F435330
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 403 | 216 | 806 | 481 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100044328|Ga0068853_1000443282 |
| Length | 504 |
| Sequence | MYLNTVTAETLRRRGTYKLSLRRPTSAVKIRLIIILPCMFFYKVYSQTPADTITLSLPEIVAMAKEKSIASKQAATVRETKYWVWRTFRSNYQPQLSLNGTLPAYSKTFTQVLQPDGSILFQPIHNNQSIAATGGTIFGTTQLQRFDDFDRHNTLYNGVPYAVGYSQPLWQFNSLRWDKKIEPLKFNESRQAYIESLEQVAITASGYFFDLLLAQVNLQIAETNLTNTQKIQAIANEKLELGKITRNEILQLELEQLKAQKAVGIARRDMEIATLNLRSFTGLTGQENIKLQVPASVIQMSVTTEKVVAEAYENRSDAIAFVRRIAEAKRDVAKAKGDNGLNATLTARLGYSKSAAELAKVYHAPQDQQLVQLDFTIPILDWGRSKSRTKTAEANQQFTRYAVEQDKQIFTQQIVTQVTLFDMMHDQLTLSARADTIASEKYQIAKDRYVLGNLSITDLSIAFQEKDQAKRDYIAALRDFWGSYYQLRYLSLYDFEKNEKILYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 140 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 191 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 192 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 194 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 195 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 196 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 197 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 198 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 199 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 200 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 201 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 202 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 203 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 204 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 205 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 206 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 207 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 208 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 209 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 210 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 211 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 212 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 213 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 214 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 215 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 216 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.03 |
| Metatranscriptomes | 0 |
| Isolates | 3.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.41 |
| Nodule | 0 |
| Rhizoplane | 0.74 |
| Rhizosphere | 78.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100044328 | 3300005539 | Bacteria | 3808 |
| 2 | SwRhRL2b_contig_1109292 | 2162886007 | Bacteria | 16391 |
| 3 | SwRhRL2b_contig_1157535 | 2162886007 | Bacteria | 16452 |
| 4 | SwRhRL2b_contig_2471198 | 2162886007 | Bacteria | 1916 |
| 5 | JGI24739J22299_10004869 | 3300001989 | Bacteria | 5118 |
| 6 | JGI24737J22298_10000041 | 3300001990 | Bacteria | 37211 |
| 7 | JGI24743J22301_10010882 | 3300001991 | Bacteria | 1629 |
| 8 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 9 | JGI25162J39368_1000121 | 3300002737 | Bacteria | 85899 |
| 10 | JGI25162J39368_1002782 | 3300002737 | Bacteria | 6189 |
| 11 | JGI25154J39366_1000100 | 3300002738 | Bacteria | 76811 |
| 12 | JGI25157J39369_1004602 | 3300002741 | Bacteria | 2455 |
| 13 | JGI25165J46597_1001237 | 3300003214 | Bacteria | 15127 |
| 14 | rootH1_10026547 | 3300003316 | Bacteria | 11340 |
| 15 | rootH1_10049259 | 3300003316 | Bacteria | 11540 |
| 16 | rootH2_10000343 | 3300003320 | Bacteria | 102217 |
| 17 | rootH2_10021608 | 3300003320 | Bacteria | 1833 |
| 18 | rootL2_10089064 | 3300003322 | Bacteria | 3259 |
| 19 | rootL2_10125616 | 3300003322 | Bacteria | 2539 |
| 20 | rootL2_10253563 | 3300003322 | Unclassified | 2242 |
| 21 | rootH1_10001370 | 3300003323 | Bacteria | 113238 |
| 22 | rootH1_10015647 | 3300003323 | Bacteria | 3869 |
| 23 | rootH1_10015649 | 3300003323 | Bacteria | 1746 |
| 24 | rootH1_10063115 | 3300003323 | Bacteria | 5032 |
| 25 | JGI25160J50197_1001283 | 3300003354 | Bacteria | 12742 |
| 26 | JGI25160J50197_1007572 | 3300003354 | Bacteria | 4235 |
| 27 | Ga0055536_1000009 | 3300003781 | Bacteria | 311572 |
| 28 | Ga0055528_1000572 | 3300003790 | Bacteria | 27859 |
| 29 | Ga0055530_10000943 | 3300003791 | Bacteria | 23778 |
| 30 | Ga0055531_10014302 | 3300003794 | Bacteria | 3582 |
| 31 | Ga0065165_1000017 | 3300005262 | Bacteria | 278286 |
| 32 | Ga0065714_10002263 | 3300005288 | Bacteria | 65514 |
| 33 | Ga0065714_10002864 | 3300005288 | Bacteria | 54801 |
| 34 | Ga0065714_10009241 | 3300005288 | Bacteria | 2988 |
| 35 | Ga0065714_10064508 | 3300005288 | Bacteria | 46035 |
| 36 | Ga0065714_10077226 | 3300005288 | Bacteria | 2710 |
| 37 | Ga0065704_10000229 | 3300005289 | Bacteria | 80338 |
| 38 | Ga0065704_10074770 | 3300005289 | Bacteria | 6027 |
| 39 | Ga0070658_10000080 | 3300005327 | Bacteria | 90682 |
| 40 | Ga0070658_10137360 | 3300005327 | Bacteria | 2040 |
| 41 | Ga0070676_10000140 | 3300005328 | Bacteria | 27970 |
| 42 | Ga0070683_100021523 | 3300005329 | Bacteria | 5755 |
| 43 | Ga0070683_100261577 | 3300005329 | Bacteria | 1646 |
| 44 | Ga0070670_100137395 | 3300005331 | Bacteria | 2112 |
| 45 | Ga0068869_100140679 | 3300005334 | Bacteria | 1863 |
| 46 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 47 | Ga0070666_10025999 | 3300005335 | Bacteria | 3820 |
| 48 | Ga0068868_100019165 | 3300005338 | Bacteria | 5126 |
| 49 | Ga0068868_100039680 | 3300005338 | Bacteria | 3659 |
| 50 | Ga0068868_100046323 | 3300005338 | Bacteria | 3403 |
| 51 | Ga0070660_100004493 | 3300005339 | Bacteria | 9639 |
| 52 | Ga0070661_100011648 | 3300005344 | Bacteria | 6132 |
| 53 | Ga0070668_100021853 | 3300005347 | Bacteria | 4833 |
| 54 | Ga0070668_100026530 | 3300005347 | Bacteria | 4397 |
| 55 | Ga0070675_100112069 | 3300005354 | Bacteria | 2309 |
| 56 | Ga0070671_100036952 | 3300005355 | Bacteria | 4049 |
| 57 | Ga0070671_100074571 | 3300005355 | Bacteria | 2835 |
| 58 | Ga0070673_100019435 | 3300005364 | Bacteria | 4875 |
| 59 | Ga0070673_100052488 | 3300005364 | Bacteria | 3199 |
| 60 | Ga0070688_100056164 | 3300005365 | Bacteria | 2472 |
| 61 | Ga0070659_100005576 | 3300005366 | Bacteria | 9044 |
| 62 | Ga0070659_100013275 | 3300005366 | Bacteria | 6126 |
| 63 | Ga0070667_100018965 | 3300005367 | Bacteria | 5703 |
| 64 | Ga0070667_100040632 | 3300005367 | Bacteria | 3900 |
| 65 | Ga0070678_100007973 | 3300005456 | Bacteria | 6314 |
| 66 | Ga0070662_100000081 | 3300005457 | Bacteria | 53265 |
| 67 | Ga0070662_100015275 | 3300005457 | Bacteria | 5140 |
| 68 | Ga0068867_100000843 | 3300005459 | Bacteria | 20637 |
| 69 | Ga0068867_100142024 | 3300005459 | Bacteria | 1878 |
| 70 | Ga0070679_100007702 | 3300005530 | Bacteria | 10082 |
| 71 | Ga0070679_100042032 | 3300005530 | Bacteria | 4552 |
| 72 | Ga0068853_100023658 | 3300005539 | Bacteria | 5146 |
| 73 | Ga0068853_100076495 | 3300005539 | Bacteria | 2923 |
| 74 | Ga0068853_100091621 | 3300005539 | Bacteria | 2674 |
| 75 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 76 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 77 | Ga0068855_100000090 | 3300005563 | Bacteria | 110528 |
| 78 | Ga0068855_100006355 | 3300005563 | Bacteria | 14401 |
| 79 | Ga0068855_100007153 | 3300005563 | Bacteria | 13546 |
| 80 | Ga0068855_100013657 | 3300005563 | Bacteria | 9794 |
| 81 | Ga0068855_100092382 | 3300005563 | Bacteria | 3490 |
| 82 | Ga0068855_100127328 | 3300005563 | Bacteria | 2911 |
| 83 | Ga0070664_100049893 | 3300005564 | Bacteria | 3540 |
| 84 | Ga0068857_100045029 | 3300005577 | Bacteria | 3913 |
| 85 | Ga0068857_100076669 | 3300005577 | Bacteria | 2982 |
| 86 | Ga0068857_100143997 | 3300005577 | Bacteria | 2155 |
| 87 | Ga0068854_100060967 | 3300005578 | Bacteria | 2731 |
| 88 | Ga0068856_100000129 | 3300005614 | Bacteria | 76536 |
| 89 | Ga0068856_100028219 | 3300005614 | Bacteria | 5479 |
| 90 | Ga0068856_100131497 | 3300005614 | Bacteria | 2507 |
| 91 | Ga0068852_100000281 | 3300005616 | Bacteria | 33979 |
| 92 | Ga0068859_100000130 | 3300005617 | Bacteria | 71018 |
| 93 | Ga0068864_100002546 | 3300005618 | Bacteria | 15048 |
| 94 | Ga0068863_100008085 | 3300005841 | Bacteria | 10273 |
| 95 | Ga0068863_100220245 | 3300005841 | Unclassified | 1828 |
| 96 | Ga0068858_100003098 | 3300005842 | Bacteria | 16637 |
| 97 | Ga0068860_100001453 | 3300005843 | Bacteria | 25628 |
| 98 | Ga0068860_100002504 | 3300005843 | Bacteria | 19274 |
| 99 | Ga0068860_100016152 | 3300005843 | Bacteria | 7285 |
| 100 | Ga0081539_10000337 | 3300005985 | Bacteria | 103868 |
| 101 | Ga0075366_10002447 | 3300006195 | Bacteria | 9508 |
| 102 | Ga0075366_10068606 | 3300006195 | Bacteria | 2110 |
| 103 | Ga0097621_100000039 | 3300006237 | Bacteria | 67231 |
| 104 | Ga0097621_100000081 | 3300006237 | Bacteria | 50723 |
| 105 | Ga0097621_100009477 | 3300006237 | Bacteria | 7069 |
| 106 | Ga0068871_100000300 | 3300006358 | Bacteria | 34429 |
| 107 | Ga0068871_100002549 | 3300006358 | Bacteria | 12434 |
| 108 | Ga0068871_100034096 | 3300006358 | Bacteria | 4037 |
| 109 | Ga0068865_100000180 | 3300006881 | Bacteria | 35127 |
| 110 | Ga0097620_100000130 | 3300006931 | Bacteria | 71018 |
| 111 | Ga0105240_10000283 | 3300009093 | Bacteria | 99553 |
| 112 | Ga0105240_10298018 | 3300009093 | Bacteria | 1845 |
| 113 | Ga0105245_10112423 | 3300009098 | Bacteria | 2534 |
| 114 | Ga0105247_10037070 | 3300009101 | Bacteria | 2974 |
| 115 | Ga0105241_10000514 | 3300009174 | Bacteria | 29151 |
| 116 | Ga0105241_10001533 | 3300009174 | Bacteria | 17705 |
| 117 | Ga0105241_10003973 | 3300009174 | Bacteria | 10930 |
| 118 | Ga0105241_10006553 | 3300009174 | Bacteria | 8581 |
| 119 | Ga0105241_10054143 | 3300009174 | Bacteria | 3070 |
| 120 | Ga0105241_10081126 | 3300009174 | Bacteria | 2540 |
| 121 | Ga0105241_10105016 | 3300009174 | Bacteria | 2252 |
| 122 | Ga0105242_10089423 | 3300009176 | Bacteria | 2588 |
| 123 | Ga0105237_10000411 | 3300009545 | Bacteria | 60960 |
| 124 | Ga0105237_10000963 | 3300009545 | Bacteria | 38740 |
| 125 | Ga0105237_10001962 | 3300009545 | Bacteria | 26195 |
| 126 | Ga0105237_10009372 | 3300009545 | Bacteria | 10489 |
| 127 | Ga0105237_10013274 | 3300009545 | Bacteria | 8642 |
| 128 | Ga0105237_10022043 | 3300009545 | Bacteria | 6537 |
| 129 | Ga0105237_10023345 | 3300009545 | Bacteria | 6339 |
| 130 | Ga0105237_10080916 | 3300009545 | Bacteria | 3238 |
| 131 | Ga0105237_10115306 | 3300009545 | Unclassified | 2680 |
| 132 | Ga0105238_10002377 | 3300009551 | Bacteria | 18888 |
| 133 | Ga0105249_10004268 | 3300009553 | Bacteria | 12351 |
| 134 | Ga0105249_10012134 | 3300009553 | Bacteria | 7584 |
| 135 | Ga0105249_10016508 | 3300009553 | Bacteria | 6549 |
| 136 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 137 | Ga0105239_10000106 | 3300010375 | Bacteria | 117256 |
| 138 | Ga0105239_10000132 | 3300010375 | Bacteria | 105380 |
| 139 | Ga0105239_10000528 | 3300010375 | Bacteria | 55243 |
| 140 | Ga0105239_10001538 | 3300010375 | Bacteria | 30493 |
| 141 | Ga0105239_10006197 | 3300010375 | Bacteria | 13918 |
| 142 | Ga0105239_10016107 | 3300010375 | Bacteria | 8271 |
| 143 | Ga0105239_10071450 | 3300010375 | Bacteria | 3813 |
| 144 | Ga0105246_10041915 | 3300011119 | Bacteria | 3097 |
| 145 | Ga0157373_10000261 | 3300013100 | Bacteria | 42879 |
| 146 | Ga0157373_10009612 | 3300013100 | Bacteria | 7136 |
| 147 | Ga0157373_10055596 | 3300013100 | Bacteria | 2812 |
| 148 | Ga0157371_10000050 | 3300013102 | Bacteria | 183160 |
| 149 | Ga0157371_10001830 | 3300013102 | Bacteria | 21442 |
| 150 | Ga0157371_10001867 | 3300013102 | Bacteria | 21086 |
| 151 | Ga0157371_10035312 | 3300013102 | Unclassified | 3583 |
| 152 | Ga0157371_10053526 | 3300013102 | Unclassified | 2866 |
| 153 | Ga0157371_10088341 | 3300013102 | Bacteria | 2194 |
| 154 | Ga0157370_10000285 | 3300013104 | Bacteria | 64200 |
| 155 | Ga0157370_10015299 | 3300013104 | Bacteria | 7805 |
| 156 | Ga0157369_10001695 | 3300013105 | Bacteria | 26849 |
| 157 | Ga0157369_10025169 | 3300013105 | Bacteria | 6608 |
| 158 | Ga0157369_10183580 | 3300013105 | Bacteria | 2200 |
| 159 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 160 | Ga0157374_10000135 | 3300013296 | Bacteria | 67340 |
| 161 | Ga0157374_10003320 | 3300013296 | Bacteria | 13514 |
| 162 | Ga0157374_10025011 | 3300013296 | Bacteria | 5357 |
| 163 | Ga0157374_10051431 | 3300013296 | Bacteria | 3834 |
| 164 | Ga0157374_10121795 | 3300013296 | Bacteria | 2518 |
| 165 | Ga0157374_10191255 | 3300013296 | Unclassified | 2002 |
| 166 | Ga0157378_10005063 | 3300013297 | Bacteria | 11573 |
| 167 | Ga0157378_10009998 | 3300013297 | Bacteria | 8274 |
| 168 | Ga0157378_10024654 | 3300013297 | Bacteria | 5296 |
| 169 | Ga0157378_10032461 | 3300013297 | Bacteria | 4613 |
| 170 | Ga0157378_10045337 | 3300013297 | Bacteria | 3907 |
| 171 | Ga0157378_10149541 | 3300013297 | Unclassified | 2175 |
| 172 | Ga0157378_10184865 | 3300013297 | Bacteria | 1962 |
| 173 | Ga0157378_10188375 | 3300013297 | Bacteria | 1944 |
| 174 | Ga0163162_10000097 | 3300013306 | Bacteria | 79518 |
| 175 | Ga0163162_10000899 | 3300013306 | Bacteria | 27700 |
| 176 | Ga0163162_10003016 | 3300013306 | Bacteria | 16084 |
| 177 | Ga0163162_10006867 | 3300013306 | Bacteria | 11044 |
| 178 | Ga0163162_10063136 | 3300013306 | Bacteria | 3745 |
| 179 | Ga0163162_10091521 | 3300013306 | Bacteria | 3125 |
| 180 | Ga0157372_10000011 | 3300013307 | Bacteria | 277202 |
| 181 | Ga0157372_10001527 | 3300013307 | Bacteria | 25162 |
| 182 | Ga0157372_10015408 | 3300013307 | Bacteria | 8193 |
| 183 | Ga0157372_10250569 | 3300013307 | Bacteria | 2055 |
| 184 | Ga0157372_10367948 | 3300013307 | Bacteria | 1675 |
| 185 | Ga0157375_10000250 | 3300013308 | Bacteria | 49016 |
| 186 | Ga0157375_10041548 | 3300013308 | Bacteria | 4441 |
| 187 | Ga0157375_10227951 | 3300013308 | Unclassified | 2022 |
| 188 | Ga0163163_10000389 | 3300014325 | Bacteria | 41878 |
| 189 | Ga0163163_10037815 | 3300014325 | Bacteria | 4697 |
| 190 | Ga0182008_10000012 | 3300014497 | Bacteria | 297475 |
| 191 | Ga0182008_10000078 | 3300014497 | Bacteria | 77087 |
| 192 | Ga0157379_10149917 | 3300014968 | Bacteria | 2103 |
| 193 | Ga0157376_10000374 | 3300014969 | Bacteria | 29126 |
| 194 | Ga0157376_10003324 | 3300014969 | Bacteria | 11067 |
| 195 | Ga0157376_10026381 | 3300014969 | Bacteria | 4591 |
| 196 | Ga0182006_1000166 | 3300015261 | Bacteria | 69787 |
| 197 | Ga0182006_1000297 | 3300015261 | Bacteria | 43680 |
| 198 | Ga0182006_1001324 | 3300015261 | Bacteria | 15184 |
| 199 | Ga0182006_1003364 | 3300015261 | Bacteria | 8224 |
| 200 | Ga0163161_10000215 | 3300017792 | Bacteria | 52730 |
| 201 | Ga0163161_10000574 | 3300017792 | Bacteria | 29528 |
| 202 | Ga0163161_10015258 | 3300017792 | Bacteria | 5354 |
| 203 | Ga0163161_10017912 | 3300017792 | Bacteria | 4963 |
| 204 | Ga0163161_10025057 | 3300017792 | Bacteria | 4218 |
| 205 | Ga0207427_100125 | 3300025231 | Bacteria | 96142 |
| 206 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 207 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 208 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 209 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 210 | Ga0209646_1001501 | 3300025246 | Bacteria | 6201 |
| 211 | Ga0209026_1000954 | 3300025250 | Bacteria | 14493 |
| 212 | Ga0209148_1000163 | 3300025254 | Bacteria | 137449 |
| 213 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 214 | Ga0209673_1000354 | 3300025273 | Bacteria | 83443 |
| 215 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 216 | Ga0209564_1003201 | 3300025295 | Bacteria | 11499 |
| 217 | Ga0209564_1004937 | 3300025295 | Bacteria | 7884 |
| 218 | Ga0209758_1003655 | 3300025297 | Bacteria | 13704 |
| 219 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 220 | Ga0209050_1000163 | 3300025298 | Bacteria | 154895 |
| 221 | Ga0207426_1000093 | 3300025302 | Bacteria | 277663 |
| 222 | Ga0207426_1002304 | 3300025302 | Bacteria | 12553 |
| 223 | Ga0207426_1023208 | 3300025302 | Unclassified | 2119 |
| 224 | Ga0209257_1005362 | 3300025304 | Bacteria | 9055 |
| 225 | Ga0207710_10059063 | 3300025900 | Bacteria | 1735 |
| 226 | Ga0207680_10000228 | 3300025903 | Bacteria | 27141 |
| 227 | Ga0207647_10000028 | 3300025904 | Bacteria | 109750 |
| 228 | Ga0207647_10000058 | 3300025904 | Bacteria | 84631 |
| 229 | Ga0207647_10015760 | 3300025904 | Bacteria | 5173 |
| 230 | Ga0207645_10001698 | 3300025907 | Bacteria | 17878 |
| 231 | Ga0207705_10000035 | 3300025909 | Bacteria | 201649 |
| 232 | Ga0207654_10006862 | 3300025911 | Bacteria | 5731 |
| 233 | Ga0207695_10000684 | 3300025913 | Bacteria | 66519 |
| 234 | Ga0207695_10016050 | 3300025913 | Bacteria | 8786 |
| 235 | Ga0207695_10150857 | 3300025913 | Bacteria | 2264 |
| 236 | Ga0207695_10219468 | 3300025913 | Bacteria | 1809 |
| 237 | Ga0207671_10001126 | 3300025914 | Bacteria | 32182 |
| 238 | Ga0207671_10001753 | 3300025914 | Bacteria | 24394 |
| 239 | Ga0207671_10003445 | 3300025914 | Bacteria | 15761 |
| 240 | Ga0207671_10004030 | 3300025914 | Bacteria | 14263 |
| 241 | Ga0207671_10006546 | 3300025914 | Bacteria | 10353 |
| 242 | Ga0207671_10036741 | 3300025914 | Bacteria | 3633 |
| 243 | Ga0207657_10008412 | 3300025919 | Bacteria | 10474 |
| 244 | Ga0207694_10133450 | 3300025924 | Bacteria | 1992 |
| 245 | Ga0207650_10140639 | 3300025925 | Unclassified | 1897 |
| 246 | Ga0207659_10068846 | 3300025926 | Bacteria | 2576 |
| 247 | Ga0207644_10026621 | 3300025931 | Bacteria | 3987 |
| 248 | Ga0207644_10098507 | 3300025931 | Bacteria | 2192 |
| 249 | Ga0207690_10010265 | 3300025932 | Bacteria | 5562 |
| 250 | Ga0207690_10118169 | 3300025932 | Bacteria | 1921 |
| 251 | Ga0207706_10000147 | 3300025933 | Bacteria | 76792 |
| 252 | Ga0207706_10003522 | 3300025933 | Bacteria | 14949 |
| 253 | Ga0207704_10000076 | 3300025938 | Bacteria | 61793 |
| 254 | Ga0207704_10068098 | 3300025938 | Bacteria | 2243 |
| 255 | Ga0207689_10014206 | 3300025942 | Bacteria | 6775 |
| 256 | Ga0207689_10027846 | 3300025942 | Bacteria | 4728 |
| 257 | Ga0207689_10109231 | 3300025942 | Unclassified | 2273 |
| 258 | Ga0207661_10140985 | 3300025944 | Bacteria | 2074 |
| 259 | Ga0207679_10014731 | 3300025945 | Bacteria | 5150 |
| 260 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 261 | Ga0207667_10007095 | 3300025949 | Bacteria | 13527 |
| 262 | Ga0207667_10007728 | 3300025949 | Bacteria | 12855 |
| 263 | Ga0207667_10105740 | 3300025949 | Bacteria | 2904 |
| 264 | Ga0207667_10259955 | 3300025949 | Bacteria | 1775 |
| 265 | Ga0207651_10013810 | 3300025960 | Bacteria | 4637 |
| 266 | Ga0207651_10083717 | 3300025960 | Bacteria | 2308 |
| 267 | Ga0207668_10114461 | 3300025972 | Unclassified | 2030 |
| 268 | Ga0207640_10187732 | 3300025981 | Bacteria | 1555 |
| 269 | Ga0207658_10053090 | 3300025986 | Bacteria | 2993 |
| 270 | Ga0207677_10010111 | 3300026023 | Bacteria | 5327 |
| 271 | Ga0207677_10099398 | 3300026023 | Bacteria | 2136 |
| 272 | Ga0207639_10012990 | 3300026041 | Bacteria | 5813 |
| 273 | Ga0207639_10040244 | 3300026041 | Bacteria | 3487 |
| 274 | Ga0207702_10000300 | 3300026078 | Bacteria | 57198 |
| 275 | Ga0207702_10036631 | 3300026078 | Bacteria | 4104 |
| 276 | Ga0207702_10043918 | 3300026078 | Bacteria | 3754 |
| 277 | Ga0207641_10000158 | 3300026088 | Bacteria | 96378 |
| 278 | Ga0207641_10091729 | 3300026088 | Unclassified | 2659 |
| 279 | Ga0207648_10000648 | 3300026089 | Bacteria | 39101 |
| 280 | Ga0207648_10087474 | 3300026089 | Bacteria | 2719 |
| 281 | Ga0207676_10237559 | 3300026095 | Bacteria | 1633 |
| 282 | Ga0207674_10045717 | 3300026116 | Bacteria | 4501 |
| 283 | Ga0207674_10092281 | 3300026116 | Bacteria | 3018 |
| 284 | Ga0207675_100005173 | 3300026118 | Bacteria | 12557 |
| 285 | Ga0207683_10038383 | 3300026121 | Bacteria | 4174 |
| 286 | Ga0207683_10125373 | 3300026121 | Bacteria | 2307 |
| 287 | Ga0207698_10044934 | 3300026142 | Bacteria | 3323 |
| 288 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 289 | Ga0268266_10000232 | 3300028379 | Bacteria | 95941 |
| 290 | Ga0268264_10001350 | 3300028381 | Bacteria | 23002 |
| 291 | Ga0268264_10001875 | 3300028381 | Bacteria | 19096 |
| 292 | Ga0268264_10002631 | 3300028381 | Bacteria | 15680 |
| 293 | Ga0268264_10028914 | 3300028381 | Bacteria | 4538 |
| 294 | Ga0307515_10000246 | 3300028794 | Bacteria | 134348 |
| 295 | Ga0307515_10000707 | 3300028794 | Bacteria | 76907 |
| 296 | Ga0307515_10000993 | 3300028794 | Bacteria | 64832 |
| 297 | Ga0307515_10124457 | 3300028794 | Bacteria | 2892 |
| 298 | Ga0265327_10000284 | 3300031251 | Bacteria | 100178 |
| 299 | Ga0307509_10198039 | 3300031507 | Bacteria | 1849 |
| 300 | Ga0307516_10000189 | 3300031730 | Bacteria | 79794 |
| 301 | Ga0307407_10000017 | 3300031903 | Bacteria | 136012 |
| 302 | Ga0307412_10000045 | 3300031911 | Bacteria | 165021 |
| 303 | Ga0307416_100000011 | 3300032002 | Bacteria | 300622 |
| 304 | Ga0307414_10000533 | 3300032004 | Bacteria | 19793 |
| 305 | Ga0307414_10019489 | 3300032004 | Bacteria | 4205 |
| 306 | Ga0307414_10056781 | 3300032004 | Bacteria | 2748 |
| 307 | Ga0307414_10114465 | 3300032004 | Bacteria | 2061 |
| 308 | Ga0307507_10001380 | 3300033179 | Bacteria | 54486 |
| 309 | Ga0307510_10001267 | 3300033180 | Bacteria | 27507 |
| 310 | Ga0307510_10004144 | 3300033180 | Bacteria | 17022 |
| 311 | Ga0316584_0009501 | 3300036712 | Bacteria | 6754 |
| 312 | Ga0395899_0000188 | 3300037312 | Bacteria | 90869 |
| 313 | Ga0395899_0000888 | 3300037312 | Bacteria | 28385 |
| 314 | Ga0395900_0000226 | 3300037418 | Bacteria | 88588 |
| 315 | Ga0395898_0004590 | 3300037466 | Bacteria | 15073 |
| 316 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 317 | Ga0395901_0000136 | 3300038443 | Bacteria | 95382 |
| 318 | Ga0436365_0269604 | 3300039437 | Bacteria | 1735 |
| 319 | Ga0436365_1732514 | 3300039437 | Bacteria | 16095 |
| 320 | Ga0436361_0803447 | 3300039447 | Bacteria | 4486 |
| 321 | Ga0451795_1603602 | 3300041456 | Unclassified | 2088 |
| 322 | Ga0439431_0000539 | 3300041997 | Bacteria | 8039 |
| 323 | Ga0466969_0028693 | 3300044656 | Bacteria | 2844 |
| 324 | Ga0466969_0035181 | 3300044656 | Bacteria | 2534 |
| 325 | Ga0466966_0019459 | 3300044684 | Bacteria | 4466 |
| 326 | Ga0466961_0035312 | 3300044693 | Unclassified | 3211 |
| 327 | Ga0466971_0017089 | 3300044719 | Bacteria | 3206 |
| 328 | Ga0466959_0008498 | 3300045049 | Bacteria | 7265 |
| 329 | Ga0466958_0039730 | 3300045836 | Bacteria | 2827 |
| 330 | Ga0466958_0080989 | 3300045836 | Unclassified | 1998 |
| 331 | Ga0495650_0000273 | 3300046471 | Bacteria | 98757 |
| 332 | Ga0495585_0000132 | 3300046492 | Bacteria | 80905 |
| 333 | Ga0495585_0037031 | 3300046492 | Bacteria | 2748 |
| 334 | Ga0495583_0045690 | 3300046506 | Bacteria | 2024 |
| 335 | Ga0495606_0000130 | 3300046507 | Bacteria | 127805 |
| 336 | Ga0495606_0011133 | 3300046507 | Bacteria | 7373 |
| 337 | Ga0495610_0000151 | 3300046512 | Bacteria | 76854 |
| 338 | Ga0495610_0002033 | 3300046512 | Bacteria | 17292 |
| 339 | Ga0495616_0002729 | 3300046513 | Bacteria | 11555 |
| 340 | Ga0495631_0005500 | 3300046518 | Bacteria | 6623 |
| 341 | Ga0495644_0007986 | 3300046523 | Bacteria | 4071 |
| 342 | Ga0495648_0043766 | 3300046524 | Bacteria | 2803 |
| 343 | Ga0495609_0039161 | 3300046538 | Bacteria | 2135 |
| 344 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 345 | Ga0495633_0009219 | 3300046558 | Bacteria | 5471 |
| 346 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 347 | Ga0495668_0000513 | 3300046616 | Bacteria | 48303 |
| 348 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 349 | Ga0495625_0000227 | 3300046660 | Bacteria | 88834 |
| 350 | Ga0495625_0000358 | 3300046660 | Bacteria | 69690 |
| 351 | Ga0495625_0012165 | 3300046660 | Bacteria | 6983 |
| 352 | Ga0495625_0050616 | 3300046660 | Bacteria | 2980 |
| 353 | Ga0495661_0001031 | 3300046665 | Bacteria | 24752 |
| 354 | Ga0495661_0010531 | 3300046665 | Bacteria | 6306 |
| 355 | Ga0495661_0058503 | 3300046665 | Bacteria | 2297 |
| 356 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 357 | Ga0495660_0005464 | 3300046810 | Bacteria | 7612 |
| 358 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 359 | Ga0495687_002988 | 3300047443 | Bacteria | 12791 |
| 360 | Ga0495687_005612 | 3300047443 | Bacteria | 7932 |
| 361 | Ga0495677_0006183 | 3300047445 | Bacteria | 4523 |
| 362 | Ga0495686_0022968 | 3300047472 | Bacteria | 4120 |
| 363 | Ga0495686_0033922 | 3300047472 | Bacteria | 3291 |
| 364 | Ga0495686_0046651 | 3300047472 | Bacteria | 2738 |
| 365 | Ga0495614_0052396 | 3300048089 | Bacteria | 1749 |
| 366 | Ga0496115_0114154 | 3300048918 | Bacteria | 2220 |
| 367 | Ga0496123_0012248 | 3300048926 | Bacteria | 7334 |
| 368 | Ga0501034_0031521 | 3300049571 | Bacteria | 5384 |
| 369 | Ga0501034_0034236 | 3300049571 | Bacteria | 5150 |
| 370 | Ga0501241_009072 | 3300049758 | Bacteria | 1812 |
| 371 | nmdc:mga0k408_1683_c1 | 3300050493 | Bacteria | 11936 |
| 372 | nmdc:mga0k408_23843_c1 | 3300050493 | Bacteria | 3456 |
| 373 | Ga0500644_0000528 | 3300053088 | Bacteria | 16038 |
| 374 | Ga0500583_0000367 | 3300053092 | Bacteria | 14822 |
| 375 | Ga0500583_0030849 | 3300053092 | Bacteria | 2351 |
| 376 | Ga0500651_0000646 | 3300053093 | Bacteria | 17380 |
| 377 | Ga0500607_045016 | 3300053121 | Bacteria | 2371 |
| 378 | Ga0500608_000502 | 3300053122 | Bacteria | 14608 |
| 379 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 380 | Ga0500642_0003131 | 3300053130 | Bacteria | 4963 |
| 381 | Ga0500652_015478 | 3300053131 | Bacteria | 2753 |
| 382 | Ga0500568_0037049 | 3300053139 | Unclassified | 1981 |
| 383 | Ga0500577_0001759 | 3300053142 | Bacteria | 5532 |
| 384 | Ga0500604_0006911 | 3300053151 | Bacteria | 3004 |
| 385 | Ga0500616_0005705 | 3300053153 | Bacteria | 8386 |
| 386 | Ga0500633_0001643 | 3300053160 | Bacteria | 4324 |
| 387 | Ga0500611_000028 | 3300053727 | Bacteria | 93696 |
| 388 | 2599477146 | 2599185184 | Bacteria | 6430550 |
| 389 | 2738755280 | 2738541283 | Bacteria | 7222293 |
| 390 | 2738764338 | 2738541284 | Bacteria | 5199923 |
| 391 | 2738855151 | 2738541302 | Bacteria | 5944758 |
| 392 | 2776613809 | 2775506987 | Bacteria | 5373360 |
| 393 | 2819547833 | 2818991437 | Bacteria | 5805520 |
| 394 | 2852623552 | 2852623160 | Bacteria | 4376875 |
| 395 | 2884937546 | 2884933994 | Bacteria | 4535041 |
| 396 | 2896110560 | 2896109856 | Bacteria | 7140722 |
| 397 | 2911138926 | 2911138879 | Bacteria | 5811561 |
| 398 | 2919442076 | 2919437846 | Bacteria | 6199444 |
| 399 | 2928079059 | 2928078545 | Bacteria | 6534839 |
| 400 | 2928148570 | 2928147474 | Bacteria | 6512076 |
| 401 | 2929239493 | 2929239360 | Bacteria | 7745570 |
| 402 | 2932085864 | 2932082852 | Bacteria | 6563563 |
| 403 | 2945999747 | 2945997725 | Bacteria | 6404843 |
| 404 | Ga0068853_100044328 | |||
| 405 | SwRhRL2b_contig_1109292 | |||
| 406 | SwRhRL2b_contig_1157535 | |||
| 407 | SwRhRL2b_contig_2471198 | |||
| 408 | JGI24739J22299_10004869 | |||
| 409 | JGI24737J22298_10000041 | |||
| 410 | JGI24743J22301_10010882 | |||
| 411 | JGI24735J21928_10000001 | |||
| 412 | JGI25162J39368_1000121 | |||
| 413 | JGI25162J39368_1002782 | |||
| 414 | JGI25154J39366_1000100 | |||
| 415 | JGI25157J39369_1004602 | |||
| 416 | JGI25165J46597_1001237 | |||
| 417 | rootH1_10026547 | |||
| 418 | rootH1_10049259 | |||
| 419 | rootH2_10000343 | |||
| 420 | rootH2_10021608 | |||
| 421 | rootL2_10089064 | |||
| 422 | rootL2_10125616 | |||
| 423 | rootL2_10253563 | |||
| 424 | rootH1_10001370 | |||
| 425 | rootH1_10015647 | |||
| 426 | rootH1_10015649 | |||
| 427 | rootH1_10063115 | |||
| 428 | JGI25160J50197_1001283 | |||
| 429 | JGI25160J50197_1007572 | |||
| 430 | Ga0055536_1000009 | |||
| 431 | Ga0055528_1000572 | |||
| 432 | Ga0055530_10000943 | |||
| 433 | Ga0055531_10014302 | |||
| 434 | Ga0065165_1000017 | |||
| 435 | Ga0065714_10002263 | |||
| 436 | Ga0065714_10002864 | |||
| 437 | Ga0065714_10009241 | |||
| 438 | Ga0065714_10064508 | |||
| 439 | Ga0065714_10077226 | |||
| 440 | Ga0065704_10000229 | |||
| 441 | Ga0065704_10074770 | |||
| 442 | Ga0070658_10000080 | |||
| 443 | Ga0070658_10137360 | |||
| 444 | Ga0070676_10000140 | |||
| 445 | Ga0070683_100021523 | |||
| 446 | Ga0070683_100261577 | |||
| 447 | Ga0070670_100137395 | |||
| 448 | Ga0068869_100140679 | |||
| 449 | Ga0070666_10000042 | |||
| 450 | Ga0070666_10025999 | |||
| 451 | Ga0068868_100019165 | |||
| 452 | Ga0068868_100039680 | |||
| 453 | Ga0068868_100046323 | |||
| 454 | Ga0070660_100004493 | |||
| 455 | Ga0070661_100011648 | |||
| 456 | Ga0070668_100021853 | |||
| 457 | Ga0070668_100026530 | |||
| 458 | Ga0070675_100112069 | |||
| 459 | Ga0070671_100036952 | |||
| 460 | Ga0070671_100074571 | |||
| 461 | Ga0070673_100019435 | |||
| 462 | Ga0070673_100052488 | |||
| 463 | Ga0070688_100056164 | |||
| 464 | Ga0070659_100005576 | |||
| 465 | Ga0070659_100013275 | |||
| 466 | Ga0070667_100018965 | |||
| 467 | Ga0070667_100040632 | |||
| 468 | Ga0070678_100007973 | |||
| 469 | Ga0070662_100000081 | |||
| 470 | Ga0070662_100015275 | |||
| 471 | Ga0068867_100000843 | |||
| 472 | Ga0068867_100142024 | |||
| 473 | Ga0070679_100007702 | |||
| 474 | Ga0070679_100042032 | |||
| 475 | Ga0068853_100023658 | |||
| 476 | Ga0068853_100076495 | |||
| 477 | Ga0068853_100091621 | |||
| 478 | Ga0070665_100000001 | |||
| 479 | Ga0070665_100000072 | |||
| 480 | Ga0068855_100000090 | |||
| 481 | Ga0068855_100006355 | |||
| 482 | Ga0068855_100007153 | |||
| 483 | Ga0068855_100013657 | |||
| 484 | Ga0068855_100092382 | |||
| 485 | Ga0068855_100127328 | |||
| 486 | Ga0070664_100049893 | |||
| 487 | Ga0068857_100045029 | |||
| 488 | Ga0068857_100076669 | |||
| 489 | Ga0068857_100143997 | |||
| 490 | Ga0068854_100060967 | |||
| 491 | Ga0068856_100000129 | |||
| 492 | Ga0068856_100028219 | |||
| 493 | Ga0068856_100131497 | |||
| 494 | Ga0068852_100000281 | |||
| 495 | Ga0068859_100000130 | |||
| 496 | Ga0068864_100002546 | |||
| 497 | Ga0068863_100008085 | |||
| 498 | Ga0068863_100220245 | |||
| 499 | Ga0068858_100003098 | |||
| 500 | Ga0068860_100001453 | |||
| 501 | Ga0068860_100002504 | |||
| 502 | Ga0068860_100016152 | |||
| 503 | Ga0081539_10000337 | |||
| 504 | Ga0075366_10002447 | |||
| 505 | Ga0075366_10068606 | |||
| 506 | Ga0097621_100000039 | |||
| 507 | Ga0097621_100000081 | |||
| 508 | Ga0097621_100009477 | |||
| 509 | Ga0068871_100000300 | |||
| 510 | Ga0068871_100002549 | |||
| 511 | Ga0068871_100034096 | |||
| 512 | Ga0068865_100000180 | |||
| 513 | Ga0097620_100000130 | |||
| 514 | Ga0105240_10000283 | |||
| 515 | Ga0105240_10298018 | |||
| 516 | Ga0105245_10112423 | |||
| 517 | Ga0105247_10037070 | |||
| 518 | Ga0105241_10000514 | |||
| 519 | Ga0105241_10001533 | |||
| 520 | Ga0105241_10003973 | |||
| 521 | Ga0105241_10006553 | |||
| 522 | Ga0105241_10054143 | |||
| 523 | Ga0105241_10081126 | |||
| 524 | Ga0105241_10105016 | |||
| 525 | Ga0105242_10089423 | |||
| 526 | Ga0105237_10000411 | |||
| 527 | Ga0105237_10000963 | |||
| 528 | Ga0105237_10001962 | |||
| 529 | Ga0105237_10009372 | |||
| 530 | Ga0105237_10013274 | |||
| 531 | Ga0105237_10022043 | |||
| 532 | Ga0105237_10023345 | |||
| 533 | Ga0105237_10080916 | |||
| 534 | Ga0105237_10115306 | |||
| 535 | Ga0105238_10002377 | |||
| 536 | Ga0105249_10004268 | |||
| 537 | Ga0105249_10012134 | |||
| 538 | Ga0105249_10016508 | |||
| 539 | Ga0105239_10000013 | |||
| 540 | Ga0105239_10000106 | |||
| 541 | Ga0105239_10000132 | |||
| 542 | Ga0105239_10000528 | |||
| 543 | Ga0105239_10001538 | |||
| 544 | Ga0105239_10006197 | |||
| 545 | Ga0105239_10016107 | |||
| 546 | Ga0105239_10071450 | |||
| 547 | Ga0105246_10041915 | |||
| 548 | Ga0157373_10000261 | |||
| 549 | Ga0157373_10009612 | |||
| 550 | Ga0157373_10055596 | |||
| 551 | Ga0157371_10000050 | |||
| 552 | Ga0157371_10001830 | |||
| 553 | Ga0157371_10001867 | |||
| 554 | Ga0157371_10035312 | |||
| 555 | Ga0157371_10053526 | |||
| 556 | Ga0157371_10088341 | |||
| 557 | Ga0157370_10000285 | |||
| 558 | Ga0157370_10015299 | |||
| 559 | Ga0157369_10001695 | |||
| 560 | Ga0157369_10025169 | |||
| 561 | Ga0157369_10183580 | |||
| 562 | Ga0157374_10000007 | |||
| 563 | Ga0157374_10000135 | |||
| 564 | Ga0157374_10003320 | |||
| 565 | Ga0157374_10025011 | |||
| 566 | Ga0157374_10051431 | |||
| 567 | Ga0157374_10121795 | |||
| 568 | Ga0157374_10191255 | |||
| 569 | Ga0157378_10005063 | |||
| 570 | Ga0157378_10009998 | |||
| 571 | Ga0157378_10024654 | |||
| 572 | Ga0157378_10032461 | |||
| 573 | Ga0157378_10045337 | |||
| 574 | Ga0157378_10149541 | |||
| 575 | Ga0157378_10184865 | |||
| 576 | Ga0157378_10188375 | |||
| 577 | Ga0163162_10000097 | |||
| 578 | Ga0163162_10000899 | |||
| 579 | Ga0163162_10003016 | |||
| 580 | Ga0163162_10006867 | |||
| 581 | Ga0163162_10063136 | |||
| 582 | Ga0163162_10091521 | |||
| 583 | Ga0157372_10000011 | |||
| 584 | Ga0157372_10001527 | |||
| 585 | Ga0157372_10015408 | |||
| 586 | Ga0157372_10250569 | |||
| 587 | Ga0157372_10367948 | |||
| 588 | Ga0157375_10000250 | |||
| 589 | Ga0157375_10041548 | |||
| 590 | Ga0157375_10227951 | |||
| 591 | Ga0163163_10000389 | |||
| 592 | Ga0163163_10037815 | |||
| 593 | Ga0182008_10000012 | |||
| 594 | Ga0182008_10000078 | |||
| 595 | Ga0157379_10149917 | |||
| 596 | Ga0157376_10000374 | |||
| 597 | Ga0157376_10003324 | |||
| 598 | Ga0157376_10026381 | |||
| 599 | Ga0182006_1000166 | |||
| 600 | Ga0182006_1000297 | |||
| 601 | Ga0182006_1001324 | |||
| 602 | Ga0182006_1003364 | |||
| 603 | Ga0163161_10000215 | |||
| 604 | Ga0163161_10000574 | |||
| 605 | Ga0163161_10015258 | |||
| 606 | Ga0163161_10017912 | |||
| 607 | Ga0163161_10025057 | |||
| 608 | Ga0207427_100125 | |||
| 609 | Ga0209437_100008 | |||
| 610 | Ga0209437_100017 | |||
| 611 | Ga0209258_100029 | |||
| 612 | Ga0209646_1000006 | |||
| 613 | Ga0209646_1001501 | |||
| 614 | Ga0209026_1000954 | |||
| 615 | Ga0209148_1000163 | |||
| 616 | Ga0209233_1000024 | |||
| 617 | Ga0209673_1000354 | |||
| 618 | Ga0209676_1000001 | |||
| 619 | Ga0209564_1003201 | |||
| 620 | Ga0209564_1004937 | |||
| 621 | Ga0209758_1003655 | |||
| 622 | Ga0209050_1000018 | |||
| 623 | Ga0209050_1000163 | |||
| 624 | Ga0207426_1000093 | |||
| 625 | Ga0207426_1002304 | |||
| 626 | Ga0207426_1023208 | |||
| 627 | Ga0209257_1005362 | |||
| 628 | Ga0207710_10059063 | |||
| 629 | Ga0207680_10000228 | |||
| 630 | Ga0207647_10000028 | |||
| 631 | Ga0207647_10000058 | |||
| 632 | Ga0207647_10015760 | |||
| 633 | Ga0207645_10001698 | |||
| 634 | Ga0207705_10000035 | |||
| 635 | Ga0207654_10006862 | |||
| 636 | Ga0207695_10000684 | |||
| 637 | Ga0207695_10016050 | |||
| 638 | Ga0207695_10150857 | |||
| 639 | Ga0207695_10219468 | |||
| 640 | Ga0207671_10001126 | |||
| 641 | Ga0207671_10001753 | |||
| 642 | Ga0207671_10003445 | |||
| 643 | Ga0207671_10004030 | |||
| 644 | Ga0207671_10006546 | |||
| 645 | Ga0207671_10036741 | |||
| 646 | Ga0207657_10008412 | |||
| 647 | Ga0207694_10133450 | |||
| 648 | Ga0207650_10140639 | |||
| 649 | Ga0207659_10068846 | |||
| 650 | Ga0207644_10026621 | |||
| 651 | Ga0207644_10098507 | |||
| 652 | Ga0207690_10010265 | |||
| 653 | Ga0207690_10118169 | |||
| 654 | Ga0207706_10000147 | |||
| 655 | Ga0207706_10003522 | |||
| 656 | Ga0207704_10000076 | |||
| 657 | Ga0207704_10068098 | |||
| 658 | Ga0207689_10014206 | |||
| 659 | Ga0207689_10027846 | |||
| 660 | Ga0207689_10109231 | |||
| 661 | Ga0207661_10140985 | |||
| 662 | Ga0207679_10014731 | |||
| 663 | Ga0207667_10000009 | |||
| 664 | Ga0207667_10007095 | |||
| 665 | Ga0207667_10007728 | |||
| 666 | Ga0207667_10105740 | |||
| 667 | Ga0207667_10259955 | |||
| 668 | Ga0207651_10013810 | |||
| 669 | Ga0207651_10083717 | |||
| 670 | Ga0207668_10114461 | |||
| 671 | Ga0207640_10187732 | |||
| 672 | Ga0207658_10053090 | |||
| 673 | Ga0207677_10010111 | |||
| 674 | Ga0207677_10099398 | |||
| 675 | Ga0207639_10012990 | |||
| 676 | Ga0207639_10040244 | |||
| 677 | Ga0207702_10000300 | |||
| 678 | Ga0207702_10036631 | |||
| 679 | Ga0207702_10043918 | |||
| 680 | Ga0207641_10000158 | |||
| 681 | Ga0207641_10091729 | |||
| 682 | Ga0207648_10000648 | |||
| 683 | Ga0207648_10087474 | |||
| 684 | Ga0207676_10237559 | |||
| 685 | Ga0207674_10045717 | |||
| 686 | Ga0207674_10092281 | |||
| 687 | Ga0207675_100005173 | |||
| 688 | Ga0207683_10038383 | |||
| 689 | Ga0207683_10125373 | |||
| 690 | Ga0207698_10044934 | |||
| 691 | Ga0268266_10000089 | |||
| 692 | Ga0268266_10000232 | |||
| 693 | Ga0268264_10001350 | |||
| 694 | Ga0268264_10001875 | |||
| 695 | Ga0268264_10002631 | |||
| 696 | Ga0268264_10028914 | |||
| 697 | Ga0307515_10000246 | |||
| 698 | Ga0307515_10000707 | |||
| 699 | Ga0307515_10000993 | |||
| 700 | Ga0307515_10124457 | |||
| 701 | Ga0265327_10000284 | |||
| 702 | Ga0307509_10198039 | |||
| 703 | Ga0307516_10000189 | |||
| 704 | Ga0307407_10000017 | |||
| 705 | Ga0307412_10000045 | |||
| 706 | Ga0307416_100000011 | |||
| 707 | Ga0307414_10000533 | |||
| 708 | Ga0307414_10019489 | |||
| 709 | Ga0307414_10056781 | |||
| 710 | Ga0307414_10114465 | |||
| 711 | Ga0307507_10001380 | |||
| 712 | Ga0307510_10001267 | |||
| 713 | Ga0307510_10004144 | |||
| 714 | Ga0316584_0009501 | |||
| 715 | Ga0395899_0000188 | |||
| 716 | Ga0395899_0000888 | |||
| 717 | Ga0395900_0000226 | |||
| 718 | Ga0395898_0004590 | |||
| 719 | Ga0395905_0000068 | |||
| 720 | Ga0395901_0000136 | |||
| 721 | Ga0436365_0269604 | |||
| 722 | Ga0436365_1732514 | |||
| 723 | Ga0436361_0803447 | |||
| 724 | Ga0451795_1603602 | |||
| 725 | Ga0439431_0000539 | |||
| 726 | Ga0466969_0028693 | |||
| 727 | Ga0466969_0035181 | |||
| 728 | Ga0466966_0019459 | |||
| 729 | Ga0466961_0035312 | |||
| 730 | Ga0466971_0017089 | |||
| 731 | Ga0466959_0008498 | |||
| 732 | Ga0466958_0039730 | |||
| 733 | Ga0466958_0080989 | |||
| 734 | Ga0495650_0000273 | |||
| 735 | Ga0495585_0000132 | |||
| 736 | Ga0495585_0037031 | |||
| 737 | Ga0495583_0045690 | |||
| 738 | Ga0495606_0000130 | |||
| 739 | Ga0495606_0011133 | |||
| 740 | Ga0495610_0000151 | |||
| 741 | Ga0495610_0002033 | |||
| 742 | Ga0495616_0002729 | |||
| 743 | Ga0495631_0005500 | |||
| 744 | Ga0495644_0007986 | |||
| 745 | Ga0495648_0043766 | |||
| 746 | Ga0495609_0039161 | |||
| 747 | Ga0495633_0000035 | |||
| 748 | Ga0495633_0009219 | |||
| 749 | Ga0495668_0000032 | |||
| 750 | Ga0495668_0000513 | |||
| 751 | Ga0495625_0000036 | |||
| 752 | Ga0495625_0000227 | |||
| 753 | Ga0495625_0000358 | |||
| 754 | Ga0495625_0012165 | |||
| 755 | Ga0495625_0050616 | |||
| 756 | Ga0495661_0001031 | |||
| 757 | Ga0495661_0010531 | |||
| 758 | Ga0495661_0058503 | |||
| 759 | Ga0495649_0000017 | |||
| 760 | Ga0495660_0005464 | |||
| 761 | Ga0495687_000001 | |||
| 762 | Ga0495687_002988 | |||
| 763 | Ga0495687_005612 | |||
| 764 | Ga0495677_0006183 | |||
| 765 | Ga0495686_0022968 | |||
| 766 | Ga0495686_0033922 | |||
| 767 | Ga0495686_0046651 | |||
| 768 | Ga0495614_0052396 | |||
| 769 | Ga0496115_0114154 | |||
| 770 | Ga0496123_0012248 | |||
| 771 | Ga0501034_0031521 | |||
| 772 | Ga0501034_0034236 | |||
| 773 | Ga0501241_009072 | |||
| 774 | nmdc:mga0k408_1683_c1 | |||
| 775 | nmdc:mga0k408_23843_c1 | |||
| 776 | Ga0500644_0000528 | |||
| 777 | Ga0500583_0000367 | |||
| 778 | Ga0500583_0030849 | |||
| 779 | Ga0500651_0000646 | |||
| 780 | Ga0500607_045016 | |||
| 781 | Ga0500608_000502 | |||
| 782 | Ga0500618_000004 | |||
| 783 | Ga0500642_0003131 | |||
| 784 | Ga0500652_015478 | |||
| 785 | Ga0500568_0037049 | |||
| 786 | Ga0500577_0001759 | |||
| 787 | Ga0500604_0006911 | |||
| 788 | Ga0500616_0005705 | |||
| 789 | Ga0500633_0001643 | |||
| 790 | Ga0500611_000028 | |||
| 791 | 2599477146 | |||
| 792 | 2738755280 | |||
| 793 | 2738764338 | |||
| 794 | 2738855151 | |||
| 795 | 2776613809 | |||
| 796 | 2819547833 | |||
| 797 | 2852623552 | |||
| 798 | 2884937546 | |||
| 799 | 2896110560 | |||
| 800 | 2911138926 | |||
| 801 | 2919442076 | |||
| 802 | 2928079059 | |||
| 803 | 2928148570 | |||
| 804 | 2929239493 | |||
| 805 | 2932085864 | |||
| 806 | 2945999747 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f1m-assembly2.cif.gz_C | conformational flexibility in the multidrug efflux system protein acra | 0.9526 | 207 | 282 |
| 3mxz-assembly1.cif.gz_A | crystal structure of tubulin folding cofactor a from arabidopsis thaliana | 0.9401 | 204 | 281 |
| 2f1m-assembly1.cif.gz_A | conformational flexibility in the multidrug efflux system protein acra | 0.9285 | 205 | 282 |
| 2f1m-assembly2.cif.gz_D | conformational flexibility in the multidrug efflux system protein acra | 0.9172 | 205 | 282 |
| 5ng5-assembly1.cif.gz_B | multi-drug efflux; membrane transport; rnd superfamily; drug resistance | 0.8533 | 207 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9595 | 207 | 278 | 1.10.287.470 |
| 3mxzA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9401 | 204 | 281 | 1.20.58.90 |
| 2f1mD03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9307 | 207 | 278 | 1.10.287.470 |
| 2f1mA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9299 | 207 | 278 | 1.10.287.470 |
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9223 | 207 | 278 | 1.10.287.470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A512B371-F1-model_v4 | Membrane protein | 0.8768 | 46 | 494 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A2P8FRT5-F1-model_v4 | Outer membrane efflux protein | 0.8621 | 32 | 494 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A1G8BL73-F1-model_v4 | Outer membrane protein TolC | 0.8555 | 32 | 494 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A433WC78-F1-model_v4 | TolC family protein | 0.8539 | 31 | 492 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A512B371-F1-model_v4 | Membrane protein | 0.8449 | 46 | 494 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |