F435366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 403 | 228 | 806 | 600 |
Family's Representative Sequence
| Representative Sequence | 3300009092|Ga0105250_10001708|Ga0105250_100017082 |
| Length | 647 |
| Sequence | LRSVCAAVVQFIIRKTYYTSINYAVSSAYKNGTHFALLNSILYTSWNSLMASTFGFTLQDWQRSYQQNPQQITALLAAHLDAIDAQDNAWLYLATPAQLQAQIEPLLASYQRNPAALPLFGVPFAVKDNIDVAGWPTSAACPAFTYTAEADAFVVAQLKAAGAVVIGKTNLDQYATGLVGTRSPFGAVSNTFNPDYVSGGSSSGSASVLARGLVGFSLGTDTAGSGRVPAGFNNIVGLKPTKGWFSASGVVPACRLNDTISVFALTVEDAFAVATAAGGYDAGDAYSRSNPHTAPASFKAQPDFAIPATPEFFGDKQAEAAWLAALEQLQAGGATLHPIDFSLFHQLAEQLYYGPWVAERTVAVGEMIHRPEEMDPVVYGIVSSGLKYTAVEAYQAEYLRAELTRQIQQTLAQFDALLVPTSPTIHTLDEMQQEPVHYNSQFGTYTNFTNLADLSALALPAPFRADGLPAGITLIAPAWHDRALAGFGLRWQQQMALPLGATGKAAPAQSYALPISTDHVRVAVVGAHLTGMPLNFQLTTRQAVLVEETQTASHYRLFALLDGPIKKPGLLRGESGAAITVELWDIPLARFGEFVAEIPAPLGIGSLTLADGRIVKGFICEPAVLSQALEITEFGGWRNWLASLGSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 12 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 40 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 65 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 67 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 68 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 69 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 70 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 71 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 72 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 73 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 74 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 75 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 76 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 77 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 78 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 79 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 107 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 108 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 109 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 113 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 114 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 115 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 116 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 117 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 118 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 119 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 120 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 127 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 128 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 129 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 130 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 131 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 132 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 133 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 134 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 135 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 136 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 137 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 138 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 139 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 140 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 141 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 142 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 143 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 144 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 145 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 146 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 147 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 148 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 149 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 150 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 151 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 152 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 153 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 154 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 155 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 156 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 157 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 158 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 159 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 160 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 161 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 162 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 163 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 164 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 165 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 166 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 167 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 168 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 169 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 170 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 171 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 172 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 173 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 174 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 175 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 176 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 177 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 178 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 179 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 180 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 181 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 182 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 183 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 184 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 185 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 186 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 187 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 188 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 189 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 190 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 191 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 192 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 193 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 194 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 195 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 196 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 197 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 198 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 199 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 200 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 201 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 202 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 203 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 204 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 205 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 206 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 207 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 208 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 209 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 210 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 211 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 212 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 213 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 214 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 215 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 216 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 217 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 218 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 219 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 220 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 221 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 222 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 223 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 224 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 225 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 226 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 227 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 228 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.68 |
| Metatranscriptomes | 0 |
| Isolates | 24.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0.25 |
| Endosphere | 6.7 |
| Nodule | 1.49 |
| Rhizoplane | 4.47 |
| Rhizosphere | 61.29 |
| Stem | 0 |
| Stem Tuber | 1.24 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105250_10001708 | 3300009092 | Bacteria | 11611 |
| 2 | SwRhRL2b_contig_285204 | 2162886007 | Bacteria | 3541 |
| 3 | JGI25162J39368_1000007 | 3300002737 | Bacteria | 403947 |
| 4 | JGI25162J39368_1004459 | 3300002737 | Bacteria | 3229 |
| 5 | JGI25163J39215_1000410 | 3300002771 | Bacteria | 13470 |
| 6 | JGI25164J39214_1000010 | 3300002772 | Bacteria | 288863 |
| 7 | JGI25164J39214_1000016 | 3300002772 | Bacteria | 202035 |
| 8 | Ga0055538_1000006 | 3300003751 | Bacteria | 403947 |
| 9 | Ga0055539_1000010 | 3300003752 | Bacteria | 403947 |
| 10 | Ga0055533_1000013 | 3300003756 | Bacteria | 403947 |
| 11 | Ga0055525_1000015 | 3300003759 | Bacteria | 403947 |
| 12 | Ga0055541_1000007 | 3300003841 | Bacteria | 403947 |
| 13 | Ga0058692_1000010 | 3300003856 | Bacteria | 326761 |
| 14 | Ga0058692_1000154 | 3300003856 | Bacteria | 43640 |
| 15 | Ga0058692_1000299 | 3300003856 | Bacteria | 25458 |
| 16 | Ga0058692_1000420 | 3300003856 | Bacteria | 19522 |
| 17 | Ga0058692_1001366 | 3300003856 | Bacteria | 9055 |
| 18 | Ga0065703_1019316 | 3300005272 | Bacteria | 3218 |
| 19 | Ga0065704_10000667 | 3300005289 | Bacteria | 21743 |
| 20 | Ga0065704_10088329 | 3300005289 | Bacteria | 2945 |
| 21 | Ga0065704_10092254 | 3300005289 | Bacteria | 2665 |
| 22 | Ga0070661_100000053 | 3300005344 | Bacteria | 89030 |
| 23 | Ga0070671_100076342 | 3300005355 | Bacteria | 2799 |
| 24 | Ga0070662_100020138 | 3300005457 | Bacteria | 4539 |
| 25 | Ga0068853_100000005 | 3300005539 | Bacteria | 366404 |
| 26 | Ga0070665_100013569 | 3300005548 | Bacteria | 8196 |
| 27 | Ga0070664_100000030 | 3300005564 | Bacteria | 89030 |
| 28 | Ga0068858_100005788 | 3300005842 | Bacteria | 12076 |
| 29 | Ga0075364_10003334 | 3300006051 | Bacteria | 9112 |
| 30 | Ga0075364_10052142 | 3300006051 | Bacteria | 2673 |
| 31 | Ga0079104_1000083 | 3300006946 | Bacteria | 137254 |
| 32 | Ga0079104_1000448 | 3300006946 | Bacteria | 46655 |
| 33 | Ga0079104_1001008 | 3300006946 | Bacteria | 21846 |
| 34 | Ga0105251_10000016 | 3300009011 | Bacteria | 146400 |
| 35 | Ga0105251_10000058 | 3300009011 | Bacteria | 103857 |
| 36 | Ga0105251_10000715 | 3300009011 | Bacteria | 30569 |
| 37 | Ga0105251_10002907 | 3300009011 | Bacteria | 12871 |
| 38 | Ga0105251_10003295 | 3300009011 | Bacteria | 11819 |
| 39 | Ga0105251_10012111 | 3300009011 | Bacteria | 4895 |
| 40 | Ga0105251_10021101 | 3300009011 | Bacteria | 3408 |
| 41 | Ga0105244_10000026 | 3300009036 | Bacteria | 216056 |
| 42 | Ga0105244_10000137 | 3300009036 | Bacteria | 75679 |
| 43 | Ga0105244_10000704 | 3300009036 | Bacteria | 29004 |
| 44 | Ga0105244_10002484 | 3300009036 | Bacteria | 13880 |
| 45 | Ga0105244_10002875 | 3300009036 | Bacteria | 12746 |
| 46 | Ga0105244_10003517 | 3300009036 | Bacteria | 11134 |
| 47 | Ga0105244_10011561 | 3300009036 | Bacteria | 5279 |
| 48 | Ga0105244_10011596 | 3300009036 | Bacteria | 5270 |
| 49 | Ga0105244_10012030 | 3300009036 | Bacteria | 5145 |
| 50 | Ga0105244_10017125 | 3300009036 | Bacteria | 4106 |
| 51 | Ga0105244_10017759 | 3300009036 | Bacteria | 4011 |
| 52 | Ga0105250_10000020 | 3300009092 | Bacteria | 242010 |
| 53 | Ga0105250_10000889 | 3300009092 | Bacteria | 17674 |
| 54 | Ga0105250_10002067 | 3300009092 | Bacteria | 10306 |
| 55 | Ga0105250_10003063 | 3300009092 | Bacteria | 8067 |
| 56 | Ga0105250_10006576 | 3300009092 | Bacteria | 5061 |
| 57 | Ga0105250_10008603 | 3300009092 | Bacteria | 4327 |
| 58 | Ga0105250_10010174 | 3300009092 | Bacteria | 3926 |
| 59 | Ga0105250_10012746 | 3300009092 | Bacteria | 3463 |
| 60 | Ga0105247_10000443 | 3300009101 | Bacteria | 35032 |
| 61 | Ga0105247_10000630 | 3300009101 | Bacteria | 28152 |
| 62 | Ga0105243_10000053 | 3300009148 | Bacteria | 137373 |
| 63 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 64 | Ga0105242_10003203 | 3300009176 | Bacteria | 12746 |
| 65 | Ga0105237_10001925 | 3300009545 | Bacteria | 26498 |
| 66 | Ga0105249_10001356 | 3300009553 | Bacteria | 21405 |
| 67 | Ga0105246_10035196 | 3300011119 | Bacteria | 3345 |
| 68 | Ga0157373_10000818 | 3300013100 | Bacteria | 24099 |
| 69 | Ga0157373_10034954 | 3300013100 | Bacteria | 3610 |
| 70 | Ga0157371_10000044 | 3300013102 | Bacteria | 194689 |
| 71 | Ga0157371_10000267 | 3300013102 | Bacteria | 71120 |
| 72 | Ga0157371_10000589 | 3300013102 | Bacteria | 43110 |
| 73 | Ga0157371_10000766 | 3300013102 | Bacteria | 37124 |
| 74 | Ga0157371_10031922 | 3300013102 | Bacteria | 3792 |
| 75 | Ga0157370_10000276 | 3300013104 | Bacteria | 65208 |
| 76 | Ga0157370_10199108 | 3300013104 | Bacteria | 1858 |
| 77 | Ga0157369_10002704 | 3300013105 | Bacteria | 21151 |
| 78 | Ga0157369_10010851 | 3300013105 | Bacteria | 10376 |
| 79 | Ga0163162_10039659 | 3300013306 | Bacteria | 4707 |
| 80 | Ga0157372_10050173 | 3300013307 | Bacteria | 4642 |
| 81 | Ga0157372_10064670 | 3300013307 | Bacteria | 4104 |
| 82 | Ga0157375_10099539 | 3300013308 | Bacteria | 2987 |
| 83 | Ga0182008_10001594 | 3300014497 | Bacteria | 15094 |
| 84 | Ga0182008_10009560 | 3300014497 | Bacteria | 5224 |
| 85 | Ga0182006_1000013 | 3300015261 | Bacteria | 363224 |
| 86 | Ga0182006_1012228 | 3300015261 | Bacteria | 3756 |
| 87 | Ga0182007_10006297 | 3300015262 | Bacteria | 5104 |
| 88 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 89 | Ga0163161_10002687 | 3300017792 | Bacteria | 12643 |
| 90 | Ga0163161_10004040 | 3300017792 | Bacteria | 10266 |
| 91 | Ga0209760_100034 | 3300025207 | Bacteria | 135933 |
| 92 | Ga0209784_100022 | 3300025224 | Bacteria | 403999 |
| 93 | Ga0209566_100021 | 3300025225 | Bacteria | 403999 |
| 94 | Ga0209674_100038 | 3300025226 | Bacteria | 403999 |
| 95 | Ga0209563_100042 | 3300025230 | Bacteria | 403999 |
| 96 | Ga0207427_100027 | 3300025231 | Bacteria | 403999 |
| 97 | Ga0209437_100049 | 3300025233 | Bacteria | 403999 |
| 98 | Ga0209437_100063 | 3300025233 | Bacteria | 335477 |
| 99 | Ga0209677_100025 | 3300025253 | Bacteria | 403999 |
| 100 | Ga0209233_1005285 | 3300025261 | Bacteria | 4303 |
| 101 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 102 | Ga0207696_1000036 | 3300025711 | Bacteria | 337736 |
| 103 | Ga0207696_1000453 | 3300025711 | Bacteria | 35831 |
| 104 | Ga0207696_1000952 | 3300025711 | Bacteria | 17674 |
| 105 | Ga0207696_1001410 | 3300025711 | Bacteria | 13120 |
| 106 | Ga0207696_1002790 | 3300025711 | Bacteria | 8300 |
| 107 | Ga0207696_1007742 | 3300025711 | Bacteria | 4175 |
| 108 | Ga0207696_1010303 | 3300025711 | Bacteria | 3433 |
| 109 | Ga0207655_1000011 | 3300025728 | Bacteria | 643321 |
| 110 | Ga0207655_1000057 | 3300025728 | Bacteria | 273598 |
| 111 | Ga0207655_1000112 | 3300025728 | Bacteria | 170624 |
| 112 | Ga0207655_1000181 | 3300025728 | Bacteria | 112734 |
| 113 | Ga0207655_1000218 | 3300025728 | Bacteria | 98543 |
| 114 | Ga0207655_1000788 | 3300025728 | Bacteria | 34605 |
| 115 | Ga0207655_1000875 | 3300025728 | Bacteria | 31869 |
| 116 | Ga0207655_1009713 | 3300025728 | Bacteria | 5938 |
| 117 | Ga0207655_1010898 | 3300025728 | Bacteria | 5466 |
| 118 | Ga0207655_1012969 | 3300025728 | Bacteria | 4820 |
| 119 | Ga0207655_1023434 | 3300025728 | Bacteria | 3062 |
| 120 | Ga0207713_1000007 | 3300025735 | Bacteria | 564979 |
| 121 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 122 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 123 | Ga0207713_1000060 | 3300025735 | Bacteria | 213145 |
| 124 | Ga0207713_1002303 | 3300025735 | Bacteria | 14042 |
| 125 | Ga0207713_1003113 | 3300025735 | Bacteria | 11502 |
| 126 | Ga0207713_1003357 | 3300025735 | Bacteria | 10983 |
| 127 | Ga0207713_1036054 | 3300025735 | Bacteria | 2126 |
| 128 | Ga0207710_10000009 | 3300025900 | Bacteria | 485205 |
| 129 | Ga0207710_10000049 | 3300025900 | Bacteria | 186492 |
| 130 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 131 | Ga0207671_10004590 | 3300025914 | Bacteria | 13123 |
| 132 | Ga0207649_10000070 | 3300025920 | Bacteria | 89018 |
| 133 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 134 | Ga0207679_10000021 | 3300025945 | Bacteria | 221630 |
| 135 | Ga0207712_10027695 | 3300025961 | Bacteria | 3785 |
| 136 | Ga0207703_10004138 | 3300026035 | Bacteria | 11964 |
| 137 | Ga0207639_10000010 | 3300026041 | Bacteria | 415264 |
| 138 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 139 | Ga0209281_1000050 | 3300027111 | Bacteria | 320102 |
| 140 | Ga0209281_1000130 | 3300027111 | Bacteria | 191756 |
| 141 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 142 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 143 | Ga0209371_1000017 | 3300027312 | Bacteria | 625776 |
| 144 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 145 | Ga0209371_1000057 | 3300027312 | Bacteria | 238850 |
| 146 | Ga0209371_1000412 | 3300027312 | Bacteria | 44123 |
| 147 | Ga0209371_1000945 | 3300027312 | Bacteria | 22636 |
| 148 | Ga0209371_1001132 | 3300027312 | Bacteria | 19583 |
| 149 | Ga0209371_1001738 | 3300027312 | Bacteria | 13726 |
| 150 | Ga0209371_1005884 | 3300027312 | Bacteria | 4718 |
| 151 | Ga0209371_1006614 | 3300027312 | Bacteria | 4251 |
| 152 | Ga0209371_1007332 | 3300027312 | Bacteria | 3865 |
| 153 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 154 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 155 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 156 | Ga0268256_1000091 | 3300030500 | Bacteria | 148069 |
| 157 | Ga0268256_1000798 | 3300030500 | Bacteria | 22636 |
| 158 | Ga0268256_1004093 | 3300030500 | Bacteria | 6233 |
| 159 | Ga0268256_1005873 | 3300030500 | Bacteria | 4700 |
| 160 | Ga0268256_1007523 | 3300030500 | Bacteria | 3865 |
| 161 | Ga0439436_0000073 | 3300041404 | Bacteria | 25935 |
| 162 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 163 | Ga0439438_001119 | 3300041405 | Bacteria | 11922 |
| 164 | Ga0439438_001814 | 3300041405 | Bacteria | 9369 |
| 165 | Ga0439447_000341 | 3300041407 | Bacteria | 16808 |
| 166 | Ga0439447_000361 | 3300041407 | Bacteria | 16505 |
| 167 | Ga0439447_000968 | 3300041407 | Bacteria | 10478 |
| 168 | Ga0439447_004775 | 3300041407 | Bacteria | 4611 |
| 169 | Ga0439466_0000002 | 3300041411 | Bacteria | 494198 |
| 170 | Ga0439466_0006008 | 3300041411 | Bacteria | 4621 |
| 171 | Ga0439432_002404 | 3300042006 | Bacteria | 7061 |
| 172 | Ga0439432_008611 | 3300042006 | Bacteria | 3580 |
| 173 | Ga0439432_022407 | 3300042006 | Bacteria | 2086 |
| 174 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 175 | Ga0439452_000013 | 3300042010 | Bacteria | 364058 |
| 176 | Ga0439452_001346 | 3300042010 | Bacteria | 10230 |
| 177 | Ga0439452_001445 | 3300042010 | Bacteria | 9707 |
| 178 | Ga0439463_000452 | 3300042016 | Bacteria | 11448 |
| 179 | Ga0450904_000514 | 3300042139 | Bacteria | 7449 |
| 180 | Ga0450907_000495 | 3300042146 | Bacteria | 10884 |
| 181 | Ga0439434_0010265 | 3300042435 | Bacteria | 2760 |
| 182 | Ga0439464_0003621 | 3300042439 | Bacteria | 3915 |
| 183 | Ga0450893_0000327 | 3300042532 | Bacteria | 6642 |
| 184 | Ga0495627_000028 | 3300046453 | Bacteria | 234737 |
| 185 | Ga0495591_000124 | 3300046458 | Bacteria | 84206 |
| 186 | Ga0495650_0000039 | 3300046471 | Bacteria | 375501 |
| 187 | Ga0495650_0000113 | 3300046471 | Bacteria | 196536 |
| 188 | Ga0495607_0000106 | 3300046501 | Bacteria | 88081 |
| 189 | Ga0495607_0010125 | 3300046501 | Bacteria | 6345 |
| 190 | Ga0495607_0012378 | 3300046501 | Bacteria | 5637 |
| 191 | Ga0495607_0033711 | 3300046501 | Bacteria | 3114 |
| 192 | Ga0495583_0000131 | 3300046506 | Bacteria | 125393 |
| 193 | Ga0495583_0001159 | 3300046506 | Bacteria | 28688 |
| 194 | Ga0495606_0000032 | 3300046507 | Bacteria | 248690 |
| 195 | Ga0495606_0000794 | 3300046507 | Bacteria | 48239 |
| 196 | Ga0495606_0001088 | 3300046507 | Bacteria | 38905 |
| 197 | Ga0495610_0016711 | 3300046512 | Bacteria | 4213 |
| 198 | Ga0495620_0002491 | 3300046515 | Bacteria | 10683 |
| 199 | Ga0495631_0004526 | 3300046518 | Bacteria | 7387 |
| 200 | Ga0495637_0001643 | 3300046520 | Bacteria | 12931 |
| 201 | Ga0495643_0060568 | 3300046522 | Bacteria | 2009 |
| 202 | Ga0495648_0022021 | 3300046524 | Bacteria | 4398 |
| 203 | Ga0495648_0026403 | 3300046524 | Bacteria | 3910 |
| 204 | Ga0495648_0030666 | 3300046524 | Bacteria | 3551 |
| 205 | Ga0495654_0000031 | 3300046530 | Bacteria | 206800 |
| 206 | Ga0495654_0000119 | 3300046530 | Bacteria | 88217 |
| 207 | Ga0495654_0000578 | 3300046530 | Bacteria | 29450 |
| 208 | Ga0495654_0010988 | 3300046530 | Bacteria | 4916 |
| 209 | Ga0495654_0011570 | 3300046530 | Bacteria | 4771 |
| 210 | Ga0495654_0027023 | 3300046530 | Bacteria | 2945 |
| 211 | Ga0495597_0001564 | 3300046542 | Bacteria | 16162 |
| 212 | Ga0495668_0003975 | 3300046616 | Bacteria | 10775 |
| 213 | Ga0495625_0003804 | 3300046660 | Bacteria | 14607 |
| 214 | Ga0495661_0001936 | 3300046665 | Bacteria | 16465 |
| 215 | Ga0495649_0005514 | 3300046694 | Bacteria | 8023 |
| 216 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 217 | Ga0495589_0000763 | 3300046794 | Bacteria | 20550 |
| 218 | Ga0495589_0009120 | 3300046794 | Bacteria | 5158 |
| 219 | Ga0495660_0000023 | 3300046810 | Bacteria | 272605 |
| 220 | Ga0495660_0000034 | 3300046810 | Bacteria | 201261 |
| 221 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 222 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 223 | Ga0495672_0000084 | 3300047320 | Bacteria | 156238 |
| 224 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 225 | Ga0495679_000024 | 3300047446 | Bacteria | 205864 |
| 226 | Ga0495679_000255 | 3300047446 | Bacteria | 44133 |
| 227 | Ga0495679_001008 | 3300047446 | Bacteria | 17324 |
| 228 | Ga0495673_0000292 | 3300047469 | Bacteria | 67107 |
| 229 | Ga0495673_0001194 | 3300047469 | Bacteria | 21723 |
| 230 | Ga0495686_0025888 | 3300047472 | Bacteria | 3842 |
| 231 | Ga0496100_0029695 | 3300048903 | Bacteria | 3384 |
| 232 | Ga0496101_0003408 | 3300048904 | Bacteria | 9915 |
| 233 | Ga0496102_0003134 | 3300048905 | Bacteria | 14021 |
| 234 | Ga0496104_0000208 | 3300048907 | Bacteria | 52252 |
| 235 | Ga0496105_0004102 | 3300048908 | Bacteria | 10920 |
| 236 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 237 | Ga0496116_0000112 | 3300048919 | Bacteria | 181946 |
| 238 | Ga0496116_0000715 | 3300048919 | Bacteria | 42503 |
| 239 | Ga0496116_0001156 | 3300048919 | Bacteria | 31157 |
| 240 | Ga0496116_0074850 | 3300048919 | Bacteria | 2128 |
| 241 | Ga0496117_0000100 | 3300048920 | Bacteria | 194307 |
| 242 | Ga0496117_0000103 | 3300048920 | Bacteria | 189316 |
| 243 | Ga0496117_0000238 | 3300048920 | Bacteria | 104303 |
| 244 | Ga0496117_0002870 | 3300048920 | Bacteria | 20944 |
| 245 | Ga0496117_0016258 | 3300048920 | Bacteria | 6287 |
| 246 | Ga0496117_0018547 | 3300048920 | Bacteria | 5757 |
| 247 | Ga0496118_0000046 | 3300048921 | Bacteria | 271783 |
| 248 | Ga0496118_0000454 | 3300048921 | Bacteria | 67788 |
| 249 | Ga0496118_0000959 | 3300048921 | Bacteria | 45037 |
| 250 | Ga0496118_0001062 | 3300048921 | Bacteria | 42938 |
| 251 | Ga0496118_0012003 | 3300048921 | Bacteria | 8371 |
| 252 | Ga0496118_0018950 | 3300048921 | Bacteria | 6171 |
| 253 | Ga0496118_0024831 | 3300048921 | Bacteria | 5161 |
| 254 | Ga0496119_0000031 | 3300048922 | Bacteria | 239685 |
| 255 | Ga0496119_0000374 | 3300048922 | Bacteria | 61884 |
| 256 | Ga0496119_0002749 | 3300048922 | Bacteria | 18923 |
| 257 | Ga0496119_0004318 | 3300048922 | Bacteria | 14197 |
| 258 | Ga0496119_0004731 | 3300048922 | Bacteria | 13378 |
| 259 | Ga0496119_0008560 | 3300048922 | Bacteria | 8972 |
| 260 | Ga0496119_0011573 | 3300048922 | Bacteria | 7282 |
| 261 | Ga0496119_0024745 | 3300048922 | Bacteria | 4214 |
| 262 | Ga0496120_0000017 | 3300048923 | Bacteria | 269222 |
| 263 | Ga0496120_0000084 | 3300048923 | Bacteria | 156678 |
| 264 | Ga0496120_0000275 | 3300048923 | Bacteria | 86166 |
| 265 | Ga0496120_0000317 | 3300048923 | Bacteria | 79762 |
| 266 | Ga0496120_0000491 | 3300048923 | Bacteria | 61896 |
| 267 | Ga0496120_0000806 | 3300048923 | Bacteria | 45060 |
| 268 | Ga0496120_0001442 | 3300048923 | Bacteria | 28529 |
| 269 | Ga0496120_0001680 | 3300048923 | Bacteria | 25410 |
| 270 | Ga0496120_0004679 | 3300048923 | Bacteria | 11297 |
| 271 | Ga0496121_0001130 | 3300048924 | Bacteria | 46848 |
| 272 | Ga0496121_0088113 | 3300048924 | Bacteria | 2434 |
| 273 | Ga0496121_0093948 | 3300048924 | Bacteria | 2334 |
| 274 | Ga0496122_0000067 | 3300048925 | Bacteria | 231365 |
| 275 | Ga0496122_0007703 | 3300048925 | Bacteria | 11865 |
| 276 | Ga0496122_0011010 | 3300048925 | Bacteria | 9241 |
| 277 | Ga0496123_0000056 | 3300048926 | Bacteria | 231365 |
| 278 | Ga0496123_0001657 | 3300048926 | Bacteria | 29899 |
| 279 | Ga0496123_0026197 | 3300048926 | Bacteria | 4376 |
| 280 | Ga0496123_0030124 | 3300048926 | Bacteria | 3978 |
| 281 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 282 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 283 | Ga0496124_0000338 | 3300048927 | Bacteria | 85856 |
| 284 | Ga0496124_0000362 | 3300048927 | Bacteria | 82902 |
| 285 | Ga0496124_0000965 | 3300048927 | Bacteria | 45797 |
| 286 | Ga0496124_0069253 | 3300048927 | Bacteria | 2929 |
| 287 | Ga0496125_0000183 | 3300048928 | Bacteria | 137652 |
| 288 | Ga0496125_0000245 | 3300048928 | Bacteria | 111310 |
| 289 | Ga0496125_0010371 | 3300048928 | Bacteria | 9425 |
| 290 | Ga0496125_0016151 | 3300048928 | Bacteria | 7180 |
| 291 | Ga0496126_0006344 | 3300048929 | Bacteria | 13188 |
| 292 | Ga0496126_0018190 | 3300048929 | Bacteria | 6972 |
| 293 | Ga0496126_0052322 | 3300048929 | Bacteria | 3712 |
| 294 | Ga0496126_0128877 | 3300048929 | Bacteria | 2188 |
| 295 | Ga0495678_000607 | 3300049459 | Bacteria | 33697 |
| 296 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 297 | Ga0501034_0016688 | 3300049571 | Bacteria | 7529 |
| 298 | Ga0501047_0003432 | 3300049581 | Bacteria | 14984 |
| 299 | Ga0501035_0070691 | 3300049822 | Bacteria | 3091 |
| 300 | Ga0501044_0005080 | 3300049823 | Bacteria | 14681 |
| 301 | Ga0501226_000032 | 3300049853 | Bacteria | 73400 |
| 302 | Ga0500566_0009776 | 3300053094 | Bacteria | 5663 |
| 303 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
| 304 | Ga0500622_0001406 | 3300053156 | Bacteria | 19394 |
| 305 | Ga0500634_0000284 | 3300053161 | Bacteria | 16228 |
| 306 | 2506577452 | 2506520007 | Bacteria | 5442880 |
| 307 | 2506582590 | 2506520008 | Bacteria | 5443009 |
| 308 | 2508851390 | 2508501071 | Bacteria | 5454741 |
| 309 | 2511381912 | 2511231025 | Bacteria | 5324661 |
| 310 | 2511432748 | 2511231035 | Bacteria | 5341610 |
| 311 | 2538427482 | 2537561728 | Bacteria | 5149301 |
| 312 | 2552747245 | 2551306352 | Bacteria | 3873115 |
| 313 | 2585826557 | 2585427591 | Bacteria | 5482980 |
| 314 | 2585832662 | 2585427592 | Bacteria | 5370892 |
| 315 | 2599880370 | 2599185288 | Bacteria | 6666191 |
| 316 | 2599928135 | 2599185299 | Bacteria | 4854625 |
| 317 | 2599946949 | 2599185303 | Bacteria | 6512725 |
| 318 | 2599970787 | 2599185307 | Bacteria | 6194719 |
| 319 | 2601539770 | 2600255257 | Bacteria | 5597196 |
| 320 | 2601625053 | 2600255283 | Bacteria | 6061572 |
| 321 | 2601758119 | 2600255310 | Bacteria | 5600903 |
| 322 | 2601763629 | 2600255311 | Bacteria | 5598766 |
| 323 | 2608670528 | 2608642108 | Bacteria | 4104624 |
| 324 | 2621300056 | 2619619299 | Bacteria | 6649820 |
| 325 | 2640733800 | 2639762793 | Bacteria | 3943681 |
| 326 | 2650900209 | 2648501693 | Bacteria | 5069560 |
| 327 | 2656278367 | 2654587920 | Bacteria | 5475511 |
| 328 | 2671109221 | 2667528173 | Bacteria | 5375747 |
| 329 | 2671585904 | 2671180115 | Bacteria | 5353919 |
| 330 | 2678230781 | 2675903507 | Bacteria | 3737791 |
| 331 | 2686354448 | 2684622997 | Bacteria | 4624240 |
| 332 | 2687580462 | 2687453129 | Bacteria | 4387428 |
| 333 | 2689443930 | 2687453601 | Bacteria | 5546041 |
| 334 | 2712470075 | 2711768156 | Bacteria | 4471618 |
| 335 | 2738670058 | 2738541265 | Bacteria | 6594665 |
| 336 | 2738748451 | 2738541282 | Bacteria | 6593925 |
| 337 | 2738806594 | 2738541294 | Bacteria | 6925949 |
| 338 | 2738857493 | 2738541303 | Bacteria | 6591772 |
| 339 | 2738893954 | 2738541309 | Bacteria | 6926455 |
| 340 | 2745160986 | 2744054655 | Bacteria | 3552603 |
| 341 | 2772437960 | 2772190666 | Bacteria | 5117644 |
| 342 | 2774388663 | 2773857761 | Bacteria | 3837365 |
| 343 | 2774438677 | 2773857770 | Bacteria | 3911866 |
| 344 | 2791921328 | 2791354903 | Bacteria | 4937680 |
| 345 | 2793404194 | 2791355275 | Bacteria | 4429597 |
| 346 | 2808979284 | 2808606385 | Bacteria | 6711065 |
| 347 | 2808994832 | 2808606388 | Bacteria | 6706662 |
| 348 | 2809124264 | 2808606414 | Bacteria | 4917181 |
| 349 | 2812367436 | 2811994881 | Bacteria | 6298475 |
| 350 | 2813728554 | 2811995292 | Bacteria | 5303342 |
| 351 | 2814696068 | 2814123068 | Bacteria | 5687681 |
| 352 | 2817491396 | 2816332298 | Bacteria | 6852809 |
| 353 | 2844532604 | 2844528606 | Bacteria | 4733806 |
| 354 | 2847089126 | 2847085930 | Bacteria | 5070450 |
| 355 | 2847801301 | 2847797336 | Bacteria | 5176640 |
| 356 | 2852614268 | 2852612431 | Bacteria | 6885235 |
| 357 | 2852667994 | 2852667396 | Bacteria | 6885555 |
| 358 | 2855197163 | 2855195626 | Bacteria | 4927512 |
| 359 | 2857544336 | 2857542790 | Bacteria | 5326616 |
| 360 | 2858468674 | 2858466076 | Bacteria | 4722413 |
| 361 | 2858953726 | 2858950400 | Bacteria | 6783797 |
| 362 | 2865018610 | 2865014394 | Bacteria | 4764573 |
| 363 | 2869553305 | 2869551831 | Bacteria | 5474685 |
| 364 | 2871274466 | 2871272651 | Bacteria | 5042015 |
| 365 | 2871286131 | 2871282230 | Bacteria | 4917173 |
| 366 | 2876605747 | 2876601092 | Bacteria | 5114497 |
| 367 | 2881613739 | 2881609920 | Bacteria | 4405319 |
| 368 | 2884090234 | 2884086401 | Bacteria | 5005459 |
| 369 | 2888367961 | 2888366609 | Bacteria | 5155009 |
| 370 | 2888374396 | 2888373701 | Bacteria | 5098052 |
| 371 | 2891636905 | 2891633521 | Bacteria | 4602265 |
| 372 | 2891672489 | 2891670763 | Bacteria | 4967099 |
| 373 | 2900051769 | 2900051742 | Bacteria | 4985156 |
| 374 | 2904477500 | 2904474040 | Bacteria | 5504324 |
| 375 | 2904508169 | 2904504865 | Bacteria | 5152820 |
| 376 | 2908673100 | 2908669403 | Bacteria | 5740494 |
| 377 | 2916701608 | 2916699645 | Bacteria | 3568996 |
| 378 | 2919153791 | 2919150387 | Bacteria | 5500879 |
| 379 | 2919183689 | 2919182534 | Bacteria | 3907101 |
| 380 | 2919507108 | 2919506607 | Bacteria | 3392955 |
| 381 | 2923521484 | 2923519811 | Bacteria | 6298479 |
| 382 | 2927147193 | 2927143783 | Bacteria | 5504251 |
| 383 | 2928518849 | 2928515477 | Bacteria | 4448421 |
| 384 | 2937969701 | 2937967321 | Bacteria | 5094075 |
| 385 | 2939606623 | 2939602548 | Bacteria | 4950493 |
| 386 | 2945954335 | 2945951305 | Bacteria | 4918162 |
| 387 | 2945964011 | 2945961074 | Bacteria | 7342064 |
| 388 | 2978976820 | 2978975091 | Bacteria | 4704313 |
| 389 | 2984498132 | 2984494565 | Bacteria | 5000175 |
| 390 | 2990198112 | 2990196909 | Bacteria | 4054280 |
| 391 | 2990265170 | 2990261002 | Bacteria | 4919493 |
| 392 | 3000379382 | 3000376612 | Bacteria | 4705565 |
| 393 | 3007254503 | 3007252601 | Bacteria | 4559114 |
| 394 | 3007316703 | 3007315729 | Bacteria | 5076637 |
| 395 | 640936950 | 640753048 | Bacteria | 5495657 |
| 396 | 8004594832 | 8004592986 | Bacteria | 5122074 |
| 397 | 8015394969 | 8015394850 | Bacteria | 5064660 |
| 398 | 8016737276 | 8016733728 | Bacteria | 5274317 |
| 399 | 8019502477 | 8019499862 | Bacteria | 5169538 |
| 400 | 8033233145 | 8033232454 | Bacteria | 3202805 |
| 401 | 8054850932 | 8054849141 | Bacteria | 5232694 |
| 402 | 8055091308 | 8055087960 | Bacteria | 4784273 |
| 403 | 8055094943 | 8055092621 | Bacteria | 4873875 |
| 404 | Ga0105250_10001708 | |||
| 405 | SwRhRL2b_contig_285204 | |||
| 406 | JGI25162J39368_1000007 | |||
| 407 | JGI25162J39368_1004459 | |||
| 408 | JGI25163J39215_1000410 | |||
| 409 | JGI25164J39214_1000010 | |||
| 410 | JGI25164J39214_1000016 | |||
| 411 | Ga0055538_1000006 | |||
| 412 | Ga0055539_1000010 | |||
| 413 | Ga0055533_1000013 | |||
| 414 | Ga0055525_1000015 | |||
| 415 | Ga0055541_1000007 | |||
| 416 | Ga0058692_1000010 | |||
| 417 | Ga0058692_1000154 | |||
| 418 | Ga0058692_1000299 | |||
| 419 | Ga0058692_1000420 | |||
| 420 | Ga0058692_1001366 | |||
| 421 | Ga0065703_1019316 | |||
| 422 | Ga0065704_10000667 | |||
| 423 | Ga0065704_10088329 | |||
| 424 | Ga0065704_10092254 | |||
| 425 | Ga0070661_100000053 | |||
| 426 | Ga0070671_100076342 | |||
| 427 | Ga0070662_100020138 | |||
| 428 | Ga0068853_100000005 | |||
| 429 | Ga0070665_100013569 | |||
| 430 | Ga0070664_100000030 | |||
| 431 | Ga0068858_100005788 | |||
| 432 | Ga0075364_10003334 | |||
| 433 | Ga0075364_10052142 | |||
| 434 | Ga0079104_1000083 | |||
| 435 | Ga0079104_1000448 | |||
| 436 | Ga0079104_1001008 | |||
| 437 | Ga0105251_10000016 | |||
| 438 | Ga0105251_10000058 | |||
| 439 | Ga0105251_10000715 | |||
| 440 | Ga0105251_10002907 | |||
| 441 | Ga0105251_10003295 | |||
| 442 | Ga0105251_10012111 | |||
| 443 | Ga0105251_10021101 | |||
| 444 | Ga0105244_10000026 | |||
| 445 | Ga0105244_10000137 | |||
| 446 | Ga0105244_10000704 | |||
| 447 | Ga0105244_10002484 | |||
| 448 | Ga0105244_10002875 | |||
| 449 | Ga0105244_10003517 | |||
| 450 | Ga0105244_10011561 | |||
| 451 | Ga0105244_10011596 | |||
| 452 | Ga0105244_10012030 | |||
| 453 | Ga0105244_10017125 | |||
| 454 | Ga0105244_10017759 | |||
| 455 | Ga0105250_10000020 | |||
| 456 | Ga0105250_10000889 | |||
| 457 | Ga0105250_10002067 | |||
| 458 | Ga0105250_10003063 | |||
| 459 | Ga0105250_10006576 | |||
| 460 | Ga0105250_10008603 | |||
| 461 | Ga0105250_10010174 | |||
| 462 | Ga0105250_10012746 | |||
| 463 | Ga0105247_10000443 | |||
| 464 | Ga0105247_10000630 | |||
| 465 | Ga0105243_10000053 | |||
| 466 | Ga0105241_10000004 | |||
| 467 | Ga0105242_10003203 | |||
| 468 | Ga0105237_10001925 | |||
| 469 | Ga0105249_10001356 | |||
| 470 | Ga0105246_10035196 | |||
| 471 | Ga0157373_10000818 | |||
| 472 | Ga0157373_10034954 | |||
| 473 | Ga0157371_10000044 | |||
| 474 | Ga0157371_10000267 | |||
| 475 | Ga0157371_10000589 | |||
| 476 | Ga0157371_10000766 | |||
| 477 | Ga0157371_10031922 | |||
| 478 | Ga0157370_10000276 | |||
| 479 | Ga0157370_10199108 | |||
| 480 | Ga0157369_10002704 | |||
| 481 | Ga0157369_10010851 | |||
| 482 | Ga0163162_10039659 | |||
| 483 | Ga0157372_10050173 | |||
| 484 | Ga0157372_10064670 | |||
| 485 | Ga0157375_10099539 | |||
| 486 | Ga0182008_10001594 | |||
| 487 | Ga0182008_10009560 | |||
| 488 | Ga0182006_1000013 | |||
| 489 | Ga0182006_1012228 | |||
| 490 | Ga0182007_10006297 | |||
| 491 | Ga0163161_10000001 | |||
| 492 | Ga0163161_10002687 | |||
| 493 | Ga0163161_10004040 | |||
| 494 | Ga0209760_100034 | |||
| 495 | Ga0209784_100022 | |||
| 496 | Ga0209566_100021 | |||
| 497 | Ga0209674_100038 | |||
| 498 | Ga0209563_100042 | |||
| 499 | Ga0207427_100027 | |||
| 500 | Ga0209437_100049 | |||
| 501 | Ga0209437_100063 | |||
| 502 | Ga0209677_100025 | |||
| 503 | Ga0209233_1005285 | |||
| 504 | Ga0207696_1000001 | |||
| 505 | Ga0207696_1000036 | |||
| 506 | Ga0207696_1000453 | |||
| 507 | Ga0207696_1000952 | |||
| 508 | Ga0207696_1001410 | |||
| 509 | Ga0207696_1002790 | |||
| 510 | Ga0207696_1007742 | |||
| 511 | Ga0207696_1010303 | |||
| 512 | Ga0207655_1000011 | |||
| 513 | Ga0207655_1000057 | |||
| 514 | Ga0207655_1000112 | |||
| 515 | Ga0207655_1000181 | |||
| 516 | Ga0207655_1000218 | |||
| 517 | Ga0207655_1000788 | |||
| 518 | Ga0207655_1000875 | |||
| 519 | Ga0207655_1009713 | |||
| 520 | Ga0207655_1010898 | |||
| 521 | Ga0207655_1012969 | |||
| 522 | Ga0207655_1023434 | |||
| 523 | Ga0207713_1000007 | |||
| 524 | Ga0207713_1000024 | |||
| 525 | Ga0207713_1000026 | |||
| 526 | Ga0207713_1000060 | |||
| 527 | Ga0207713_1002303 | |||
| 528 | Ga0207713_1003113 | |||
| 529 | Ga0207713_1003357 | |||
| 530 | Ga0207713_1036054 | |||
| 531 | Ga0207710_10000009 | |||
| 532 | Ga0207710_10000049 | |||
| 533 | Ga0207654_10000006 | |||
| 534 | Ga0207671_10004590 | |||
| 535 | Ga0207649_10000070 | |||
| 536 | Ga0207709_10000001 | |||
| 537 | Ga0207679_10000021 | |||
| 538 | Ga0207712_10027695 | |||
| 539 | Ga0207703_10004138 | |||
| 540 | Ga0207639_10000010 | |||
| 541 | Ga0209281_1000008 | |||
| 542 | Ga0209281_1000050 | |||
| 543 | Ga0209281_1000130 | |||
| 544 | Ga0209371_1000002 | |||
| 545 | Ga0209371_1000006 | |||
| 546 | Ga0209371_1000017 | |||
| 547 | Ga0209371_1000053 | |||
| 548 | Ga0209371_1000057 | |||
| 549 | Ga0209371_1000412 | |||
| 550 | Ga0209371_1000945 | |||
| 551 | Ga0209371_1001132 | |||
| 552 | Ga0209371_1001738 | |||
| 553 | Ga0209371_1005884 | |||
| 554 | Ga0209371_1006614 | |||
| 555 | Ga0209371_1007332 | |||
| 556 | Ga0268256_1000002 | |||
| 557 | Ga0268256_1000007 | |||
| 558 | Ga0268256_1000053 | |||
| 559 | Ga0268256_1000091 | |||
| 560 | Ga0268256_1000798 | |||
| 561 | Ga0268256_1004093 | |||
| 562 | Ga0268256_1005873 | |||
| 563 | Ga0268256_1007523 | |||
| 564 | Ga0439436_0000073 | |||
| 565 | Ga0439438_000003 | |||
| 566 | Ga0439438_001119 | |||
| 567 | Ga0439438_001814 | |||
| 568 | Ga0439447_000341 | |||
| 569 | Ga0439447_000361 | |||
| 570 | Ga0439447_000968 | |||
| 571 | Ga0439447_004775 | |||
| 572 | Ga0439466_0000002 | |||
| 573 | Ga0439466_0006008 | |||
| 574 | Ga0439432_002404 | |||
| 575 | Ga0439432_008611 | |||
| 576 | Ga0439432_022407 | |||
| 577 | Ga0439452_000004 | |||
| 578 | Ga0439452_000013 | |||
| 579 | Ga0439452_001346 | |||
| 580 | Ga0439452_001445 | |||
| 581 | Ga0439463_000452 | |||
| 582 | Ga0450904_000514 | |||
| 583 | Ga0450907_000495 | |||
| 584 | Ga0439434_0010265 | |||
| 585 | Ga0439464_0003621 | |||
| 586 | Ga0450893_0000327 | |||
| 587 | Ga0495627_000028 | |||
| 588 | Ga0495591_000124 | |||
| 589 | Ga0495650_0000039 | |||
| 590 | Ga0495650_0000113 | |||
| 591 | Ga0495607_0000106 | |||
| 592 | Ga0495607_0010125 | |||
| 593 | Ga0495607_0012378 | |||
| 594 | Ga0495607_0033711 | |||
| 595 | Ga0495583_0000131 | |||
| 596 | Ga0495583_0001159 | |||
| 597 | Ga0495606_0000032 | |||
| 598 | Ga0495606_0000794 | |||
| 599 | Ga0495606_0001088 | |||
| 600 | Ga0495610_0016711 | |||
| 601 | Ga0495620_0002491 | |||
| 602 | Ga0495631_0004526 | |||
| 603 | Ga0495637_0001643 | |||
| 604 | Ga0495643_0060568 | |||
| 605 | Ga0495648_0022021 | |||
| 606 | Ga0495648_0026403 | |||
| 607 | Ga0495648_0030666 | |||
| 608 | Ga0495654_0000031 | |||
| 609 | Ga0495654_0000119 | |||
| 610 | Ga0495654_0000578 | |||
| 611 | Ga0495654_0010988 | |||
| 612 | Ga0495654_0011570 | |||
| 613 | Ga0495654_0027023 | |||
| 614 | Ga0495597_0001564 | |||
| 615 | Ga0495668_0003975 | |||
| 616 | Ga0495625_0003804 | |||
| 617 | Ga0495661_0001936 | |||
| 618 | Ga0495649_0005514 | |||
| 619 | Ga0495589_0000002 | |||
| 620 | Ga0495589_0000763 | |||
| 621 | Ga0495589_0009120 | |||
| 622 | Ga0495660_0000023 | |||
| 623 | Ga0495660_0000034 | |||
| 624 | Ga0495672_0000029 | |||
| 625 | Ga0495672_0000054 | |||
| 626 | Ga0495672_0000084 | |||
| 627 | Ga0495676_0000002 | |||
| 628 | Ga0495679_000024 | |||
| 629 | Ga0495679_000255 | |||
| 630 | Ga0495679_001008 | |||
| 631 | Ga0495673_0000292 | |||
| 632 | Ga0495673_0001194 | |||
| 633 | Ga0495686_0025888 | |||
| 634 | Ga0496100_0029695 | |||
| 635 | Ga0496101_0003408 | |||
| 636 | Ga0496102_0003134 | |||
| 637 | Ga0496104_0000208 | |||
| 638 | Ga0496105_0004102 | |||
| 639 | Ga0496116_0000023 | |||
| 640 | Ga0496116_0000112 | |||
| 641 | Ga0496116_0000715 | |||
| 642 | Ga0496116_0001156 | |||
| 643 | Ga0496116_0074850 | |||
| 644 | Ga0496117_0000100 | |||
| 645 | Ga0496117_0000103 | |||
| 646 | Ga0496117_0000238 | |||
| 647 | Ga0496117_0002870 | |||
| 648 | Ga0496117_0016258 | |||
| 649 | Ga0496117_0018547 | |||
| 650 | Ga0496118_0000046 | |||
| 651 | Ga0496118_0000454 | |||
| 652 | Ga0496118_0000959 | |||
| 653 | Ga0496118_0001062 | |||
| 654 | Ga0496118_0012003 | |||
| 655 | Ga0496118_0018950 | |||
| 656 | Ga0496118_0024831 | |||
| 657 | Ga0496119_0000031 | |||
| 658 | Ga0496119_0000374 | |||
| 659 | Ga0496119_0002749 | |||
| 660 | Ga0496119_0004318 | |||
| 661 | Ga0496119_0004731 | |||
| 662 | Ga0496119_0008560 | |||
| 663 | Ga0496119_0011573 | |||
| 664 | Ga0496119_0024745 | |||
| 665 | Ga0496120_0000017 | |||
| 666 | Ga0496120_0000084 | |||
| 667 | Ga0496120_0000275 | |||
| 668 | Ga0496120_0000317 | |||
| 669 | Ga0496120_0000491 | |||
| 670 | Ga0496120_0000806 | |||
| 671 | Ga0496120_0001442 | |||
| 672 | Ga0496120_0001680 | |||
| 673 | Ga0496120_0004679 | |||
| 674 | Ga0496121_0001130 | |||
| 675 | Ga0496121_0088113 | |||
| 676 | Ga0496121_0093948 | |||
| 677 | Ga0496122_0000067 | |||
| 678 | Ga0496122_0007703 | |||
| 679 | Ga0496122_0011010 | |||
| 680 | Ga0496123_0000056 | |||
| 681 | Ga0496123_0001657 | |||
| 682 | Ga0496123_0026197 | |||
| 683 | Ga0496123_0030124 | |||
| 684 | Ga0496124_0000007 | |||
| 685 | Ga0496124_0000017 | |||
| 686 | Ga0496124_0000338 | |||
| 687 | Ga0496124_0000362 | |||
| 688 | Ga0496124_0000965 | |||
| 689 | Ga0496124_0069253 | |||
| 690 | Ga0496125_0000183 | |||
| 691 | Ga0496125_0000245 | |||
| 692 | Ga0496125_0010371 | |||
| 693 | Ga0496125_0016151 | |||
| 694 | Ga0496126_0006344 | |||
| 695 | Ga0496126_0018190 | |||
| 696 | Ga0496126_0052322 | |||
| 697 | Ga0496126_0128877 | |||
| 698 | Ga0495678_000607 | |||
| 699 | Ga0495682_0000003 | |||
| 700 | Ga0501034_0016688 | |||
| 701 | Ga0501047_0003432 | |||
| 702 | Ga0501035_0070691 | |||
| 703 | Ga0501044_0005080 | |||
| 704 | Ga0501226_000032 | |||
| 705 | Ga0500566_0009776 | |||
| 706 | Ga0500621_000006 | |||
| 707 | Ga0500622_0001406 | |||
| 708 | Ga0500634_0000284 | |||
| 709 | 2506577452 | |||
| 710 | 2506582590 | |||
| 711 | 2508851390 | |||
| 712 | 2511381912 | |||
| 713 | 2511432748 | |||
| 714 | 2538427482 | |||
| 715 | 2552747245 | |||
| 716 | 2585826557 | |||
| 717 | 2585832662 | |||
| 718 | 2599880370 | |||
| 719 | 2599928135 | |||
| 720 | 2599946949 | |||
| 721 | 2599970787 | |||
| 722 | 2601539770 | |||
| 723 | 2601625053 | |||
| 724 | 2601758119 | |||
| 725 | 2601763629 | |||
| 726 | 2608670528 | |||
| 727 | 2621300056 | |||
| 728 | 2640733800 | |||
| 729 | 2650900209 | |||
| 730 | 2656278367 | |||
| 731 | 2671109221 | |||
| 732 | 2671585904 | |||
| 733 | 2678230781 | |||
| 734 | 2686354448 | |||
| 735 | 2687580462 | |||
| 736 | 2689443930 | |||
| 737 | 2712470075 | |||
| 738 | 2738670058 | |||
| 739 | 2738748451 | |||
| 740 | 2738806594 | |||
| 741 | 2738857493 | |||
| 742 | 2738893954 | |||
| 743 | 2745160986 | |||
| 744 | 2772437960 | |||
| 745 | 2774388663 | |||
| 746 | 2774438677 | |||
| 747 | 2791921328 | |||
| 748 | 2793404194 | |||
| 749 | 2808979284 | |||
| 750 | 2808994832 | |||
| 751 | 2809124264 | |||
| 752 | 2812367436 | |||
| 753 | 2813728554 | |||
| 754 | 2814696068 | |||
| 755 | 2817491396 | |||
| 756 | 2844532604 | |||
| 757 | 2847089126 | |||
| 758 | 2847801301 | |||
| 759 | 2852614268 | |||
| 760 | 2852667994 | |||
| 761 | 2855197163 | |||
| 762 | 2857544336 | |||
| 763 | 2858468674 | |||
| 764 | 2858953726 | |||
| 765 | 2865018610 | |||
| 766 | 2869553305 | |||
| 767 | 2871274466 | |||
| 768 | 2871286131 | |||
| 769 | 2876605747 | |||
| 770 | 2881613739 | |||
| 771 | 2884090234 | |||
| 772 | 2888367961 | |||
| 773 | 2888374396 | |||
| 774 | 2891636905 | |||
| 775 | 2891672489 | |||
| 776 | 2900051769 | |||
| 777 | 2904477500 | |||
| 778 | 2904508169 | |||
| 779 | 2908673100 | |||
| 780 | 2916701608 | |||
| 781 | 2919153791 | |||
| 782 | 2919183689 | |||
| 783 | 2919507108 | |||
| 784 | 2923521484 | |||
| 785 | 2927147193 | |||
| 786 | 2928518849 | |||
| 787 | 2937969701 | |||
| 788 | 2939606623 | |||
| 789 | 2945954335 | |||
| 790 | 2945964011 | |||
| 791 | 2978976820 | |||
| 792 | 2984498132 | |||
| 793 | 2990198112 | |||
| 794 | 2990265170 | |||
| 795 | 3000379382 | |||
| 796 | 3007254503 | |||
| 797 | 3007316703 | |||
| 798 | 640936950 | |||
| 799 | 8004594832 | |||
| 800 | 8015394969 | |||
| 801 | 8016737276 | |||
| 802 | 8019502477 | |||
| 803 | 8033233145 | |||
| 804 | 8054850932 | |||
| 805 | 8055091308 | |||
| 806 | 8055094943 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4cp8-assembly2.cif.gz_D | structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp | 0.9576 | 16 | 454 |
| 5c5z-assembly1.cif.gz_B | crystal structure analysis of c4763, a uropathogenic e. coli-specific protein | 0.9478 | 484 | 607 |
| 4cp8-assembly2.cif.gz_D | structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp | 0.9388 | 16 | 454 |
| 4gyr-assembly1.cif.gz_B | granulibacter bethesdensis allophanate hydrolase apo | 0.9281 | 16 | 470 |
| 5c5z-assembly1.cif.gz_B | crystal structure analysis of c4763, a uropathogenic e. coli-specific protein | 0.9048 | 484 | 607 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4cp8A00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.961 | 16 | 454 | 3.90.1300.10 |
| 4issB03 | Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like | 0.9528 | 484 | 609 | 3.10.490.10 |
| 5c5zB00 | Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like | 0.9403 | 484 | 607 | 3.10.490.10 |
| 4cp8A00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.94 | 16 | 454 | 3.90.1300.10 |
| 4istB01 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.9283 | 1 | 473 | 3.90.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A074YUG5-F1-model_v4 | Allophanate hydrolase C-terminal domain-containing protein | 0.9882 | 486 | 608 |
|
| AF-A0A4Q5WQT4-F1-model_v4 | deleted | 0.9859 | 83 | 451 |
|
| AF-A0A377N6T3-F1-model_v4 | Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-) | 0.98 | 1 | 193 |
GO:0016740
GO:0016874 |
| AF-A0A0K0STS0-F1-model_v4 | Amidase | 0.9791 | 484 | 610 |
|
| AF-S6TR78-F1-model_v4 | Allophanate hydrolase | 0.9777 | 299 | 462 |
GO:0016787
|