 Bacteria 882
106 Ga0075428_101407628 3300006844 Bacteria 732
107 Ga0075430_100047265 3300006846 Bacteria 3633
108 Ga0075431_101228352 3300006847 Bacteria 712
109 Ga0075433_11736761 3300006852 Bacteria 537
110 Ga0075434_100512956 3300006871 Bacteria 1219
111 Ga0068865_100880202 3300006881 Bacteria 778
112 Ga0075436_100059212 3300006914 Bacteria 2646
113 Ga0075436_100292772 3300006914 Bacteria 1166
114 Ga0097620_100243310 3300006931 Bacteria 1888
115 Ga0075435_100101649 3300007076 Bacteria 2382
116 Ga0075435_100166026 3300007076 Bacteria 1861
117 Ga0105240_10084121 3300009093 Bacteria 3902
118 Ga0105240_10127338 3300009093 Bacteria 3058
119 Ga0111539_10030029 3300009094 Bacteria 6613
120 Ga0105245_10070370 3300009098 Bacteria 3174
121 Ga0105245_10283047 3300009098 Bacteria 1621
122 Ga0105245_10506015 3300009098 Bacteria 1225
123 Ga0105245_11148302 3300009098 Bacteria 824
124 Ga0105245_11289423 3300009098 Bacteria 779
125 Ga0105247_11204062 3300009101 Bacteria 603
126 Ga0114129_10188927 3300009147 Bacteria 2798
127 Ga0114129_10229379 3300009147 Bacteria 2502
128 Ga0114129_11152046 3300009147 Bacteria 968
129 Ga0105243_10829896 3300009148 Bacteria 914
130 Ga0105243_11247320 3300009148 Bacteria 758
131 Ga0105243_11712323 3300009148 Bacteria 658
132 Ga0105241_10010818 3300009174 Bacteria 6693
133 Ga0105241_10023033 3300009174 Bacteria 4618
134 Ga0105241_11744024 3300009174 Bacteria 606
135 Ga0105241_11790097 3300009174 Bacteria 599
136 Ga0105241_12199752 3300009174 Bacteria 547
137 Ga0105242_10303335 3300009176 Bacteria 1458
138 Ga0105242_11433229 3300009176 Unclassified 719
139 Ga0105242_12683359 3300009176 Bacteria 548
140 Ga0105248_10017819 3300009177 Bacteria 7838
141 Ga0105248_10155665 3300009177 Bacteria 2579
142 Ga0105248_10443615 3300009177 Bacteria 1462
143 Ga0105248_11792087 3300009177 Bacteria 696
144 Ga0105237_10037854 3300009545 Bacteria 4874
145 Ga0105237_10090542 3300009545 Unclassified 3048
146 Ga0105238_10002280 3300009551 Bacteria 19335
147 Ga0105238_10103541 3300009551 Bacteria 2828
148 Ga0105249_10562782 3300009553 Bacteria 1192
149 Ga0105249_10746934 3300009553 Bacteria 1040
150 Ga0105239_10029331 3300010375 Bacteria 6049
151 Ga0105239_10033173 3300010375 Bacteria 5670
152 Ga0157373_10117583 3300013100 Bacteria 1869
153 Ga0157371_10266451 3300013102 Bacteria 1236
154 Ga0157371_10380855 3300013102 Bacteria 1030
155 Ga0157371_11091778 3300013102 Bacteria 612
156 Ga0157370_10026722 3300013104 Bacteria 5696
157 Ga0157370_10096274 3300013104 Bacteria 2777
158 Ga0157369_10008502 3300013105 Bacteria 11768
159 Ga0157369_10013507 3300013105 Bacteria 9229
160 Ga0157374_10450017 3300013296 Bacteria 1289
161 Ga0157374_10555783 3300013296 Bacteria 1156
162 Ga0157378_10067237 3300013297 Bacteria 3211
163 Ga0157378_10684061 3300013297 Bacteria 1044
164 Ga0157378_11768288 3300013297 Bacteria 666
165 Ga0157378_12302423 3300013297 Bacteria 590
166 Ga0163162_10302132 3300013306 Bacteria 1732
167 Ga0163162_10638489 3300013306 Bacteria 1189
168 Ga0163162_11494043 3300013306 Bacteria 770
169 Ga0163162_12269397 3300013306 Bacteria 623
170 Ga0157372_10002463 3300013307 Bacteria 20056
171 Ga0163163_10005908 3300014325 Bacteria 10650
172 Ga0157380_10079398 3300014326 Bacteria 2680
173 Ga0157380_10165029 3300014326 Bacteria 1929
174 Ga0157377_10807885 3300014745 Unclassified 692
175 Ga0157379_10270043 3300014968 Bacteria 1546
176 Ga0157379_10351455 3300014968 Bacteria 1350
177 Ga0157379_10820781 3300014968 Bacteria 879
178 Ga0157376_10136921 3300014969 Bacteria 2192
179 Ga0157376_10165855 3300014969 Bacteria 2007
180 Ga0157376_10366108 3300014969 Unclassified 1384
181 Ga0157376_11804271 3300014969 Bacteria 648
182 Ga0157376_12878763 3300014969 Bacteria 521
183 Ga0209257_1000170 3300025304 Bacteria 169384
184 Ga0207680_10094816 3300025903 Bacteria 1906
185 Ga0207680_10112156 3300025903 Bacteria 1770
186 Ga0207647_10003010 3300025904 Bacteria 12671
187 Ga0207685_10538081 3300025905 Bacteria 620
188 Ga0207699_11254666 3300025906 Unclassified 549
189 Ga0207645_10334567 3300025907 Bacteria 1012
190 Ga0207643_11057198 3300025908 Bacteria 524
191 Ga0207705_10536426 3300025909 Bacteria 909
192 Ga0207654_10172419 3300025911 Bacteria 1406
193 Ga0207654_10271710 3300025911 Bacteria 1144
194 Ga0207654_10351225 3300025911 Bacteria 1015
195 Ga0207654_11392260 3300025911 Bacteria 511
196 Ga0207707_10633990 3300025912 Bacteria 902
197 Ga0207695_10000182 3300025913 Bacteria 184125
198 Ga0207695_10288456 3300025913 Bacteria 1534
199 Ga0207671_10058348 3300025914 Bacteria 2861
200 Ga0207671_10390868 3300025914 Bacteria 1106
201 Ga0207657_10008333 3300025919 Bacteria 10537
202 Ga0207657_10315816 3300025919 Bacteria 1236
203 Ga0207649_10016045 3300025920 Bacteria 4217
204 Ga0207649_10065642 3300025920 Bacteria 2298
205 Ga0207646_11364422 3300025922 Bacteria 617
206 Ga0207681_10368428 3300025923 Unclassified 1154
207 Ga0207694_10175384 3300025924 Bacteria 1737
208 Ga0207659_10612670 3300025926 Bacteria 929
209 Ga0207687_10045313 3300025927 Bacteria 3039
210 Ga0207687_10118022 3300025927 Bacteria 1980
211 Ga0207687_10468448 3300025927 Bacteria 1047
212 Ga0207687_11233040 3300025927 Bacteria 643
213 Ga0207644_10063199 3300025931 Bacteria 2688
214 Ga0207644_10619999 3300025931 Bacteria 899
215 Ga0207690_10217253 3300025932 Bacteria 1461
216 Ga0207690_11422900 3300025932 Bacteria 580
217 Ga0207706_10362451 3300025933 Bacteria 1259
218 Ga0207706_10680139 3300025933 Bacteria 880
219 Ga0207686_10073051 3300025934 Bacteria 2212
220 Ga0207686_10378976 3300025934 Bacteria 1072
221 Ga0207686_10392326 3300025934 Bacteria 1055
222 Ga0207709_10574179 3300025935 Bacteria 890
223 Ga0207709_11000451 3300025935 Bacteria 683
224 Ga0207670_10235279 3300025936 Bacteria 1409
225 Ga0207670_11584945 3300025936 Bacteria 557
226 Ga0207669_10209655 3300025937 Bacteria 1421
227 Ga0207669_11132830 3300025937 Bacteria 661
228 Ga0207711_10048040 3300025941 Bacteria 3650
229 Ga0207711_10589078 3300025941 Bacteria 1037
230 Ga0207711_11141865 3300025941 Bacteria 720
231 Ga0207711_11660292 3300025941 Bacteria 582
232 Ga0207689_10075769 3300025942 Bacteria 2765
233 Ga0207689_10168075 3300025942 Bacteria 1807
234 Ga0207689_10635362 3300025942 Bacteria 899
235 Ga0207661_10370121 3300025944 Bacteria 1295
236 Ga0207679_10339349 3300025945 Bacteria 1306
237 Ga0207667_10000799 3300025949 Bacteria 40827
238 Ga0207667_10046984 3300025949 Bacteria 4570
239 Ga0207667_10768351 3300025949 Bacteria 962
240 Ga0207651_11182700 3300025960 Bacteria 686
241 Ga0207712_11260335 3300025961 Bacteria 660
242 Ga0207658_10167991 3300025986 Bacteria 1804
243 Ga0207677_10780117 3300026023 Bacteria 854
244 Ga0207703_10078277 3300026035 Bacteria 2747
245 Ga0207703_10121090 3300026035 Bacteria 2246
246 Ga0207639_10029355 3300026041 Bacteria 4025
247 Ga0207639_10048856 3300026041 Bacteria 3204
248 Ga0207702_10208391 3300026078 Bacteria 1816
249 Ga0207702_10310069 3300026078 Bacteria 1500
250 Ga0207641_10015099 3300026088 Bacteria 6328
251 Ga0207641_10169436 3300026088 Bacteria 1992
252 Ga0207641_11038357 3300026088 Bacteria 817
253 Ga0207648_10835958 3300026089 Bacteria 858
254 Ga0207648_11472299 3300026089 Bacteria 640
255 Ga0207676_10083361 3300026095 Bacteria 2603
256 Ga0207676_10764279 3300026095 Bacteria 941
257 Ga0207674_10011436 3300026116 Bacteria 9973
258 Ga0207674_11957244 3300026116 Bacteria 552
259 Ga0207683_10590518 3300026121 Bacteria 1028
260 Ga0207683_10617322 3300026121 Bacteria 1004
261 Ga0207698_10015078 3300026142 Bacteria 5164
262 Ga0207698_10177978 3300026142 Bacteria 1880
263 Ga0209971_1010007 3300027682 Bacteria 2243
264 Ga0207428_10060906 3300027907 Bacteria 2990
265 Ga0268266_11241804 3300028379 Bacteria 720
266 Ga0268265_10493280 3300028380 Bacteria 1153
267 Ga0268264_10014391 3300028381 Bacteria 6503
268 Ga0268264_10054189 3300028381 Bacteria 3348
269 Ga0268264_10084080 3300028381 Bacteria 2727
270 Ga0268264_11312935 3300028381 Bacteria 734
271 Ga0268264_11808259 3300028381 Bacteria 621
272 Ga0307515_10157289 3300028794 Bacteria 2338
273 Ga0307515_10429387 3300028794 Bacteria 940
274 Ga0265338_10000769 3300028800 Bacteria 54637
275 Ga0265338_10990285 3300028800 Bacteria 569
276 Ga0265330_10044069 3300031235 Bacteria 1971
277 Ga0265320_10032036 3300031240 Bacteria 2695
278 Ga0265329_10219704 3300031242 Bacteria 628
279 Ga0265340_10040859 3300031247 Bacteria 2282
280 Ga0307513_10016581 3300031456 Bacteria 8880
281 Ga0265313_10029940 3300031595 Bacteria 2809
282 Ga0265314_10069535 3300031711 Bacteria 2362
283 Ga0265342_10106133 3300031712 Bacteria 1594
284 Ga0307410_10817488 3300031852 Bacteria 794
285 Ga0307409_100026732 3300031995 Bacteria 4076
286 Ga0307409_101354900 3300031995 Unclassified 737
287 Ga0307409_101887257 3300031995 Unclassified 627
288 Ga0307414_10103190 3300032004 Bacteria 2151
289 Ga0307415_100969782 3300032126 Unclassified 788
290 Ga0373949_0167114 3300035090 Bacteria 645
291 Ga0373956_0281177 3300035119 Bacteria 792
292 Ga0373955_0114850 3300035172 Bacteria 1560
293 Ga0373933_0191667 3300035724 Bacteria 1306
294 Ga0373937_0099714 3300036401 Bacteria 2694
295 Ga0436365_1931636 3300039437 Bacteria 713
296 Ga0439439_0028286 3300041406 Bacteria 1419
297 Ga0439465_0016468 3300041413 Bacteria 2305
298 Ga0439465_0186025 3300041413 Bacteria 753
299 Ga0451791_1723832 3300041451 Bacteria 1428
300 Ga0451800_0143561 3300041459 Bacteria 684
301 Ga0451800_0714958 3300041459 Bacteria 671
302 Ga0451802_1919989 3300041460 Bacteria 2388
303 Ga0451807_1847167 3300041486 Bacteria 2883
304 Ga0451837_0613658 3300041494 Bacteria 589
305 Ga0451841_0186297 3300041498 Bacteria 757
306 Ga0439431_0060466 3300041997 Bacteria 996
307 Ga0439433_0026904 3300041999 Bacteria 1303
308 Ga0439432_054121 3300042006 Bacteria 1247
309 Ga0439449_0035416 3300042007 Bacteria 1858
310 Ga0439449_0071270 3300042007 Bacteria 1280
311 Ga0439457_054601 3300042014 Bacteria 900
312 Ga0439462_0130670 3300042015 Bacteria 701
313 Ga0439434_0242761 3300042435 Bacteria 615
314 Ga0495592_0064666 3300046454 Bacteria 2680
315 Ga0495629_0000001 3300046459 Bacteria 807972
316 Ga0495651_0113438 3300046462 Bacteria 2001
317 Ga0495608_0384158 3300046511 Bacteria 860
318 Ga0495663_0003791 3300046525 Bacteria 4314
319 Ga0495652_0051622 3300046529 Bacteria 3511
320 Ga0495586_0269969 3300046535 Bacteria 972
321 Ga0495587_0036610 3300046536 Bacteria 2951
322 Ga0495645_0173330 3300046543 Bacteria 1483
323 Ga0495667_0025570 3300046559 Bacteria 3978
324 Ga0495611_0211281 3300046648 Unclassified 904
325 Ga0495635_0109335 3300046663 Bacteria 1889
326 Ga0495657_0528432 3300046675 Bacteria 686
327 Ga0495599_0028334 3300046678 Bacteria 3510
328 Ga0495623_0054336 3300046679 Bacteria 2527
329 Ga0495671_0020259 3300046692 Bacteria 3506
330 Ga0495600_0331231 3300046809 Bacteria 956
331 Ga0495604_0910232 3300047317 Bacteria 549
332 Ga0495672_0097873 3300047320 Bacteria 1597
333 Ga0495680_0234080 3300047322 Bacteria 1307
334 Ga0495675_0219872 3300047444 Bacteria 1150
335 Ga0495684_0393660 3300047471 Bacteria 974
336 Ga0495686_0452135 3300047472 Bacteria 682
337 Ga0496102_1420505 3300048905 Bacteria 613
338 Ga0501033_0282028 3300049570 Bacteria 1172
339 Ga0501033_0846759 3300049570 Unclassified 616
340 Ga0501034_0190949 3300049571 Bacteria 2010
341 Ga0501034_0339415 3300049571 Bacteria 1432
342 Ga0501036_0088464 3300049572 Bacteria 2617
343 Ga0501036_1530714 3300049572 Bacteria 539
344 Ga0501037_0399770 3300049573 Bacteria 942
345 Ga0501037_0847582 3300049573 Unclassified 601
346 Ga0501038_0120847 3300049574 Bacteria 2160
347 Ga0501038_0223186 3300049574 Bacteria 1502
348 Ga0501039_0062906 3300049575 Bacteria 2875
349 Ga0501043_0129543 3300049579 Bacteria 1977
350 Ga0501046_0013980 3300049580 Bacteria 6780
351 Ga0501047_0358351 3300049581 Bacteria 1294
352 Ga0501047_1275656 3300049581 Bacteria 548
353 Ga0501067_0036594 3300049583 Bacteria 2725
354 Ga0501067_0631086 3300049583 Bacteria 601
355 Ga0501068_0005079 3300049584 Bacteria 7174
356 Ga0501070_0097587 3300049586 Bacteria 2430
357 Ga0501070_0440903 3300049586 Bacteria 1050
358 Ga0501070_0595626 3300049586 Unclassified 881
359 Ga0501071_0240877 3300049587 Bacteria 1364
360 Ga0501072_0491355 3300049588 Bacteria 971
361 Ga0501072_0649338 3300049588 Bacteria 830
362 Ga0501073_0219151 3300049589 Bacteria 1314
363 Ga0501073_0630856 3300049589 Bacteria 740
364 Ga0501074_0067593 3300049590 Bacteria 2569
365 Ga0501075_0253607 3300049591 Unclassified 1341
366 Ga0501076_0800463 3300049592 Bacteria 778
367 Ga0501079_0078617 3300049741 Bacteria 2551
368 Ga0501083_0047414 3300049744 Bacteria 2903
369 Ga0501083_0084951 3300049744 Bacteria 2094
370 Ga0501035_0103422 3300049822 Bacteria 2498
371 Ga0501044_0043558 3300049823 Bacteria 4662
372 Ga0501044_0099728 3300049823 Bacteria 2922
373 Ga0501045_0183611 3300049824 Bacteria 1559
374 Ga0501045_0858410 3300049824 Bacteria 668
375 nmdc:mga03683_234798_c1 3300050489 Bacteria 849
376 nmdc:mga0yw44_1014886_c1 3300050492 Bacteria 561
377 nmdc:mga0yw44_804289_c1 3300050492 Unclassified 638
378 nmdc:mga05p37_1212270_c1 3300050507 Bacteria 778
379 nmdc:mga05p37_1395511_c1 3300050507 Bacteria 706
380 nmdc:mga05p37_145352_c1 3300050507 Bacteria 2904
381 nmdc:mga0qj67_6481_c1 3300050509 Bacteria 8602
382 nmdc:mga06r32_328276_c1 3300050510 Bacteria 686
383 nmdc:mga06r32_401303_c1 3300050510 Bacteria 1353
384 nmdc:mga08y16_14008_c1 3300050511 Bacteria 8440
385 nmdc:mga0n895_612848_c1 3300050512 Bacteria 1090
386 nmdc:mga0rr50_1128299_c1 3300050513 Bacteria 667
387 nmdc:mga0rr50_1498749_c1 3300050513 Bacteria 570
388 nmdc:mga0rr50_153526_c1 3300050513 Bacteria 1863
389 nmdc:mga0rr50_70933_c1 3300050513 Bacteria 2656
390 nmdc:mga08x19_240407_c1 3300050514 Bacteria 1248
391 nmdc:mga08x19_684507_c1 3300050514 Bacteria 728
392 Ga0495601_0019766 3300053077 Bacteria 4111
393 Ga0495619_0080161 3300053085 Bacteria 2197
394 Ga0500651_0023358 3300053093 Bacteria 3873
395 Ga0500577_0029746 3300053142 Bacteria 1895
396 Ga0501082_0168173 3300060353 Bacteria 1905
397 Ga0501082_1376325 3300060353 Bacteria 616
398 Ga0501082_1601726 3300060353 Bacteria 568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100652513 Ga0070678_1006525131 113
2 3300005539 Ga0068853_100773613 Ga0068853_1007736131 113
3 3300005577 Ga0068857_101473243 Ga0068857_1014732432 113
4 3300013102 Ga0157371_10380855 Ga0157371_103808552 113
5 3300025937 Ga0207669_11132830 Ga0207669_111328302 113
6 3300026116 Ga0207674_11957244 Ga0207674_119572442 113
7 3300026121 Ga0207683_10590518 Ga0207683_105905182 113
8 iso_pu_bacteria 2593339239 2595451223 115
9 3300005329 Ga0070683_100004225 Ga0070683_1000042254 117
10 3300005330 Ga0070690_100098795 Ga0070690_1000987952 117
11 3300005335 Ga0070666_10022167 Ga0070666_100221674 117
12 3300005336 Ga0070680_100619419 Ga0070680_1006194192 117
13 3300005338 Ga0068868_100451215 Ga0068868_1004512152 117
14 3300005339 Ga0070660_100061492 Ga0070660_1000614922 117
15 3300005344 Ga0070661_100018079 Ga0070661_1000180793 117
16 3300005344 Ga0070661_100101614 Ga0070661_1001016141 117
17 3300005355 Ga0070671_100072562 Ga0070671_1000725622 117
18 3300005366 Ga0070659_100366208 Ga0070659_1003662082 117
19 3300005367 Ga0070667_100128235 Ga0070667_1001282353 117
20 3300005457 Ga0070662_100073291 Ga0070662_1000732912 117
21 3300005535 Ga0070684_100474439 Ga0070684_1004744392 117
22 3300005539 Ga0068853_100001459 Ga0068853_1000014592 117
23 3300005563 Ga0068855_100027022 Ga0068855_1000270229 117
24 3300005563 Ga0068855_100366548 Ga0068855_1003665482 117
25 3300005564 Ga0070664_100096886 Ga0070664_1000968862 117
26 3300005577 Ga0068857_100009937 Ga0068857_1000099376 117
27 3300005614 Ga0068856_100043830 Ga0068856_1000438302 117
28 3300005614 Ga0068856_100540455 Ga0068856_1005404552 117
29 3300005616 Ga0068852_100003363 Ga0068852_1000033634 117
30 3300005616 Ga0068852_100197122 Ga0068852_1001971223 117
31 3300005842 Ga0068858_100663224 Ga0068858_1006632242 117
32 3300005843 Ga0068860_100095158 Ga0068860_1000951584 117
33 3300009093 Ga0105240_10084121 Ga0105240_100841212 117
34 3300009093 Ga0105240_10127338 Ga0105240_101273382 117
35 3300009098 Ga0105245_11148302 Ga0105245_111483022 117
36 3300009174 Ga0105241_10010818 Ga0105241_100108183 117
37 3300009174 Ga0105241_10023033 Ga0105241_100230333 117
38 3300009177 Ga0105248_11792087 Ga0105248_117920871 117
39 3300009545 Ga0105237_10037854 Ga0105237_100378544 117
40 3300009545 Ga0105237_10090542 Ga0105237_100905422 117
41 3300009551 Ga0105238_10002280 Ga0105238_1000228017 117
42 3300009551 Ga0105238_10103541 Ga0105238_101035412 117
43 3300010375 Ga0105239_10029331 Ga0105239_100293313 117
44 3300010375 Ga0105239_10033173 Ga0105239_100331735 117
45 3300013100 Ga0157373_10117583 Ga0157373_101175832 117
46 3300013102 Ga0157371_10266451 Ga0157371_102664512 117
47 3300013104 Ga0157370_10026722 Ga0157370_100267225 117
48 3300013104 Ga0157370_10096274 Ga0157370_100962744 117
49 3300013105 Ga0157369_10008502 Ga0157369_100085025 117
50 3300013105 Ga0157369_10013507 Ga0157369_100135076 117
51 3300013296 Ga0157374_10450017 Ga0157374_104500172 117
52 3300013306 Ga0163162_12269397 Ga0163162_122693972 117
53 3300013307 Ga0157372_10002463 Ga0157372_1000246314 117
54 3300025903 Ga0207680_10112156 Ga0207680_101121562 117
55 3300025904 Ga0207647_10003010 Ga0207647_100030103 117
56 3300025909 Ga0207705_10536426 Ga0207705_105364261 117
57 3300025911 Ga0207654_10172419 Ga0207654_101724192 117
58 3300025911 Ga0207654_10271710 Ga0207654_102717102 117
59 3300025913 Ga0207695_10000182 Ga0207695_10000182132 117
60 3300025913 Ga0207695_10288456 Ga0207695_102884562 117
61 3300025914 Ga0207671_10058348 Ga0207671_100583483 117
62 3300025914 Ga0207671_10390868 Ga0207671_103908682 117
63 3300025919 Ga0207657_10008333 Ga0207657_1000833310 117
64 3300025920 Ga0207649_10016045 Ga0207649_100160453 117
65 3300025920 Ga0207649_10065642 Ga0207649_100656422 117
66 3300025924 Ga0207694_10175384 Ga0207694_101753842 117
67 3300025927 Ga0207687_11233040 Ga0207687_112330402 117
68 3300025931 Ga0207644_10063199 Ga0207644_100631992 117
69 3300025933 Ga0207706_10362451 Ga0207706_103624512 117
70 3300025941 Ga0207711_11660292 Ga0207711_116602921 117
71 3300025942 Ga0207689_10168075 Ga0207689_101680753 117
72 3300025944 Ga0207661_10370121 Ga0207661_103701213 117
73 3300025945 Ga0207679_10339349 Ga0207679_103393493 117
74 3300025949 Ga0207667_10000799 Ga0207667_100007997 117
75 3300025949 Ga0207667_10046984 Ga0207667_100469843 117
76 3300026023 Ga0207677_10780117 Ga0207677_107801172 117
77 3300026041 Ga0207639_10029355 Ga0207639_100293552 117
78 3300026041 Ga0207639_10048856 Ga0207639_100488564 117
79 3300026078 Ga0207702_10208391 Ga0207702_102083912 117
80 3300026078 Ga0207702_10310069 Ga0207702_103100692 117
81 3300026116 Ga0207674_10011436 Ga0207674_100114363 117
82 3300026142 Ga0207698_10015078 Ga0207698_100150784 117
83 3300028381 Ga0268264_10084080 Ga0268264_100840802 117
84 3300005548 Ga0070665_100274694 Ga0070665_1002746943 118
85 3300005985 Ga0081539_10192168 Ga0081539_101921682 118
86 3300025933 Ga0207706_10680139 Ga0207706_106801392 118
87 3300028794 Ga0307515_10157289 Ga0307515_101572892 118
88 3300028794 Ga0307515_10429387 Ga0307515_104293872 118
89 3300049589 Ga0501073_0630856 Ga0501073_0630856_226_582 118
90 3300049744 Ga0501083_0047414 Ga0501083_0047414_2236_2592 118
91 3300049823 Ga0501044_0043558 Ga0501044_0043558_864_1220 118
92 3300005328 Ga0070676_10519359 Ga0070676_105193592 119
93 3300005333 Ga0070677_10634647 Ga0070677_106346471 119
94 3300005334 Ga0068869_100153191 Ga0068869_1001531912 119
95 3300005335 Ga0070666_10088326 Ga0070666_100883263 119
96 3300005336 Ga0070680_100954544 Ga0070680_1009545441 119
97 3300005339 Ga0070660_100729123 Ga0070660_1007291231 119
98 3300005340 Ga0070689_100138471 Ga0070689_1001384712 119
99 3300005340 Ga0070689_101576806 Ga0070689_1015768061 119
100 3300005341 Ga0070691_10704345 Ga0070691_107043452 119
101 3300005353 Ga0070669_100483300 Ga0070669_1004833002 119
102 3300005354 Ga0070675_100275577 Ga0070675_1002755772 119
103 3300005355 Ga0070671_100127713 Ga0070671_1001277133 119
104 3300005355 Ga0070671_100709446 Ga0070671_1007094461 119
105 3300005364 Ga0070673_101647215 Ga0070673_1016472151 119
106 3300005365 Ga0070688_100189551 Ga0070688_1001895512 119
107 3300005367 Ga0070667_100050335 Ga0070667_1000503352 119
108 3300005440 Ga0070705_100234709 Ga0070705_1002347092 119
109 3300005440 Ga0070705_101314615 Ga0070705_1013146151 119
110 3300005456 Ga0070678_100222548 Ga0070678_1002225483 119
111 3300005467 Ga0070706_100508186 Ga0070706_1005081862 119
112 3300005518 Ga0070699_100178927 Ga0070699_1001789271 119
113 3300005518 Ga0070699_100636581 Ga0070699_1006365811 119
114 3300005536 Ga0070697_100606897 Ga0070697_1006068971 119
115 3300005539 Ga0068853_101788006 Ga0068853_1017880061 119
116 3300005545 Ga0070695_100040396 Ga0070695_1000403965 119
117 3300005545 Ga0070695_101807810 Ga0070695_1018078101 119
118 3300005546 Ga0070696_100121020 Ga0070696_1001210204 119
119 3300005546 Ga0070696_100229128 Ga0070696_1002291283 119
120 3300005546 Ga0070696_100431351 Ga0070696_1004313512 119
121 3300005548 Ga0070665_100373043 Ga0070665_1003730432 119
122 3300005548 Ga0070665_100504132 Ga0070665_1005041322 119
123 3300005548 Ga0070665_101935865 Ga0070665_1019358652 119
124 3300005549 Ga0070704_100370332 Ga0070704_1003703322 119
125 3300005549 Ga0070704_100945008 Ga0070704_1009450081 119
126 3300005549 Ga0070704_101762544 Ga0070704_1017625442 119
127 3300005563 Ga0068855_100393981 Ga0068855_1003939811 119
128 3300005617 Ga0068859_100243320 Ga0068859_1002433202 119
129 3300005618 Ga0068864_100076657 Ga0068864_1000766571 119
130 3300005718 Ga0068866_11012163 Ga0068866_110121631 119
131 3300005841 Ga0068863_100015895 Ga0068863_1000158952 119
132 3300005841 Ga0068863_101079376 Ga0068863_1010793762 119
133 3300005843 Ga0068860_100003747 Ga0068860_10000374712 119
134 3300005843 Ga0068860_100165938 Ga0068860_1001659383 119
135 3300006038 Ga0075365_10768883 Ga0075365_107688832 119
136 3300006173 Ga0070716_101761206 Ga0070716_1017612061 119
137 3300006177 Ga0075362_10385878 Ga0075362_103858782 119
138 3300006237 Ga0097621_100017657 Ga0097621_1000176573 119
139 3300006237 Ga0097621_102094470 Ga0097621_1020944701 119
140 3300006358 Ga0068871_100593790 Ga0068871_1005937901 119
141 3300006358 Ga0068871_100776660 Ga0068871_1007766602 119
142 3300006844 Ga0075428_101407628 Ga0075428_1014076282 119
143 3300006846 Ga0075430_100047265 Ga0075430_1000472655 119
144 3300006847 Ga0075431_101228352 Ga0075431_1012283522 119
145 3300006881 Ga0068865_100880202 Ga0068865_1008802021 119
146 3300006914 Ga0075436_100059212 Ga0075436_1000592122 119
147 3300006914 Ga0075436_100292772 Ga0075436_1002927723 119
148 3300006931 Ga0097620_100243310 Ga0097620_1002433102 119
149 3300007076 Ga0075435_100166026 Ga0075435_1001660263 119
150 3300009094 Ga0111539_10030029 Ga0111539_100300294 119
151 3300009147 Ga0114129_10188927 Ga0114129_101889274 119
152 3300009147 Ga0114129_10229379 Ga0114129_102293793 119
153 3300009147 Ga0114129_11152046 Ga0114129_111520462 119
154 3300009148 Ga0105243_11247320 Ga0105243_112473202 119
155 3300009148 Ga0105243_11712323 Ga0105243_117123232 119
156 3300009174 Ga0105241_11744024 Ga0105241_117440242 119
157 3300009176 Ga0105242_12683359 Ga0105242_126833591 119
158 3300009177 Ga0105248_10155665 Ga0105248_101556653 119
159 3300009553 Ga0105249_10746934 Ga0105249_107469341 119
160 3300013102 Ga0157371_11091778 Ga0157371_110917781 119
161 3300013297 Ga0157378_12302423 Ga0157378_123024231 119
162 3300013306 Ga0163162_11494043 Ga0163162_114940432 119
163 3300014325 Ga0163163_10005908 Ga0163163_100059083 119
164 3300014326 Ga0157380_10079398 Ga0157380_100793985 119
165 3300014326 Ga0157380_10165029 Ga0157380_101650292 119
166 3300014968 Ga0157379_10270043 Ga0157379_102700433 119
167 3300014969 Ga0157376_10136921 Ga0157376_101369214 119
168 3300014969 Ga0157376_12878763 Ga0157376_128787631 119
169 3300025304 Ga0209257_1000170 Ga0209257_1000170147 119
170 3300025903 Ga0207680_10094816 Ga0207680_100948162 119
171 3300025907 Ga0207645_10334567 Ga0207645_103345672 119
172 3300025908 Ga0207643_11057198 Ga0207643_110571981 119
173 3300025922 Ga0207646_11364422 Ga0207646_113644221 119
174 3300025923 Ga0207681_10368428 Ga0207681_103684282 119
175 3300025926 Ga0207659_10612670 Ga0207659_106126701 119
176 3300025931 Ga0207644_10619999 Ga0207644_106199991 119
177 3300025932 Ga0207690_11422900 Ga0207690_114229001 119
178 3300025934 Ga0207686_10378976 Ga0207686_103789762 119
179 3300025935 Ga0207709_11000451 Ga0207709_110004512 119
180 3300025936 Ga0207670_11584945 Ga0207670_115849451 119
181 3300025941 Ga0207711_11141865 Ga0207711_111418652 119
182 3300025942 Ga0207689_10635362 Ga0207689_106353621 119
183 3300025949 Ga0207667_10768351 Ga0207667_107683512 119
184 3300025960 Ga0207651_11182700 Ga0207651_111827002 119
185 3300025986 Ga0207658_10167991 Ga0207658_101679912 119
186 3300026035 Ga0207703_10121090 Ga0207703_101210904 119
187 3300026088 Ga0207641_10015099 Ga0207641_100150991 119
188 3300026088 Ga0207641_11038357 Ga0207641_110383572 119
189 3300026089 Ga0207648_10835958 Ga0207648_108359582 119
190 3300026095 Ga0207676_10083361 Ga0207676_100833613 119
191 3300026121 Ga0207683_10617322 Ga0207683_106173221 119
192 3300027907 Ga0207428_10060906 Ga0207428_100609064 119
193 3300028379 Ga0268266_11241804 Ga0268266_112418042 119
194 3300028381 Ga0268264_10014391 Ga0268264_1001439110 119
195 3300028381 Ga0268264_10054189 Ga0268264_100541893 119
196 3300028381 Ga0268264_11312935 Ga0268264_113129351 119
197 3300028800 Ga0265338_10990285 Ga0265338_109902851 119
198 3300031235 Ga0265330_10044069 Ga0265330_100440692 119
199 3300031240 Ga0265320_10032036 Ga0265320_100320364 119
200 3300031242 Ga0265329_10219704 Ga0265329_102197042 119
201 3300031247 Ga0265340_10040859 Ga0265340_100408594 119
202 3300031456 Ga0307513_10016581 Ga0307513_100165814 119
203 3300031595 Ga0265313_10029940 Ga0265313_100299404 119
204 3300031711 Ga0265314_10069535 Ga0265314_100695352 119
205 3300031712 Ga0265342_10106133 Ga0265342_101061332 119
206 3300031852 Ga0307410_10817488 Ga0307410_108174881 119
207 3300031995 Ga0307409_100026732 Ga0307409_1000267324 119
208 3300031995 Ga0307409_101354900 Ga0307409_1013549002 119
209 3300031995 Ga0307409_101887257 Ga0307409_1018872572 119
210 3300032004 Ga0307414_10103190 Ga0307414_101031902 119
211 3300032126 Ga0307415_100969782 Ga0307415_1009697822 119
212 3300035090 Ga0373949_0167114 Ga0373949_0167114_77_436 119
213 3300041406 Ga0439439_0028286 Ga0439439_0028286_789_1148 119
214 3300041413 Ga0439465_0016468 Ga0439465_0016468_1735_2094 119
215 3300041413 Ga0439465_0186025 Ga0439465_0186025_246_605 119
216 3300041451 Ga0451791_1723832 Ga0451791_1723832_710_1069 119
217 3300041459 Ga0451800_0143561 Ga0451800_0143561_231_590 119
218 3300041460 Ga0451802_1919989 Ga0451802_1919989_538_897 119
219 3300041486 Ga0451807_1847167 Ga0451807_1847167_324_683 119
220 3300041494 Ga0451837_0613658 Ga0451837_0613658_177_536 119
221 3300041498 Ga0451841_0186297 Ga0451841_0186297_186_545 119
222 3300041997 Ga0439431_0060466 Ga0439431_0060466_426_785 119
223 3300041999 Ga0439433_0026904 Ga0439433_0026904_769_1128 119
224 3300042006 Ga0439432_054121 Ga0439432_054121_759_1127 119
225 3300042007 Ga0439449_0035416 Ga0439449_0035416_1487_1846 119
226 3300042007 Ga0439449_0071270 Ga0439449_0071270_255_623 119
227 3300042014 Ga0439457_054601 Ga0439457_054601_57_416 119
228 3300042015 Ga0439462_0130670 Ga0439462_0130670_262_630 119
229 3300042435 Ga0439434_0242761 Ga0439434_0242761_79_438 119
230 3300046525 Ga0495663_0003791 Ga0495663_0003791_1954_2313 119
231 3300046648 Ga0495611_0211281 Ga0495611_0211281_490_849 119
232 3300046692 Ga0495671_0020259 Ga0495671_0020259_1821_2180 119
233 3300047320 Ga0495672_0097873 Ga0495672_0097873_37_399 119
234 3300047472 Ga0495686_0452135 Ga0495686_0452135_73_432 119
235 3300048905 Ga0496102_1420505 Ga0496102_1420505_126_485 119
236 3300049570 Ga0501033_0282028 Ga0501033_0282028_99_461 119
237 3300049570 Ga0501033_0846759 Ga0501033_0846759_170_532 119
238 3300049571 Ga0501034_0190949 Ga0501034_0190949_1048_1410 119
239 3300049571 Ga0501034_0339415 Ga0501034_0339415_1052_1411 119
240 3300049572 Ga0501036_0088464 Ga0501036_0088464_1409_1771 119
241 3300049572 Ga0501036_1530714 Ga0501036_1530714_17_376 119
242 3300049573 Ga0501037_0399770 Ga0501037_0399770_345_704 119
243 3300049573 Ga0501037_0847582 Ga0501037_0847582_151_510 119
244 3300049574 Ga0501038_0120847 Ga0501038_0120847_979_1341 119
245 3300049574 Ga0501038_0223186 Ga0501038_0223186_357_719 119
246 3300049575 Ga0501039_0062906 Ga0501039_0062906_1986_2348 119
247 3300049579 Ga0501043_0129543 Ga0501043_0129543_268_630 119
248 3300049580 Ga0501046_0013980 Ga0501046_0013980_3377_3739 119
249 3300049581 Ga0501047_0358351 Ga0501047_0358351_800_1162 119
250 3300049581 Ga0501047_1275656 Ga0501047_1275656_25_384 119
251 3300049583 Ga0501067_0036594 Ga0501067_0036594_2093_2455 119
252 3300049583 Ga0501067_0631086 Ga0501067_0631086_217_579 119
253 3300049584 Ga0501068_0005079 Ga0501068_0005079_2038_2400 119
254 3300049586 Ga0501070_0097587 Ga0501070_0097587_206_568 119
255 3300049586 Ga0501070_0440903 Ga0501070_0440903_206_568 119
256 3300049586 Ga0501070_0595626 Ga0501070_0595626_170_529 119
257 3300049587 Ga0501071_0240877 Ga0501071_0240877_847_1206 119
258 3300049588 Ga0501072_0491355 Ga0501072_0491355_510_869 119
259 3300049588 Ga0501072_0649338 Ga0501072_0649338_144_506 119
260 3300049589 Ga0501073_0219151 Ga0501073_0219151_77_439 119
261 3300049590 Ga0501074_0067593 Ga0501074_0067593_1161_1523 119
262 3300049591 Ga0501075_0253607 Ga0501075_0253607_870_1232 119
263 3300049592 Ga0501076_0800463 Ga0501076_0800463_12_371 119
264 3300049741 Ga0501079_0078617 Ga0501079_0078617_73_435 119
265 3300049744 Ga0501083_0084951 Ga0501083_0084951_258_620 119
266 3300049822 Ga0501035_0103422 Ga0501035_0103422_1399_1761 119
267 3300049823 Ga0501044_0099728 Ga0501044_0099728_16_375 119
268 3300049824 Ga0501045_0183611 Ga0501045_0183611_643_1005 119
269 3300049824 Ga0501045_0858410 Ga0501045_0858410_231_590 119
270 3300050489 nmdc:mga03683_234798_c1 nmdc:mga03683_234798_c1_233_592 119
271 3300050492 nmdc:mga0yw44_1014886_c1 nmdc:mga0yw44_1014886_c1_65_424 119
272 3300050492 nmdc:mga0yw44_804289_c1 nmdc:mga0yw44_804289_c1_167_526 119
273 3300050507 nmdc:mga05p37_1212270_c1 nmdc:mga05p37_1212270_c1_191_550 119
274 3300050507 nmdc:mga05p37_1395511_c1 nmdc:mga05p37_1395511_c1_152_511 119
275 3300050507 nmdc:mga05p37_145352_c1 nmdc:mga05p37_145352_c1_1370_1729 119
276 3300050509 nmdc:mga0qj67_6481_c1 nmdc:mga0qj67_6481_c1_7127_7486 119
277 3300050510 nmdc:mga06r32_328276_c1 nmdc:mga06r32_328276_c1_236_595 119
278 3300050511 nmdc:mga08y16_14008_c1 nmdc:mga08y16_14008_c1_50_409 119
279 3300050513 nmdc:mga0rr50_1128299_c1 nmdc:mga0rr50_1128299_c1_35_394 119
280 3300050513 nmdc:mga0rr50_70933_c1 nmdc:mga0rr50_70933_c1_1555_1914 119
281 3300050514 nmdc:mga08x19_240407_c1 nmdc:mga08x19_240407_c1_705_1064 119
282 3300050514 nmdc:mga08x19_684507_c1 nmdc:mga08x19_684507_c1_137_496 119
283 3300053093 Ga0500651_0023358 Ga0500651_0023358_3359_3718 119
284 3300053142 Ga0500577_0029746 Ga0500577_0029746_1135_1494 119
285 3300060353 Ga0501082_0168173 Ga0501082_0168173_782_1144 119
286 3300060353 Ga0501082_1376325 Ga0501082_1376325_244_603 119
287 3300060353 Ga0501082_1601726 Ga0501082_1601726_26_385 119
288 3300005344 Ga0070661_100468992 Ga0070661_1004689922 120
289 3300005366 Ga0070659_100342072 Ga0070659_1003420722 120
290 3300005546 Ga0070696_100221634 Ga0070696_1002216342 120
291 3300005563 Ga0068855_100549664 Ga0068855_1005496642 120
292 3300006237 Ga0097621_101688380 Ga0097621_1016883801 120
293 3300009553 Ga0105249_10562782 Ga0105249_105627821 120
294 3300013297 Ga0157378_11768288 Ga0157378_117682881 120
295 3300025912 Ga0207707_10633990 Ga0207707_106339901 120
296 3300025919 Ga0207657_10315816 Ga0207657_103158162 120
297 3300025932 Ga0207690_10217253 Ga0207690_102172533 120
298 3300027682 Ga0209971_1010007 Ga0209971_10100071 120
299 3300028800 Ga0265338_10000769 Ga0265338_1000076948 120
300 3300041459 Ga0451800_0714958 Ga0451800_0714958_81_644 120
301 3300046459 Ga0495629_0000001 Ga0495629_0000001_796199_796561 120
302 3300046535 Ga0495586_0269969 Ga0495586_0269969_133_498 120
303 3300050510 nmdc:mga06r32_401303_c1 nmdc:mga06r32_401303_c1_475_897 120
304 3300005327 Ga0070658_10626794 Ga0070658_106267941 121
305 3300005330 Ga0070690_100468004 Ga0070690_1004680042 121
306 3300005334 Ga0068869_100216673 Ga0068869_1002166732 121
307 3300005345 Ga0070692_11182911 Ga0070692_111829111 121
308 3300005354 Ga0070675_102219168 Ga0070675_1022191681 121
309 3300005364 Ga0070673_100408026 Ga0070673_1004080263 121
310 3300005434 Ga0070709_11502036 Ga0070709_115020361 121
311 3300005459 Ga0068867_101634053 Ga0068867_1016340531 121
312 3300005544 Ga0070686_100118154 Ga0070686_1001181543 121
313 3300005545 Ga0070695_101156303 Ga0070695_1011563032 121
314 3300005546 Ga0070696_100417357 Ga0070696_1004173571 121
315 3300005547 Ga0070693_100002180 Ga0070693_1000021805 121
316 3300005615 Ga0070702_100215536 Ga0070702_1002155362 121
317 3300005616 Ga0068852_101124615 Ga0068852_1011246152 121
318 3300005834 Ga0068851_10727570 Ga0068851_107275701 121
319 3300005985 Ga0081539_10117295 Ga0081539_101172951 121
320 3300006237 Ga0097621_100018306 Ga0097621_1000183065 121
321 3300006237 Ga0097621_100106401 Ga0097621_1001064014 121
322 3300006237 Ga0097621_100596602 Ga0097621_1005966021 121
323 3300006237 Ga0097621_100596602 Ga0097621_1005966022 121
324 3300006358 Ga0068871_100023825 Ga0068871_1000238255 121
325 3300006358 Ga0068871_100602170 Ga0068871_1006021702 121
326 3300006852 Ga0075433_11736761 Ga0075433_117367611 121
327 3300006871 Ga0075434_100512956 Ga0075434_1005129562 121
328 3300007076 Ga0075435_100101649 Ga0075435_1001016493 121
329 3300009098 Ga0105245_10070370 Ga0105245_100703702 121
330 3300009098 Ga0105245_10283047 Ga0105245_102830472 121
331 3300009098 Ga0105245_10506015 Ga0105245_105060152 121
332 3300009098 Ga0105245_11289423 Ga0105245_112894231 121
333 3300009101 Ga0105247_11204062 Ga0105247_112040622 121
334 3300009148 Ga0105243_10829896 Ga0105243_108298962 121
335 3300009174 Ga0105241_11790097 Ga0105241_117900972 121
336 3300009174 Ga0105241_12199752 Ga0105241_121997522 121
337 3300009176 Ga0105242_10303335 Ga0105242_103033352 121
338 3300009176 Ga0105242_11433229 Ga0105242_114332291 121
339 3300009177 Ga0105248_10017819 Ga0105248_1001781910 121
340 3300009177 Ga0105248_10017819 Ga0105248_1001781911 121
341 3300009177 Ga0105248_10443615 Ga0105248_104436152 121
342 3300013296 Ga0157374_10555783 Ga0157374_105557832 121
343 3300013297 Ga0157378_10067237 Ga0157378_100672373 121
344 3300013297 Ga0157378_10684061 Ga0157378_106840612 121
345 3300013306 Ga0163162_10302132 Ga0163162_103021321 121
346 3300013306 Ga0163162_10302132 Ga0163162_103021322 121
347 3300013306 Ga0163162_10638489 Ga0163162_106384892 121
348 3300014745 Ga0157377_10807885 Ga0157377_108078852 121
349 3300014968 Ga0157379_10351455 Ga0157379_103514552 121
350 3300014968 Ga0157379_10820781 Ga0157379_108207812 121
351 3300014969 Ga0157376_10165855 Ga0157376_101658552 121
352 3300014969 Ga0157376_10366108 Ga0157376_103661081 121
353 3300014969 Ga0157376_11804271 Ga0157376_118042712 121
354 3300025905 Ga0207685_10538081 Ga0207685_105380812 121
355 3300025906 Ga0207699_11254666 Ga0207699_112546661 121
356 3300025911 Ga0207654_10351225 Ga0207654_103512252 121
357 3300025911 Ga0207654_11392260 Ga0207654_113922601 121
358 3300025927 Ga0207687_10045313 Ga0207687_100453133 121
359 3300025927 Ga0207687_10118022 Ga0207687_101180224 121
360 3300025927 Ga0207687_10468448 Ga0207687_104684482 121
361 3300025934 Ga0207686_10073051 Ga0207686_100730512 121
362 3300025934 Ga0207686_10392326 Ga0207686_103923262 121
363 3300025935 Ga0207709_10574179 Ga0207709_105741792 121
364 3300025936 Ga0207670_10235279 Ga0207670_102352792 121
365 3300025937 Ga0207669_10209655 Ga0207669_102096553 121
366 3300025941 Ga0207711_10048040 Ga0207711_100480402 121
367 3300025941 Ga0207711_10048040 Ga0207711_100480403 121
368 3300025941 Ga0207711_10589078 Ga0207711_105890781 121
369 3300025942 Ga0207689_10075769 Ga0207689_100757692 121
370 3300025961 Ga0207712_11260335 Ga0207712_112603351 121
371 3300026035 Ga0207703_10078277 Ga0207703_100782772 121
372 3300026088 Ga0207641_10169436 Ga0207641_101694362 121
373 3300026089 Ga0207648_11472299 Ga0207648_114722992 121
374 3300026095 Ga0207676_10764279 Ga0207676_107642792 121
375 3300026142 Ga0207698_10177978 Ga0207698_101779783 121
376 3300028380 Ga0268265_10493280 Ga0268265_104932801 121
377 3300028381 Ga0268264_11808259 Ga0268264_118082592 121
378 3300035119 Ga0373956_0281177 Ga0373956_0281177_80_445 121
379 3300035172 Ga0373955_0114850 Ga0373955_0114850_1174_1539 121
380 3300035724 Ga0373933_0191667 Ga0373933_0191667_902_1267 121
381 3300036401 Ga0373937_0099714 Ga0373937_0099714_1573_1938 121
382 3300039437 Ga0436365_1931636 Ga0436365_1931636_329_694 121
383 3300046454 Ga0495592_0064666 Ga0495592_0064666_719_1084 121
384 3300046462 Ga0495651_0113438 Ga0495651_0113438_1608_1973 121
385 3300046511 Ga0495608_0384158 Ga0495608_0384158_157_522 121
386 3300046529 Ga0495652_0051622 Ga0495652_0051622_819_1184 121
387 3300046536 Ga0495587_0036610 Ga0495587_0036610_1029_1394 121
388 3300046543 Ga0495645_0173330 Ga0495645_0173330_190_555 121
389 3300046559 Ga0495667_0025570 Ga0495667_0025570_1246_1611 121
390 3300046663 Ga0495635_0109335 Ga0495635_0109335_449_814 121
391 3300046675 Ga0495657_0528432 Ga0495657_0528432_112_477 121
392 3300046678 Ga0495599_0028334 Ga0495599_0028334_1384_1749 121
393 3300046679 Ga0495623_0054336 Ga0495623_0054336_16_381 121
394 3300046809 Ga0495600_0331231 Ga0495600_0331231_30_395 121
395 3300047317 Ga0495604_0910232 Ga0495604_0910232_113_478 121
396 3300047322 Ga0495680_0234080 Ga0495680_0234080_106_471 121
397 3300047444 Ga0495675_0219872 Ga0495675_0219872_727_1092 121
398 3300047471 Ga0495684_0393660 Ga0495684_0393660_577_942 121
399 3300050512 nmdc:mga0n895_612848_c1 nmdc:mga0n895_612848_c1_208_573 121
400 3300050513 nmdc:mga0rr50_1498749_c1 nmdc:mga0rr50_1498749_c1_122_487 121
401 3300050513 nmdc:mga0rr50_153526_c1 nmdc:mga0rr50_153526_c1_213_578 121
402 3300053077 Ga0495601_0019766 Ga0495601_0019766_1725_2090 121
403 3300053085 Ga0495619_0080161 Ga0495619_0080161_176_541 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

3

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8808 2 121
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8751 2 121
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8467 2 121
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8057 2 121
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.7544 3 118
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8846 3 121 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8705 3 121 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7426 2 118 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7408 2 118 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7363 4 121 3.30.70.100
ID Description Score Start End GO Terms
AF-Q07H21-F1-model_v4 DUF1428 domain-containing protein 0.9406 3 121
AF-A0A1I0NUD6-F1-model_v4 Uncharacterized conserved protein YbaA, DUF1428 family 0.9405 3 121
AF-A0A4R3YSC6-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.9395 4 121
AF-A0A1V4HV00-F1-model_v4 RNA signal recognition particle 0.9381 3 121
AF-A0A7C9LWW8-F1-model_v4 DUF1428 family protein 0.9381 4 121

Feature Viewer

pLDDT pTM Quality
89.45 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map