F435366

General Info

Members Datasets Scaffolds Average Seq Length
403 228 806 600

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10001708|Ga0105250_100017082
Length 647
Sequence LRSVCAAVVQFIIRKTYYTSINYAVSSAYKNGTHFALLNSILYTSWNSLMASTFGFTLQDWQRSYQQNPQQITALLAAHLDAIDAQDNAWLYLATPAQLQAQIEPLLASYQRNPAALPLFGVPFAVKDNIDVAGWPTSAACPAFTYTAEADAFVVAQLKAAGAVVIGKTNLDQYATGLVGTRSPFGAVSNTFNPDYVSGGSSSGSASVLARGLVGFSLGTDTAGSGRVPAGFNNIVGLKPTKGWFSASGVVPACRLNDTISVFALTVEDAFAVATAAGGYDAGDAYSRSNPHTAPASFKAQPDFAIPATPEFFGDKQAEAAWLAALEQLQAGGATLHPIDFSLFHQLAEQLYYGPWVAERTVAVGEMIHRPEEMDPVVYGIVSSGLKYTAVEAYQAEYLRAELTRQIQQTLAQFDALLVPTSPTIHTLDEMQQEPVHYNSQFGTYTNFTNLADLSALALPAPFRADGLPAGITLIAPAWHDRALAGFGLRWQQQMALPLGATGKAAPAQSYALPISTDHVRVAVVGAHLTGMPLNFQLTTRQAVLVEETQTASHYRLFALLDGPIKKPGLLRGESGAAITVELWDIPLARFGEFVAEIPAPLGIGSLTLADGRIVKGFICEPAVLSQALEITEFGGWRNWLASLGSK

Samples

Sample ID Description Type Environment
1 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
69 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
72 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
75 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
121 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
131 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
132 2506520008 Serratia plymuthica AS12 Isolate Unclassified
133 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
134 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
135 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
136 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
137 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
138 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
139 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
140 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
141 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
142 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
143 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
144 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
145 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
146 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
147 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
148 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
149 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
150 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
151 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
152 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
153 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
154 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
155 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
156 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
157 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
158 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
159 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
160 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
161 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
162 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
163 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
164 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
165 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
166 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
167 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
168 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
169 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
170 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
171 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
172 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
173 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
174 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
175 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
176 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
177 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
178 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
179 2847085930 Erwinia persicina B64 Isolate Bulb
180 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
181 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
182 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
183 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
184 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
185 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
186 2858950400 Achromobacter sp. K91 Isolate Unclassified
187 2865014394 Pantoea sp. R-71966 Isolate Unclassified
188 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
189 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
190 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
191 2876601092 Pantoea endophytica 596 Isolate Unclassified
192 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
193 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
194 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
195 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
196 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
197 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
198 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
199 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
200 2904504865 Serratia marcescens 1822 Isolate Unclassified
201 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
202 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
203 2919150387 Rahnella aceris 1817 Isolate Unclassified
204 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
205 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
206 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
207 2927143783 Rahnella sp. 2050 Isolate Unclassified
208 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
209 2937967321 Serratia sp. YC16 Isolate Unclassified
210 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
211 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
212 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
213 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
214 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
215 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
216 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
217 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
218 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
219 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
220 640753048 Serratia proteamaculans 568 Isolate Endosphere
221 8004592986 Serratia sp. S119 Isolate Unclassified
222 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
223 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
224 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
225 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
226 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
227 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
228 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.68
Metatranscriptomes 0
Isolates 24.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0.25
Endosphere 6.7
Nodule 1.49
Rhizoplane 4.47
Rhizosphere 61.29
Stem 0
Stem Tuber 1.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105250_10001708 3300009092 Bacteria 11611
2 SwRhRL2b_contig_285204 2162886007 Bacteria 3541
3 JGI25162J39368_1000007 3300002737 Bacteria 403947
4 JGI25162J39368_1004459 3300002737 Bacteria 3229
5 JGI25163J39215_1000410 3300002771 Bacteria 13470
6 JGI25164J39214_1000010 3300002772 Bacteria 288863
7 JGI25164J39214_1000016 3300002772 Bacteria 202035
8 Ga0055538_1000006 3300003751 Bacteria 403947
9 Ga0055539_1000010 3300003752 Bacteria 403947
10 Ga0055533_1000013 3300003756 Bacteria 403947
11 Ga0055525_1000015 3300003759 Bacteria 403947
12 Ga0055541_1000007 3300003841 Bacteria 403947
13 Ga0058692_1000010 3300003856 Bacteria 326761
14 Ga0058692_1000154 3300003856 Bacteria 43640
15 Ga0058692_1000299 3300003856 Bacteria 25458
16 Ga0058692_1000420 3300003856 Bacteria 19522
17 Ga0058692_1001366 3300003856 Bacteria 9055
18 Ga0065703_1019316 3300005272 Bacteria 3218
19 Ga0065704_10000667 3300005289 Bacteria 21743
20 Ga0065704_10088329 3300005289 Bacteria 2945
21 Ga0065704_10092254 3300005289 Bacteria 2665
22 Ga0070661_100000053 3300005344 Bacteria 89030
23 Ga0070671_100076342 3300005355 Bacteria 2799
24 Ga0070662_100020138 3300005457 Bacteria 4539
25 Ga0068853_100000005 3300005539 Bacteria 366404
26 Ga0070665_100013569 3300005548 Bacteria 8196
27 Ga0070664_100000030 3300005564 Bacteria 89030
28 Ga0068858_100005788 3300005842 Bacteria 12076
29 Ga0075364_10003334 3300006051 Bacteria 9112
30 Ga0075364_10052142 3300006051 Bacteria 2673
31 Ga0079104_1000083 3300006946 Bacteria 137254
32 Ga0079104_1000448 3300006946 Bacteria 46655
33 Ga0079104_1001008 3300006946 Bacteria 21846
34 Ga0105251_10000016 3300009011 Bacteria 146400
35 Ga0105251_10000058 3300009011 Bacteria 103857
36 Ga0105251_10000715 3300009011 Bacteria 30569
37 Ga0105251_10002907 3300009011 Bacteria 12871
38 Ga0105251_10003295 3300009011 Bacteria 11819
39 Ga0105251_10012111 3300009011 Bacteria 4895
40 Ga0105251_10021101 3300009011 Bacteria 3408
41 Ga0105244_10000026 3300009036 Bacteria 216056
42 Ga0105244_10000137 3300009036 Bacteria 75679
43 Ga0105244_10000704 3300009036 Bacteria 29004
44 Ga0105244_10002484 3300009036 Bacteria 13880
45 Ga0105244_10002875 3300009036 Bacteria 12746
46 Ga0105244_10003517 3300009036 Bacteria 11134
47 Ga0105244_10011561 3300009036 Bacteria 5279
48 Ga0105244_10011596 3300009036 Bacteria 5270
49 Ga0105244_10012030 3300009036 Bacteria 5145
50 Ga0105244_10017125 3300009036 Bacteria 4106
51 Ga0105244_10017759 3300009036 Bacteria 4011
52 Ga0105250_10000020 3300009092 Bacteria 242010
53 Ga0105250_10000889 3300009092 Bacteria 17674
54 Ga0105250_10002067 3300009092 Bacteria 10306
55 Ga0105250_10003063 3300009092 Bacteria 8067
56 Ga0105250_10006576 3300009092 Bacteria 5061
57 Ga0105250_10008603 3300009092 Bacteria 4327
58 Ga0105250_10010174 3300009092 Bacteria 3926
59 Ga0105250_10012746 3300009092 Bacteria 3463
60 Ga0105247_10000443 3300009101 Bacteria 35032
61 Ga0105247_10000630 3300009101 Bacteria 28152
62 Ga0105243_10000053 3300009148 Bacteria 137373
63 Ga0105241_10000004 3300009174 Bacteria 803007
64 Ga0105242_10003203 3300009176 Bacteria 12746
65 Ga0105237_10001925 3300009545 Bacteria 26498
66 Ga0105249_10001356 3300009553 Bacteria 21405
67 Ga0105246_10035196 3300011119 Bacteria 3345
68 Ga0157373_10000818 3300013100 Bacteria 24099
69 Ga0157373_10034954 3300013100 Bacteria 3610
70 Ga0157371_10000044 3300013102 Bacteria 194689
71 Ga0157371_10000267 3300013102 Bacteria 71120
72 Ga0157371_10000589 3300013102 Bacteria 43110
73 Ga0157371_10000766 3300013102 Bacteria 37124
74 Ga0157371_10031922 3300013102 Bacteria 3792
75 Ga0157370_10000276 3300013104 Bacteria 65208
76 Ga0157370_10199108 3300013104 Bacteria 1858
77 Ga0157369_10002704 3300013105 Bacteria 21151
78 Ga0157369_10010851 3300013105 Bacteria 10376
79 Ga0163162_10039659 3300013306 Bacteria 4707
80 Ga0157372_10050173 3300013307 Bacteria 4642
81 Ga0157372_10064670 3300013307 Bacteria 4104
82 Ga0157375_10099539 3300013308 Bacteria 2987
83 Ga0182008_10001594 3300014497 Bacteria 15094
84 Ga0182008_10009560 3300014497 Bacteria 5224
85 Ga0182006_1000013 3300015261 Bacteria 363224
86 Ga0182006_1012228 3300015261 Bacteria 3756
87 Ga0182007_10006297 3300015262 Bacteria 5104
88 Ga0163161_10000001 3300017792 Bacteria 2041488
89 Ga0163161_10002687 3300017792 Bacteria 12643
90 Ga0163161_10004040 3300017792 Bacteria 10266
91 Ga0209760_100034 3300025207 Bacteria 135933
92 Ga0209784_100022 3300025224 Bacteria 403999
93 Ga0209566_100021 3300025225 Bacteria 403999
94 Ga0209674_100038 3300025226 Bacteria 403999
95 Ga0209563_100042 3300025230 Bacteria 403999
96 Ga0207427_100027 3300025231 Bacteria 403999
97 Ga0209437_100049 3300025233 Bacteria 403999
98 Ga0209437_100063 3300025233 Bacteria 335477
99 Ga0209677_100025 3300025253 Bacteria 403999
100 Ga0209233_1005285 3300025261 Bacteria 4303
101 Ga0207696_1000001 3300025711 Bacteria 2579611
102 Ga0207696_1000036 3300025711 Bacteria 337736
103 Ga0207696_1000453 3300025711 Bacteria 35831
104 Ga0207696_1000952 3300025711 Bacteria 17674
105 Ga0207696_1001410 3300025711 Bacteria 13120
106 Ga0207696_1002790 3300025711 Bacteria 8300
107 Ga0207696_1007742 3300025711 Bacteria 4175
108 Ga0207696_1010303 3300025711 Bacteria 3433
109 Ga0207655_1000011 3300025728 Bacteria 643321
110 Ga0207655_1000057 3300025728 Bacteria 273598
111 Ga0207655_1000112 3300025728 Bacteria 170624
112 Ga0207655_1000181 3300025728 Bacteria 112734
113 Ga0207655_1000218 3300025728 Bacteria 98543
114 Ga0207655_1000788 3300025728 Bacteria 34605
115 Ga0207655_1000875 3300025728 Bacteria 31869
116 Ga0207655_1009713 3300025728 Bacteria 5938
117 Ga0207655_1010898 3300025728 Bacteria 5466
118 Ga0207655_1012969 3300025728 Bacteria 4820
119 Ga0207655_1023434 3300025728 Bacteria 3062
120 Ga0207713_1000007 3300025735 Bacteria 564979
121 Ga0207713_1000024 3300025735 Bacteria 339156
122 Ga0207713_1000026 3300025735 Bacteria 319032
123 Ga0207713_1000060 3300025735 Bacteria 213145
124 Ga0207713_1002303 3300025735 Bacteria 14042
125 Ga0207713_1003113 3300025735 Bacteria 11502
126 Ga0207713_1003357 3300025735 Bacteria 10983
127 Ga0207713_1036054 3300025735 Bacteria 2126
128 Ga0207710_10000009 3300025900 Bacteria 485205
129 Ga0207710_10000049 3300025900 Bacteria 186492
130 Ga0207654_10000006 3300025911 Bacteria 815027
131 Ga0207671_10004590 3300025914 Bacteria 13123
132 Ga0207649_10000070 3300025920 Bacteria 89018
133 Ga0207709_10000001 3300025935 Bacteria 2228154
134 Ga0207679_10000021 3300025945 Bacteria 221630
135 Ga0207712_10027695 3300025961 Bacteria 3785
136 Ga0207703_10004138 3300026035 Bacteria 11964
137 Ga0207639_10000010 3300026041 Bacteria 415264
138 Ga0209281_1000008 3300027111 Bacteria 867470
139 Ga0209281_1000050 3300027111 Bacteria 320102
140 Ga0209281_1000130 3300027111 Bacteria 191756
141 Ga0209371_1000002 3300027312 Bacteria 1551985
142 Ga0209371_1000006 3300027312 Bacteria 1055642
143 Ga0209371_1000017 3300027312 Bacteria 625776
144 Ga0209371_1000053 3300027312 Bacteria 264616
145 Ga0209371_1000057 3300027312 Bacteria 238850
146 Ga0209371_1000412 3300027312 Bacteria 44123
147 Ga0209371_1000945 3300027312 Bacteria 22636
148 Ga0209371_1001132 3300027312 Bacteria 19583
149 Ga0209371_1001738 3300027312 Bacteria 13726
150 Ga0209371_1005884 3300027312 Bacteria 4718
151 Ga0209371_1006614 3300027312 Bacteria 4251
152 Ga0209371_1007332 3300027312 Bacteria 3865
153 Ga0268256_1000002 3300030500 Bacteria 1535763
154 Ga0268256_1000007 3300030500 Bacteria 1055326
155 Ga0268256_1000053 3300030500 Bacteria 264616
156 Ga0268256_1000091 3300030500 Bacteria 148069
157 Ga0268256_1000798 3300030500 Bacteria 22636
158 Ga0268256_1004093 3300030500 Bacteria 6233
159 Ga0268256_1005873 3300030500 Bacteria 4700
160 Ga0268256_1007523 3300030500 Bacteria 3865
161 Ga0439436_0000073 3300041404 Bacteria 25935
162 Ga0439438_000003 3300041405 Bacteria 464587
163 Ga0439438_001119 3300041405 Bacteria 11922
164 Ga0439438_001814 3300041405 Bacteria 9369
165 Ga0439447_000341 3300041407 Bacteria 16808
166 Ga0439447_000361 3300041407 Bacteria 16505
167 Ga0439447_000968 3300041407 Bacteria 10478
168 Ga0439447_004775 3300041407 Bacteria 4611
169 Ga0439466_0000002 3300041411 Bacteria 494198
170 Ga0439466_0006008 3300041411 Bacteria 4621
171 Ga0439432_002404 3300042006 Bacteria 7061
172 Ga0439432_008611 3300042006 Bacteria 3580
173 Ga0439432_022407 3300042006 Bacteria 2086
174 Ga0439452_000004 3300042010 Bacteria 764268
175 Ga0439452_000013 3300042010 Bacteria 364058
176 Ga0439452_001346 3300042010 Bacteria 10230
177 Ga0439452_001445 3300042010 Bacteria 9707
178 Ga0439463_000452 3300042016 Bacteria 11448
179 Ga0450904_000514 3300042139 Bacteria 7449
180 Ga0450907_000495 3300042146 Bacteria 10884
181 Ga0439434_0010265 3300042435 Bacteria 2760
182 Ga0439464_0003621 3300042439 Bacteria 3915
183 Ga0450893_0000327 3300042532 Bacteria 6642
184 Ga0495627_000028 3300046453 Bacteria 234737
185 Ga0495591_000124 3300046458 Bacteria 84206
186 Ga0495650_0000039 3300046471 Bacteria 375501
187 Ga0495650_0000113 3300046471 Bacteria 196536
188 Ga0495607_0000106 3300046501 Bacteria 88081
189 Ga0495607_0010125 3300046501 Bacteria 6345
190 Ga0495607_0012378 3300046501 Bacteria 5637
191 Ga0495607_0033711 3300046501 Bacteria 3114
192 Ga0495583_0000131 3300046506 Bacteria 125393
193 Ga0495583_0001159 3300046506 Bacteria 28688
194 Ga0495606_0000032 3300046507 Bacteria 248690
195 Ga0495606_0000794 3300046507 Bacteria 48239
196 Ga0495606_0001088 3300046507 Bacteria 38905
197 Ga0495610_0016711 3300046512 Bacteria 4213
198 Ga0495620_0002491 3300046515 Bacteria 10683
199 Ga0495631_0004526 3300046518 Bacteria 7387
200 Ga0495637_0001643 3300046520 Bacteria 12931
201 Ga0495643_0060568 3300046522 Bacteria 2009
202 Ga0495648_0022021 3300046524 Bacteria 4398
203 Ga0495648_0026403 3300046524 Bacteria 3910
204 Ga0495648_0030666 3300046524 Bacteria 3551
205 Ga0495654_0000031 3300046530 Bacteria 206800
206 Ga0495654_0000119 3300046530 Bacteria 88217
207 Ga0495654_0000578 3300046530 Bacteria 29450
208 Ga0495654_0010988 3300046530 Bacteria 4916
209 Ga0495654_0011570 3300046530 Bacteria 4771
210 Ga0495654_0027023 3300046530 Bacteria 2945
211 Ga0495597_0001564 3300046542 Bacteria 16162
212 Ga0495668_0003975 3300046616 Bacteria 10775
213 Ga0495625_0003804 3300046660 Bacteria 14607
214 Ga0495661_0001936 3300046665 Bacteria 16465
215 Ga0495649_0005514 3300046694 Bacteria 8023
216 Ga0495589_0000002 3300046794 Bacteria 758846
217 Ga0495589_0000763 3300046794 Bacteria 20550
218 Ga0495589_0009120 3300046794 Bacteria 5158
219 Ga0495660_0000023 3300046810 Bacteria 272605
220 Ga0495660_0000034 3300046810 Bacteria 201261
221 Ga0495672_0000029 3300047320 Bacteria 305231
222 Ga0495672_0000054 3300047320 Bacteria 230777
223 Ga0495672_0000084 3300047320 Bacteria 156238
224 Ga0495676_0000002 3300047321 Bacteria 373918
225 Ga0495679_000024 3300047446 Bacteria 205864
226 Ga0495679_000255 3300047446 Bacteria 44133
227 Ga0495679_001008 3300047446 Bacteria 17324
228 Ga0495673_0000292 3300047469 Bacteria 67107
229 Ga0495673_0001194 3300047469 Bacteria 21723
230 Ga0495686_0025888 3300047472 Bacteria 3842
231 Ga0496100_0029695 3300048903 Bacteria 3384
232 Ga0496101_0003408 3300048904 Bacteria 9915
233 Ga0496102_0003134 3300048905 Bacteria 14021
234 Ga0496104_0000208 3300048907 Bacteria 52252
235 Ga0496105_0004102 3300048908 Bacteria 10920
236 Ga0496116_0000023 3300048919 Bacteria 475792
237 Ga0496116_0000112 3300048919 Bacteria 181946
238 Ga0496116_0000715 3300048919 Bacteria 42503
239 Ga0496116_0001156 3300048919 Bacteria 31157
240 Ga0496116_0074850 3300048919 Bacteria 2128
241 Ga0496117_0000100 3300048920 Bacteria 194307
242 Ga0496117_0000103 3300048920 Bacteria 189316
243 Ga0496117_0000238 3300048920 Bacteria 104303
244 Ga0496117_0002870 3300048920 Bacteria 20944
245 Ga0496117_0016258 3300048920 Bacteria 6287
246 Ga0496117_0018547 3300048920 Bacteria 5757
247 Ga0496118_0000046 3300048921 Bacteria 271783
248 Ga0496118_0000454 3300048921 Bacteria 67788
249 Ga0496118_0000959 3300048921 Bacteria 45037
250 Ga0496118_0001062 3300048921 Bacteria 42938
251 Ga0496118_0012003 3300048921 Bacteria 8371
252 Ga0496118_0018950 3300048921 Bacteria 6171
253 Ga0496118_0024831 3300048921 Bacteria 5161
254 Ga0496119_0000031 3300048922 Bacteria 239685
255 Ga0496119_0000374 3300048922 Bacteria 61884
256 Ga0496119_0002749 3300048922 Bacteria 18923
257 Ga0496119_0004318 3300048922 Bacteria 14197
258 Ga0496119_0004731 3300048922 Bacteria 13378
259 Ga0496119_0008560 3300048922 Bacteria 8972
260 Ga0496119_0011573 3300048922 Bacteria 7282
261 Ga0496119_0024745 3300048922 Bacteria 4214
262 Ga0496120_0000017 3300048923 Bacteria 269222
263 Ga0496120_0000084 3300048923 Bacteria 156678
264 Ga0496120_0000275 3300048923 Bacteria 86166
265 Ga0496120_0000317 3300048923 Bacteria 79762
266 Ga0496120_0000491 3300048923 Bacteria 61896
267 Ga0496120_0000806 3300048923 Bacteria 45060
268 Ga0496120_0001442 3300048923 Bacteria 28529
269 Ga0496120_0001680 3300048923 Bacteria 25410
270 Ga0496120_0004679 3300048923 Bacteria 11297
271 Ga0496121_0001130 3300048924 Bacteria 46848
272 Ga0496121_0088113 3300048924 Bacteria 2434
273 Ga0496121_0093948 3300048924 Bacteria 2334
274 Ga0496122_0000067 3300048925 Bacteria 231365
275 Ga0496122_0007703 3300048925 Bacteria 11865
276 Ga0496122_0011010 3300048925 Bacteria 9241
277 Ga0496123_0000056 3300048926 Bacteria 231365
278 Ga0496123_0001657 3300048926 Bacteria 29899
279 Ga0496123_0026197 3300048926 Bacteria 4376
280 Ga0496123_0030124 3300048926 Bacteria 3978
281 Ga0496124_0000007 3300048927 Bacteria 883534
282 Ga0496124_0000017 3300048927 Bacteria 444389
283 Ga0496124_0000338 3300048927 Bacteria 85856
284 Ga0496124_0000362 3300048927 Bacteria 82902
285 Ga0496124_0000965 3300048927 Bacteria 45797
286 Ga0496124_0069253 3300048927 Bacteria 2929
287 Ga0496125_0000183 3300048928 Bacteria 137652
288 Ga0496125_0000245 3300048928 Bacteria 111310
289 Ga0496125_0010371 3300048928 Bacteria 9425
290 Ga0496125_0016151 3300048928 Bacteria 7180
291 Ga0496126_0006344 3300048929 Bacteria 13188
292 Ga0496126_0018190 3300048929 Bacteria 6972
293 Ga0496126_0052322 3300048929 Bacteria 3712
294 Ga0496126_0128877 3300048929 Bacteria 2188
295 Ga0495678_000607 3300049459 Bacteria 33697
296 Ga0495682_0000003 3300049460 Bacteria 515787
297 Ga0501034_0016688 3300049571 Bacteria 7529
298 Ga0501047_0003432 3300049581 Bacteria 14984
299 Ga0501035_0070691 3300049822 Bacteria 3091
300 Ga0501044_0005080 3300049823 Bacteria 14681
301 Ga0501226_000032 3300049853 Bacteria 73400
302 Ga0500566_0009776 3300053094 Bacteria 5663
303 Ga0500621_000006 3300053126 Bacteria 245480
304 Ga0500622_0001406 3300053156 Bacteria 19394
305 Ga0500634_0000284 3300053161 Bacteria 16228
306 2506577452 2506520007 Bacteria 5442880
307 2506582590 2506520008 Bacteria 5443009
308 2508851390 2508501071 Bacteria 5454741
309 2511381912 2511231025 Bacteria 5324661
310 2511432748 2511231035 Bacteria 5341610
311 2538427482 2537561728 Bacteria 5149301
312 2552747245 2551306352 Bacteria 3873115
313 2585826557 2585427591 Bacteria 5482980
314 2585832662 2585427592 Bacteria 5370892
315 2599880370 2599185288 Bacteria 6666191
316 2599928135 2599185299 Bacteria 4854625
317 2599946949 2599185303 Bacteria 6512725
318 2599970787 2599185307 Bacteria 6194719
319 2601539770 2600255257 Bacteria 5597196
320 2601625053 2600255283 Bacteria 6061572
321 2601758119 2600255310 Bacteria 5600903
322 2601763629 2600255311 Bacteria 5598766
323 2608670528 2608642108 Bacteria 4104624
324 2621300056 2619619299 Bacteria 6649820
325 2640733800 2639762793 Bacteria 3943681
326 2650900209 2648501693 Bacteria 5069560
327 2656278367 2654587920 Bacteria 5475511
328 2671109221 2667528173 Bacteria 5375747
329 2671585904 2671180115 Bacteria 5353919
330 2678230781 2675903507 Bacteria 3737791
331 2686354448 2684622997 Bacteria 4624240
332 2687580462 2687453129 Bacteria 4387428
333 2689443930 2687453601 Bacteria 5546041
334 2712470075 2711768156 Bacteria 4471618
335 2738670058 2738541265 Bacteria 6594665
336 2738748451 2738541282 Bacteria 6593925
337 2738806594 2738541294 Bacteria 6925949
338 2738857493 2738541303 Bacteria 6591772
339 2738893954 2738541309 Bacteria 6926455
340 2745160986 2744054655 Bacteria 3552603
341 2772437960 2772190666 Bacteria 5117644
342 2774388663 2773857761 Bacteria 3837365
343 2774438677 2773857770 Bacteria 3911866
344 2791921328 2791354903 Bacteria 4937680
345 2793404194 2791355275 Bacteria 4429597
346 2808979284 2808606385 Bacteria 6711065
347 2808994832 2808606388 Bacteria 6706662
348 2809124264 2808606414 Bacteria 4917181
349 2812367436 2811994881 Bacteria 6298475
350 2813728554 2811995292 Bacteria 5303342
351 2814696068 2814123068 Bacteria 5687681
352 2817491396 2816332298 Bacteria 6852809
353 2844532604 2844528606 Bacteria 4733806
354 2847089126 2847085930 Bacteria 5070450
355 2847801301 2847797336 Bacteria 5176640
356 2852614268 2852612431 Bacteria 6885235
357 2852667994 2852667396 Bacteria 6885555
358 2855197163 2855195626 Bacteria 4927512
359 2857544336 2857542790 Bacteria 5326616
360 2858468674 2858466076 Bacteria 4722413
361 2858953726 2858950400 Bacteria 6783797
362 2865018610 2865014394 Bacteria 4764573
363 2869553305 2869551831 Bacteria 5474685
364 2871274466 2871272651 Bacteria 5042015
365 2871286131 2871282230 Bacteria 4917173
366 2876605747 2876601092 Bacteria 5114497
367 2881613739 2881609920 Bacteria 4405319
368 2884090234 2884086401 Bacteria 5005459
369 2888367961 2888366609 Bacteria 5155009
370 2888374396 2888373701 Bacteria 5098052
371 2891636905 2891633521 Bacteria 4602265
372 2891672489 2891670763 Bacteria 4967099
373 2900051769 2900051742 Bacteria 4985156
374 2904477500 2904474040 Bacteria 5504324
375 2904508169 2904504865 Bacteria 5152820
376 2908673100 2908669403 Bacteria 5740494
377 2916701608 2916699645 Bacteria 3568996
378 2919153791 2919150387 Bacteria 5500879
379 2919183689 2919182534 Bacteria 3907101
380 2919507108 2919506607 Bacteria 3392955
381 2923521484 2923519811 Bacteria 6298479
382 2927147193 2927143783 Bacteria 5504251
383 2928518849 2928515477 Bacteria 4448421
384 2937969701 2937967321 Bacteria 5094075
385 2939606623 2939602548 Bacteria 4950493
386 2945954335 2945951305 Bacteria 4918162
387 2945964011 2945961074 Bacteria 7342064
388 2978976820 2978975091 Bacteria 4704313
389 2984498132 2984494565 Bacteria 5000175
390 2990198112 2990196909 Bacteria 4054280
391 2990265170 2990261002 Bacteria 4919493
392 3000379382 3000376612 Bacteria 4705565
393 3007254503 3007252601 Bacteria 4559114
394 3007316703 3007315729 Bacteria 5076637
395 640936950 640753048 Bacteria 5495657
396 8004594832 8004592986 Bacteria 5122074
397 8015394969 8015394850 Bacteria 5064660
398 8016737276 8016733728 Bacteria 5274317
399 8019502477 8019499862 Bacteria 5169538
400 8033233145 8033232454 Bacteria 3202805
401 8054850932 8054849141 Bacteria 5232694
402 8055091308 8055087960 Bacteria 4784273
403 8055094943 8055092621 Bacteria 4873875
404 Ga0105250_10001708
405 SwRhRL2b_contig_285204
406 JGI25162J39368_1000007
407 JGI25162J39368_1004459
408 JGI25163J39215_1000410
409 JGI25164J39214_1000010
410 JGI25164J39214_1000016
411 Ga0055538_1000006
412 Ga0055539_1000010
413 Ga0055533_1000013
414 Ga0055525_1000015
415 Ga0055541_1000007
416 Ga0058692_1000010
417 Ga0058692_1000154
418 Ga0058692_1000299
419 Ga0058692_1000420
420 Ga0058692_1001366
421 Ga0065703_1019316
422 Ga0065704_10000667
423 Ga0065704_10088329
424 Ga0065704_10092254
425 Ga0070661_100000053
426 Ga0070671_100076342
427 Ga0070662_100020138
428 Ga0068853_100000005
429 Ga0070665_100013569
430 Ga0070664_100000030
431 Ga0068858_100005788
432 Ga0075364_10003334
433 Ga0075364_10052142
434 Ga0079104_1000083
435 Ga0079104_1000448
436 Ga0079104_1001008
437 Ga0105251_10000016
438 Ga0105251_10000058
439 Ga0105251_10000715
440 Ga0105251_10002907
441 Ga0105251_10003295
442 Ga0105251_10012111
443 Ga0105251_10021101
444 Ga0105244_10000026
445 Ga0105244_10000137
446 Ga0105244_10000704
447 Ga0105244_10002484
448 Ga0105244_10002875
449 Ga0105244_10003517
450 Ga0105244_10011561
451 Ga0105244_10011596
452 Ga0105244_10012030
453 Ga0105244_10017125
454 Ga0105244_10017759
455 Ga0105250_10000020
456 Ga0105250_10000889
457 Ga0105250_10002067
458 Ga0105250_10003063
459 Ga0105250_10006576
460 Ga0105250_10008603
461 Ga0105250_10010174
462 Ga0105250_10012746
463 Ga0105247_10000443
464 Ga0105247_10000630
465 Ga0105243_10000053
466 Ga0105241_10000004
467 Ga0105242_10003203
468 Ga0105237_10001925
469 Ga0105249_10001356
470 Ga0105246_10035196
471 Ga0157373_10000818
472 Ga0157373_10034954
473 Ga0157371_10000044
474 Ga0157371_10000267
475 Ga0157371_10000589
476 Ga0157371_10000766
477 Ga0157371_10031922
478 Ga0157370_10000276
479 Ga0157370_10199108
480 Ga0157369_10002704
481 Ga0157369_10010851
482 Ga0163162_10039659
483 Ga0157372_10050173
484 Ga0157372_10064670
485 Ga0157375_10099539
486 Ga0182008_10001594
487 Ga0182008_10009560
488 Ga0182006_1000013
489 Ga0182006_1012228
490 Ga0182007_10006297
491 Ga0163161_10000001
492 Ga0163161_10002687
493 Ga0163161_10004040
494 Ga0209760_100034
495 Ga0209784_100022
496 Ga0209566_100021
497 Ga0209674_100038
498 Ga0209563_100042
499 Ga0207427_100027
500 Ga0209437_100049
501 Ga0209437_100063
502 Ga0209677_100025
503 Ga0209233_1005285
504 Ga0207696_1000001
505 Ga0207696_1000036
506 Ga0207696_1000453
507 Ga0207696_1000952
508 Ga0207696_1001410
509 Ga0207696_1002790
510 Ga0207696_1007742
511 Ga0207696_1010303
512 Ga0207655_1000011
513 Ga0207655_1000057
514 Ga0207655_1000112
515 Ga0207655_1000181
516 Ga0207655_1000218
517 Ga0207655_1000788
518 Ga0207655_1000875
519 Ga0207655_1009713
520 Ga0207655_1010898
521 Ga0207655_1012969
522 Ga0207655_1023434
523 Ga0207713_1000007
524 Ga0207713_1000024
525 Ga0207713_1000026
526 Ga0207713_1000060
527 Ga0207713_1002303
528 Ga0207713_1003113
529 Ga0207713_1003357
530 Ga0207713_1036054
531 Ga0207710_10000009
532 Ga0207710_10000049
533 Ga0207654_10000006
534 Ga0207671_10004590
535 Ga0207649_10000070
536 Ga0207709_10000001
537 Ga0207679_10000021
538 Ga0207712_10027695
539 Ga0207703_10004138
540 Ga0207639_10000010
541 Ga0209281_1000008
542 Ga0209281_1000050
543 Ga0209281_1000130
544 Ga0209371_1000002
545 Ga0209371_1000006
546 Ga0209371_1000017
547 Ga0209371_1000053
548 Ga0209371_1000057
549 Ga0209371_1000412
550 Ga0209371_1000945
551 Ga0209371_1001132
552 Ga0209371_1001738
553 Ga0209371_1005884
554 Ga0209371_1006614
555 Ga0209371_1007332
556 Ga0268256_1000002
557 Ga0268256_1000007
558 Ga0268256_1000053
559 Ga0268256_1000091
560 Ga0268256_1000798
561 Ga0268256_1004093
562 Ga0268256_1005873
563 Ga0268256_1007523
564 Ga0439436_0000073
565 Ga0439438_000003
566 Ga0439438_001119
567 Ga0439438_001814
568 Ga0439447_000341
569 Ga0439447_000361
570 Ga0439447_000968
571 Ga0439447_004775
572 Ga0439466_0000002
573 Ga0439466_0006008
574 Ga0439432_002404
575 Ga0439432_008611
576 Ga0439432_022407
577 Ga0439452_000004
578 Ga0439452_000013
579 Ga0439452_001346
580 Ga0439452_001445
581 Ga0439463_000452
582 Ga0450904_000514
583 Ga0450907_000495
584 Ga0439434_0010265
585 Ga0439464_0003621
586 Ga0450893_0000327
587 Ga0495627_000028
588 Ga0495591_000124
589 Ga0495650_0000039
590 Ga0495650_0000113
591 Ga0495607_0000106
592 Ga0495607_0010125
593 Ga0495607_0012378
594 Ga0495607_0033711
595 Ga0495583_0000131
596 Ga0495583_0001159
597 Ga0495606_0000032
598 Ga0495606_0000794
599 Ga0495606_0001088
600 Ga0495610_0016711
601 Ga0495620_0002491
602 Ga0495631_0004526
603 Ga0495637_0001643
604 Ga0495643_0060568
605 Ga0495648_0022021
606 Ga0495648_0026403
607 Ga0495648_0030666
608 Ga0495654_0000031
609 Ga0495654_0000119
610 Ga0495654_0000578
611 Ga0495654_0010988
612 Ga0495654_0011570
613 Ga0495654_0027023
614 Ga0495597_0001564
615 Ga0495668_0003975
616 Ga0495625_0003804
617 Ga0495661_0001936
618 Ga0495649_0005514
619 Ga0495589_0000002
620 Ga0495589_0000763
621 Ga0495589_0009120
622 Ga0495660_0000023
623 Ga0495660_0000034
624 Ga0495672_0000029
625 Ga0495672_0000054
626 Ga0495672_0000084
627 Ga0495676_0000002
628 Ga0495679_000024
629 Ga0495679_000255
630 Ga0495679_001008
631 Ga0495673_0000292
632 Ga0495673_0001194
633 Ga0495686_0025888
634 Ga0496100_0029695
635 Ga0496101_0003408
636 Ga0496102_0003134
637 Ga0496104_0000208
638 Ga0496105_0004102
639 Ga0496116_0000023
640 Ga0496116_0000112
641 Ga0496116_0000715
642 Ga0496116_0001156
643 Ga0496116_0074850
644 Ga0496117_0000100
645 Ga0496117_0000103
646 Ga0496117_0000238
647 Ga0496117_0002870
648 Ga0496117_0016258
649 Ga0496117_0018547
650 Ga0496118_0000046
651 Ga0496118_0000454
652 Ga0496118_0000959
653 Ga0496118_0001062
654 Ga0496118_0012003
655 Ga0496118_0018950
656 Ga0496118_0024831
657 Ga0496119_0000031
658 Ga0496119_0000374
659 Ga0496119_0002749
660 Ga0496119_0004318
661 Ga0496119_0004731
662 Ga0496119_0008560
663 Ga0496119_0011573
664 Ga0496119_0024745
665 Ga0496120_0000017
666 Ga0496120_0000084
667 Ga0496120_0000275
668 Ga0496120_0000317
669 Ga0496120_0000491
670 Ga0496120_0000806
671 Ga0496120_0001442
672 Ga0496120_0001680
673 Ga0496120_0004679
674 Ga0496121_0001130
675 Ga0496121_0088113
676 Ga0496121_0093948
677 Ga0496122_0000067
678 Ga0496122_0007703
679 Ga0496122_0011010
680 Ga0496123_0000056
681 Ga0496123_0001657
682 Ga0496123_0026197
683 Ga0496123_0030124
684 Ga0496124_0000007
685 Ga0496124_0000017
686 Ga0496124_0000338
687 Ga0496124_0000362
688 Ga0496124_0000965
689 Ga0496124_0069253
690 Ga0496125_0000183
691 Ga0496125_0000245
692 Ga0496125_0010371
693 Ga0496125_0016151
694 Ga0496126_0006344
695 Ga0496126_0018190
696 Ga0496126_0052322
697 Ga0496126_0128877
698 Ga0495678_000607
699 Ga0495682_0000003
700 Ga0501034_0016688
701 Ga0501047_0003432
702 Ga0501035_0070691
703 Ga0501044_0005080
704 Ga0501226_000032
705 Ga0500566_0009776
706 Ga0500621_000006
707 Ga0500622_0001406
708 Ga0500634_0000284
709 2506577452
710 2506582590
711 2508851390
712 2511381912
713 2511432748
714 2538427482
715 2552747245
716 2585826557
717 2585832662
718 2599880370
719 2599928135
720 2599946949
721 2599970787
722 2601539770
723 2601625053
724 2601758119
725 2601763629
726 2608670528
727 2621300056
728 2640733800
729 2650900209
730 2656278367
731 2671109221
732 2671585904
733 2678230781
734 2686354448
735 2687580462
736 2689443930
737 2712470075
738 2738670058
739 2738748451
740 2738806594
741 2738857493
742 2738893954
743 2745160986
744 2772437960
745 2774388663
746 2774438677
747 2791921328
748 2793404194
749 2808979284
750 2808994832
751 2809124264
752 2812367436
753 2813728554
754 2814696068
755 2817491396
756 2844532604
757 2847089126
758 2847801301
759 2852614268
760 2852667994
761 2855197163
762 2857544336
763 2858468674
764 2858953726
765 2865018610
766 2869553305
767 2871274466
768 2871286131
769 2876605747
770 2881613739
771 2884090234
772 2888367961
773 2888374396
774 2891636905
775 2891672489
776 2900051769
777 2904477500
778 2904508169
779 2908673100
780 2916701608
781 2919153791
782 2919183689
783 2919507108
784 2923521484
785 2927147193
786 2928518849
787 2937969701
788 2939606623
789 2945954335
790 2945964011
791 2978976820
792 2984498132
793 2990198112
794 2990265170
795 3000379382
796 3007254503
797 3007316703
798 640936950
799 8004594832
800 8015394969
801 8016737276
802 8019502477
803 8033233145
804 8054850932
805 8055091308
806 8055094943

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21986

AH_C

Allophanate hydrolase C-terminal domain

520

642

0.98

PF01425

Amidase

Amidase

71

485

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.9576 16 454
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.9478 484 607
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.9388 16 454
4gyr-assembly1.cif.gz_B granulibacter bethesdensis allophanate hydrolase apo 0.9281 16 470
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.9048 484 607
ID Description Score Start End Superfamily
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.961 16 454 3.90.1300.10
4issB03 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9528 484 609 3.10.490.10
5c5zB00 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9403 484 607 3.10.490.10
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.94 16 454 3.90.1300.10
4istB01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9283 1 473 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A074YUG5-F1-model_v4 Allophanate hydrolase C-terminal domain-containing protein 0.9882 486 608
AF-A0A4Q5WQT4-F1-model_v4 deleted 0.9859 83 451
AF-A0A377N6T3-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-) 0.98 1 193 GO:0016740
GO:0016874
AF-A0A0K0STS0-F1-model_v4 Amidase 0.9791 484 610
AF-S6TR78-F1-model_v4 Allophanate hydrolase 0.9777 299 462 GO:0016787

Map