F435376

General Info

Members Datasets Scaffolds Average Seq Length
403 281 806 135

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10814997|Ga0105243_108149971
Length 159
Sequence MKIDGQCHCGRVRYQADIDPEKVSICHCTDCQTLTGSPYRVTVICAAEDVWLTGEPAKMYGKTGDNGRTRFQHFCGECGSPLFTSGEGGPDDWGIRWGSIRQRGELKPARQIWCRSAAPWISDLKGLPGRPGDEGFEHAGYPTLAPKGAAGLNRRLKGG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
247 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
260 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
261 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
268 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
269 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
270 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
271 2643221651 Afipia sp. Root123D2 Isolate Unclassified
272 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
273 2791355199
274 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
275 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
276 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
277 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
278 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
279 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
280 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
281 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 1.99
Rhizoplane 4.71
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10814997 3300009148 Bacteria 921
2 LJQas_1001084 3300000549 Bacteria 4146
3 rootL2_10281230 3300003322 Bacteria 1014
4 Ga0070683_100231541 3300005329 Bacteria 1756
5 Ga0070683_100448177 3300005329 Bacteria 1231
6 Ga0068869_100264206 3300005334 Bacteria 1379
7 Ga0070666_10810470 3300005335 Bacteria 690
8 Ga0068868_100010123 3300005338 Bacteria 6813
9 Ga0070668_100055681 3300005347 Bacteria 3053
10 Ga0070669_100888253 3300005353 Bacteria 761
11 Ga0070671_101396365 3300005355 Bacteria 619
12 Ga0070673_100370709 3300005364 Bacteria 1275
13 Ga0070667_101118291 3300005367 Bacteria 737
14 Ga0070709_10101601 3300005434 Bacteria 1916
15 Ga0070709_11428327 3300005434 Bacteria 560
16 Ga0070714_100059755 3300005435 Bacteria 3269
17 Ga0070714_100209155 3300005435 Bacteria 1788
18 Ga0070713_100037277 3300005436 Bacteria 3930
19 Ga0070713_100095907 3300005436 Bacteria 2560
20 Ga0070713_100186388 3300005436 Bacteria 1867
21 Ga0070713_100373266 3300005436 Bacteria 1327
22 Ga0070710_10011213 3300005437 Bacteria 4424
23 Ga0070710_10032056 3300005437 Bacteria 2843
24 Ga0070711_100134742 3300005439 Bacteria 1844
25 Ga0070711_101874990 3300005439 Bacteria 527
26 Ga0070705_100919715 3300005440 Bacteria 705
27 Ga0070663_100018501 3300005455 Bacteria 4570
28 Ga0070663_100132493 3300005455 Bacteria 1894
29 Ga0070662_100374042 3300005457 Bacteria 1171
30 Ga0070681_10405723 3300005458 Bacteria 1274
31 Ga0068867_100583405 3300005459 Bacteria 973
32 Ga0070699_100551763 3300005518 Bacteria 1049
33 Ga0070679_100580397 3300005530 Bacteria 1065
34 Ga0070684_100380141 3300005535 Bacteria 1301
35 Ga0070672_101501959 3300005543 Bacteria 604
36 Ga0070665_100008324 3300005548 Bacteria 10489
37 Ga0070665_100483214 3300005548 Bacteria 1249
38 Ga0070665_100553717 3300005548 Bacteria 1162
39 Ga0070665_100887461 3300005548 Bacteria 904
40 Ga0068855_101076490 3300005563 Bacteria 841
41 Ga0070664_101731488 3300005564 Bacteria 593
42 Ga0068857_100941698 3300005577 Bacteria 829
43 Ga0068854_100173683 3300005578 Bacteria 1678
44 Ga0068856_100005427 3300005614 Bacteria 12566
45 Ga0068856_100567844 3300005614 Bacteria 1156
46 Ga0068852_100802023 3300005616 Bacteria 956
47 Ga0068864_100053278 3300005618 Bacteria 3489
48 Ga0068866_10353349 3300005718 Bacteria 934
49 Ga0068861_100221524 3300005719 Bacteria 1599
50 Ga0068851_10392052 3300005834 Bacteria 816
51 Ga0068860_100504289 3300005843 Bacteria 1208
52 Ga0081455_10018433 3300005937 Bacteria 6651
53 Ga0081455_10020418 3300005937 Bacteria 6238
54 Ga0081540_1014179 3300005983 Bacteria 5126
55 Ga0081539_10016653 3300005985 Bacteria 5228
56 Ga0070717_10013460 3300006028 Bacteria 6270
57 Ga0070717_10182002 3300006028 Bacteria 1832
58 Ga0075365_10364196 3300006038 Bacteria 1019
59 Ga0075368_10096079 3300006042 Bacteria 1214
60 Ga0075363_100700378 3300006048 Bacteria 612
61 Ga0070715_10115201 3300006163 Bacteria 1274
62 Ga0070715_10236524 3300006163 Bacteria 948
63 Ga0070716_100038718 3300006173 Bacteria 2641
64 Ga0070716_100199345 3300006173 Bacteria 1329
65 Ga0070716_100659027 3300006173 Bacteria 795
66 Ga0070712_100421916 3300006175 Bacteria 1106
67 Ga0075367_10010105 3300006178 Bacteria 4949
68 Ga0075367_10451567 3300006178 Bacteria 815
69 Ga0068871_100091643 3300006358 Bacteria 2533
70 Ga0068865_101661934 3300006881 Bacteria 575
71 Ga0099794_10158212 3300007265 Bacteria 1152
72 Ga0099795_10103843 3300007788 Bacteria 1118
73 Ga0099795_10193563 3300007788 Bacteria 855
74 Ga0105245_11726076 3300009098 Bacteria 678
75 Ga0105243_10163903 3300009148 Bacteria 1919
76 Ga0105243_10461385 3300009148 Bacteria 1194
77 Ga0105242_10887695 3300009176 Bacteria 890
78 Ga0105248_10100374 3300009177 Bacteria 3261
79 Ga0105248_10853885 3300009177 Bacteria 1028
80 Ga0105237_10064791 3300009545 Bacteria 3650
81 Ga0105238_10290503 3300009551 Bacteria 1617
82 Ga0105249_10315641 3300009553 Bacteria 1573
83 Ga0099796_10000818 3300010159 Bacteria 5663
84 Ga0105239_10145709 3300010375 Bacteria 2640
85 Ga0105239_10974976 3300010375 Bacteria 974
86 Ga0105239_11312601 3300010375 Bacteria 835
87 Ga0157371_10093054 3300013102 Bacteria 2136
88 Ga0157370_10074043 3300013104 Bacteria 3213
89 Ga0157370_10734437 3300013104 Bacteria 900
90 Ga0157369_10164966 3300013105 Bacteria 2337
91 Ga0163162_10095404 3300013306 Bacteria 3061
92 Ga0157372_10570854 3300013307 Bacteria 1318
93 Ga0157372_11234075 3300013307 Bacteria 863
94 Ga0157375_10031917 3300013308 Bacteria 4989
95 Ga0157375_12124220 3300013308 Bacteria 668
96 Ga0163163_10385516 3300014325 Bacteria 1459
97 Ga0163161_10319410 3300017792 Bacteria 1227
98 Ga0213873_10012590 3300021358 Bacteria 1837
99 Ga0213876_10057982 3300021384 Bacteria 2044
100 Ga0209677_100742 3300025253 Bacteria 16569
101 Ga0207656_10240068 3300025321 Bacteria 885
102 Ga0207692_10003649 3300025898 Bacteria 6027
103 Ga0207692_10058952 3300025898 Bacteria 1980
104 Ga0207692_10154667 3300025898 Bacteria 1316
105 Ga0207642_10450233 3300025899 Bacteria 780
106 Ga0207685_10029091 3300025905 Bacteria 1952
107 Ga0207685_10373288 3300025905 Bacteria 725
108 Ga0207699_10001979 3300025906 Bacteria 9675
109 Ga0207699_10045586 3300025906 Bacteria 2560
110 Ga0207699_10049091 3300025906 Bacteria 2483
111 Ga0207699_10123303 3300025906 Bacteria 1679
112 Ga0207684_10388380 3300025910 Bacteria 1200
113 Ga0207707_10189456 3300025912 Bacteria 1794
114 Ga0207671_10255358 3300025914 Bacteria 1379
115 Ga0207693_10026808 3300025915 Bacteria 4558
116 Ga0207693_10373392 3300025915 Bacteria 1115
117 Ga0207693_10880608 3300025915 Bacteria 688
118 Ga0207663_10019345 3300025916 Bacteria 3834
119 Ga0207663_10158993 3300025916 Bacteria 1593
120 Ga0207663_10605218 3300025916 Bacteria 861
121 Ga0207663_10918694 3300025916 Bacteria 700
122 Ga0207681_10428446 3300025923 Bacteria 1073
123 Ga0207650_10798216 3300025925 Bacteria 800
124 Ga0207700_10262809 3300025928 Bacteria 1478
125 Ga0207700_10286895 3300025928 Bacteria 1418
126 Ga0207664_10660055 3300025929 Bacteria 940
127 Ga0207664_10821242 3300025929 Bacteria 836
128 Ga0207706_11325703 3300025933 Bacteria 594
129 Ga0207686_10344756 3300025934 Bacteria 1120
130 Ga0207709_10103100 3300025935 Bacteria 1890
131 Ga0207669_11071313 3300025937 Bacteria 679
132 Ga0207704_10965618 3300025938 Bacteria 719
133 Ga0207665_10001615 3300025939 Bacteria 15213
134 Ga0207665_10106399 3300025939 Bacteria 1965
135 Ga0207665_10131019 3300025939 Bacteria 1780
136 Ga0207665_10464600 3300025939 Bacteria 973
137 Ga0207711_10069156 3300025941 Bacteria 3060
138 Ga0207689_10559024 3300025942 Bacteria 961
139 Ga0207661_10182786 3300025944 Bacteria 1833
140 Ga0207679_11587230 3300025945 Bacteria 600
141 Ga0207667_10836973 3300025949 Bacteria 915
142 Ga0207712_10222265 3300025961 Bacteria 1510
143 Ga0207668_10085343 3300025972 Bacteria 2303
144 Ga0207658_10278146 3300025986 Bacteria 1434
145 Ga0207658_10704012 3300025986 Bacteria 913
146 Ga0207678_10129047 3300026067 Bacteria 2156
147 Ga0207702_10110500 3300026078 Bacteria 2443
148 Ga0207648_10536272 3300026089 Bacteria 1074
149 Ga0207676_10560786 3300026095 Bacteria 1092
150 Ga0207674_10433665 3300026116 Bacteria 1270
151 Ga0207674_11115800 3300026116 Bacteria 758
152 Ga0207675_100765623 3300026118 Bacteria 977
153 Ga0207683_10049380 3300026121 Bacteria 3684
154 Ga0207698_10795713 3300026142 Bacteria 947
155 Ga0207698_11356770 3300026142 Bacteria 726
156 Ga0209179_1055349 3300027512 Bacteria 855
157 Ga0268266_10036796 3300028379 Bacteria 4169
158 Ga0268266_10395164 3300028379 Bacteria 1306
159 Ga0265334_10010404 3300028573 Bacteria 3929
160 Ga0307508_10050421 3300031616 Bacteria 3705
161 Ga0307412_10395669 3300031911 Bacteria 1123
162 Ga0307412_12159896 3300031911 Bacteria 518
163 Ga0307416_101929538 3300032002 Bacteria 694
164 Ga0373934_0003092 3300035086 Bacteria 6078
165 Ga0373934_0017957 3300035086 Bacteria 2704
166 Ga0373934_0030357 3300035086 Bacteria 2114
167 Ga0373934_0085141 3300035086 Bacteria 1272
168 Ga0373940_0331927 3300035088 Bacteria 530
169 Ga0373923_0013845 3300035111 Bacteria 3015
170 Ga0373923_0125898 3300035111 Bacteria 1148
171 Ga0373932_0422749 3300035112 Bacteria 519
172 Ga0373936_0029198 3300035113 Bacteria 2170
173 Ga0373936_0040570 3300035113 Bacteria 1865
174 Ga0373945_0099981 3300035116 Bacteria 1134
175 Ga0373945_0129022 3300035116 Bacteria 1012
176 Ga0373953_0000167 3300035117 Bacteria 17273
177 Ga0373953_0005733 3300035117 Bacteria 4049
178 Ga0373953_0135840 3300035117 Bacteria 1050
179 Ga0373954_0043477 3300035118 Bacteria 2095
180 Ga0373956_0002810 3300035119 Bacteria 7037
181 Ga0373956_0014224 3300035119 Bacteria 3322
182 Ga0373957_0008523 3300035120 Bacteria 3325
183 Ga0373957_0037390 3300035120 Bacteria 1813
184 Ga0373946_0002212 3300035171 Bacteria 6852
185 Ga0373955_0005478 3300035172 Bacteria 5708
186 Ga0373955_0156574 3300035172 Bacteria 1342
187 Ga0373924_0010376 3300035410 Bacteria 3431
188 Ga0373924_0018691 3300035410 Bacteria 2675
189 Ga0373935_0038708 3300035692 Bacteria 2987
190 Ga0373935_0044876 3300035692 Bacteria 2787
191 Ga0373927_0040439 3300035695 Bacteria 3024
192 Ga0373933_0000037 3300035724 Bacteria 81092
193 Ga0373933_0000185 3300035724 Bacteria 41223
194 Ga0373933_0011381 3300035724 Bacteria 4901
195 Ga0373933_0152385 3300035724 Bacteria 1464
196 Ga0373947_0025534 3300035725 Bacteria 3446
197 Ga0373947_0703565 3300035725 Bacteria 689
198 Ga0373937_0044161 3300036401 Bacteria 4069
199 Ga0373937_0290551 3300036401 Unclassified 1544
200 Ga0373925_0032033 3300037068 Bacteria 3867
201 Ga0373925_0126631 3300037068 Bacteria 1988
202 Ga0395905_0338229 3300037471 Bacteria 1396
203 Ga0436364_0340307 3300037853 Bacteria 1209
204 Ga0436364_0976024 3300037853 Bacteria 695
205 Ga0436365_1925011 3300039437 Bacteria 1801
206 Ga0436360_0939149 3300039438 Bacteria 804
207 Ga0436361_0437302 3300039447 Bacteria 780
208 Ga0436361_0686722 3300039447 Bacteria 1488
209 Ga0436363_0935581 3300039450 Bacteria 567
210 Ga0436363_1275158 3300039450 Bacteria 1267
211 Ga0436362_0092954 3300039453 Bacteria 2217
212 Ga0436362_1181680 3300039453 Bacteria 601
213 Ga0436362_1253224 3300039453 Bacteria 1738
214 Ga0439465_0085658 3300041413 Bacteria 1073
215 Ga0439465_0219765 3300041413 Bacteria 696
216 Ga0451787_419996 3300041441 Bacteria 508
217 Ga0439459_0100842 3300042438 Bacteria 706
218 Ga0466961_0121205 3300044693 Bacteria 1642
219 Ga0466963_0361761 3300044694 Bacteria 1022
220 Ga0466964_0098309 3300044706 Bacteria 1286
221 Ga0466964_0927415 3300044706 Bacteria 500
222 Ga0466970_0035576 3300044765 Bacteria 2638
223 Ga0466957_0310986 3300044842 Bacteria 1061
224 Ga0466959_0321629 3300045049 Bacteria 1057
225 Ga0466967_0152446 3300045976 Bacteria 2162
226 Ga0466967_1758014 3300045976 Bacteria 617
227 Ga0495592_0173547 3300046454 Bacteria 1474
228 Ga0495592_0203593 3300046454 Bacteria 1334
229 Ga0495603_0142699 3300046455 Bacteria 1393
230 Ga0495629_0045673 3300046459 Bacteria 3073
231 Ga0495638_0052646 3300046460 Bacteria 2535
232 Ga0495638_0261167 3300046460 Bacteria 950
233 Ga0495641_0463468 3300046461 Bacteria 577
234 Ga0495651_0020948 3300046462 Bacteria 5076
235 Ga0495653_0043181 3300046463 Bacteria 3506
236 Ga0495580_0038233 3300046472 Bacteria 3438
237 Ga0495662_0074425 3300046476 Bacteria 1648
238 Ga0495664_0017027 3300046477 Bacteria 4151
239 Ga0495664_0018533 3300046477 Bacteria 3990
240 Ga0495608_0021019 3300046511 Bacteria 4483
241 Ga0495618_0068544 3300046514 Bacteria 2256
242 Ga0495618_0274746 3300046514 Bacteria 1052
243 Ga0495628_0012174 3300046516 Bacteria 7250
244 Ga0495628_0098046 3300046516 Bacteria 2264
245 Ga0495628_0216538 3300046516 Bacteria 1439
246 Ga0495628_1209907 3300046516 Bacteria 512
247 Ga0495630_0107683 3300046517 Bacteria 2111
248 Ga0495630_0232858 3300046517 Bacteria 1407
249 Ga0495652_0052796 3300046529 Bacteria 3465
250 Ga0495652_0226518 3300046529 Bacteria 1401
251 Ga0495652_0719967 3300046529 Bacteria 670
252 Ga0495640_0049672 3300046533 Bacteria 2891
253 Ga0495640_0469625 3300046533 Bacteria 767
254 Ga0495587_0013223 3300046536 Bacteria 5187
255 Ga0495587_0031452 3300046536 Bacteria 3213
256 Ga0495587_0146246 3300046536 Bacteria 1348
257 Ga0495645_0032696 3300046543 Bacteria 3795
258 Ga0495667_0070470 3300046559 Bacteria 2280
259 Ga0495667_0305088 3300046559 Bacteria 1008
260 Ga0495634_0023087 3300046642 Bacteria 4378
261 Ga0495634_0037957 3300046642 Bacteria 3287
262 Ga0495635_0006104 3300046663 Bacteria 8401
263 Ga0495635_0089352 3300046663 Bacteria 2108
264 Ga0495657_0072461 3300046675 Bacteria 2246
265 Ga0495599_0012905 3300046678 Bacteria 5156
266 Ga0495599_0064714 3300046678 Bacteria 2284
267 Ga0495599_0072820 3300046678 Bacteria 2145
268 Ga0495599_0251570 3300046678 Bacteria 1075
269 Ga0495623_0008764 3300046679 Bacteria 6567
270 Ga0495623_0079276 3300046679 Bacteria 2034
271 Ga0495646_0038024 3300046680 Bacteria 2973
272 Ga0495646_0067864 3300046680 Bacteria 2107
273 Ga0495647_0057898 3300046681 Bacteria 1522
274 Ga0495658_0222797 3300046683 Bacteria 1181
275 Ga0495613_0681140 3300046689 Bacteria 678
276 Ga0495624_0042393 3300046690 Bacteria 2908
277 Ga0495624_0425996 3300046690 Bacteria 796
278 Ga0495600_0004911 3300046809 Bacteria 8029
279 Ga0495600_0128042 3300046809 Bacteria 1651
280 Ga0495600_0687059 3300046809 Unclassified 616
281 Ga0495581_0153713 3300047315 Bacteria 1344
282 Ga0495581_0248506 3300047315 Bacteria 1040
283 Ga0495604_0057681 3300047317 Bacteria 2985
284 Ga0495674_0086626 3300047319 Bacteria 2681
285 Ga0495674_0112289 3300047319 Bacteria 2309
286 Ga0495672_0003972 3300047320 Bacteria 12380
287 Ga0495676_0140942 3300047321 Bacteria 1728
288 Ga0495680_0045074 3300047322 Bacteria 3484
289 Ga0495675_0027942 3300047444 Bacteria 3595
290 Ga0495673_0079954 3300047469 Bacteria 1356
291 Ga0495684_0000184 3300047471 Bacteria 47730
292 Ga0495593_0402542 3300047673 Bacteria 684
293 Ga0495602_0033103 3300048088 Bacteria 4855
294 Ga0495614_0068847 3300048089 Bacteria 1524
295 Ga0496101_0080745 3300048904 Bacteria 2403
296 Ga0496102_0016896 3300048905 Bacteria 6385
297 Ga0496103_0129283 3300048906 Bacteria 1612
298 Ga0496104_0188843 3300048907 Bacteria 1971
299 Ga0496105_0668315 3300048908 Bacteria 800
300 Ga0496106_0016729 3300048909 Bacteria 5426
301 Ga0496106_0163704 3300048909 Bacteria 1760
302 Ga0496107_0022225 3300048910 Bacteria 4482
303 Ga0496108_0034224 3300048911 Bacteria 4220
304 Ga0496109_0014965 3300048912 Bacteria 6752
305 Ga0496110_0027733 3300048913 Bacteria 4857
306 Ga0496110_0081182 3300048913 Bacteria 2890
307 Ga0496110_0814944 3300048913 Bacteria 838
308 Ga0496111_1137453 3300048914 Bacteria 555
309 Ga0496112_0544632 3300048915 Bacteria 1094
310 Ga0496113_0055756 3300048916 Bacteria 2964
311 Ga0496115_0010545 3300048918 Bacteria 6909
312 Ga0496115_0360706 3300048918 Bacteria 1184
313 Ga0496118_0059867 3300048921 Bacteria 2832
314 Ga0496119_0001220 3300048922 Bacteria 32068
315 Ga0496119_0050635 3300048922 Bacteria 2559
316 Ga0496121_0214973 3300048924 Bacteria 1359
317 Ga0496121_0542394 3300048924 Bacteria 729
318 Ga0496124_0000063 3300048927 Bacteria 229705
319 Ga0496126_0123572 3300048929 Bacteria 2242
320 Ga0496126_0137703 3300048929 Bacteria 2104
321 Ga0501031_0014546 3300049568 Bacteria 5117
322 Ga0501032_0000228 3300049569 Bacteria 46774
323 Ga0501033_0000256 3300049570 Bacteria 50977
324 Ga0501034_0000175 3300049571 Bacteria 119465
325 Ga0501036_0000032 3300049572 Bacteria 91370
326 Ga0501037_0000126 3300049573 Bacteria 71116
327 Ga0501038_0000114 3300049574 Bacteria 68140
328 Ga0501039_0002583 3300049575 Bacteria 13528
329 Ga0501043_0002516 3300049579 Bacteria 15489
330 Ga0501046_0001309 3300049580 Bacteria 24119
331 Ga0501047_0005183 3300049581 Bacteria 12233
332 Ga0501048_0009797 3300049582 Bacteria 7183
333 Ga0501067_0000096 3300049583 Bacteria 50761
334 Ga0501068_0001140 3300049584 Bacteria 14063
335 Ga0501069_0003223 3300049585 Bacteria 8366
336 Ga0501070_0010692 3300049586 Bacteria 7760
337 Ga0501071_0101519 3300049587 Bacteria 2121
338 Ga0501072_0001280 3300049588 Bacteria 18799
339 Ga0501073_0006779 3300049589 Bacteria 8519
340 Ga0501074_0002945 3300049590 Bacteria 11957
341 Ga0501080_0007028 3300049742 Bacteria 10162
342 Ga0501083_0005587 3300049744 Bacteria 8903
343 Ga0501035_0003496 3300049822 Bacteria 15019
344 Ga0501044_0000061 3300049823 Bacteria 133207
345 Ga0501045_0154481 3300049824 Bacteria 1707
346 nmdc:mga03n38_320811_c1 3300050490 Bacteria 836
347 nmdc:mga06z11_169147_c1 3300050494 Bacteria 1254
348 nmdc:mga07m45_512500_c1 3300050496 Bacteria 694
349 Ga0495601_0074435 3300053077 Bacteria 2172
350 Ga0495601_0307171 3300053077 Bacteria 1033
351 Ga0495612_0008315 3300053078 Bacteria 4212
352 Ga0495612_0600848 3300053078 Bacteria 508
353 Ga0500635_0021080 3300053080 Bacteria 2003
354 Ga0495595_0001012 3300053084 Bacteria 10822
355 Ga0495595_0040207 3300053084 Bacteria 2136
356 Ga0495619_0000182 3300053085 Bacteria 46524
357 Ga0495619_0021826 3300053085 Bacteria 4091
358 Ga0495619_0106998 3300053085 Bacteria 1907
359 Ga0500651_0153223 3300053093 Bacteria 1382
360 Ga0500566_0000287 3300053094 Bacteria 27092
361 Ga0500640_041327 3300053095 Bacteria 2025
362 Ga0500641_0093703 3300053096 Bacteria 1284
363 Ga0500556_0000080 3300053104 Bacteria 91090
364 Ga0500556_0000126 3300053104 Bacteria 65589
365 Ga0500572_000393 3300053111 Bacteria 15463
366 Ga0500572_003608 3300053111 Bacteria 3521
367 Ga0500591_097951 3300053115 Bacteria 1262
368 Ga0500595_004861 3300053119 Bacteria 5946
369 Ga0500595_036235 3300053119 Bacteria 1618
370 Ga0500608_027331 3300053122 Bacteria 2689
371 Ga0500608_260189 3300053122 Bacteria 670
372 Ga0500614_000404 3300053123 Bacteria 11251
373 Ga0500559_0002584 3300053136 Bacteria 9255
374 Ga0500559_0330889 3300053136 Bacteria 714
375 Ga0500603_000603 3300053150 Bacteria 8939
376 Ga0500616_0030910 3300053153 Bacteria 2938
377 Ga0500622_0003192 3300053156 Bacteria 11184
378 Ga0500630_000052 3300053159 Bacteria 34496
379 Ga0500638_061497 3300053162 Bacteria 1804
380 Ga0500639_000123 3300053163 Bacteria 37026
381 Ga0500636_0020829 3300053177 Bacteria 3881
382 Ga0500636_0096364 3300053177 Bacteria 1688
383 Ga0500636_0101467 3300053177 Bacteria 1635
384 Ga0500601_001214 3300053737 Bacteria 2867
385 Ga0501084_0002689 3300054114 Bacteria 14315
386 Ga0501084_1660559 3300054114 Bacteria 534
387 Ga0500661_104927 3300055283 Bacteria 538
388 Ga0501082_0022061 3300060353 Bacteria 5490
389 2513672292 2513237098 Bacteria 9902361
390 2513889211 2513237141 Bacteria 8496279
391 2524466904 2524023210 Bacteria 9029266
392 2644218014 2643221639 Bacteria 6649903
393 2644288326 2643221651 Bacteria 4798932
394 2728753215 2728368998 Bacteria 8720350
395 2793077252
396 2876817354 2876808645 Bacteria 8824342
397 2879115639 2879110137 Bacteria 8907982
398 2889040597 2889033259 Bacteria 9099371
399 2903772740 2903768456 Bacteria 9749579
400 2904696565 2904690495 Bacteria 9412302
401 2908760419 2908756301 Bacteria 8864324
402 3005479564 3005474847 Bacteria 9259049
403 8006988125 8006984368 Bacteria 9651211
404 Ga0105243_10814997
405 LJQas_1001084
406 rootL2_10281230
407 Ga0070683_100231541
408 Ga0070683_100448177
409 Ga0068869_100264206
410 Ga0070666_10810470
411 Ga0068868_100010123
412 Ga0070668_100055681
413 Ga0070669_100888253
414 Ga0070671_101396365
415 Ga0070673_100370709
416 Ga0070667_101118291
417 Ga0070709_10101601
418 Ga0070709_11428327
419 Ga0070714_100059755
420 Ga0070714_100209155
421 Ga0070713_100037277
422 Ga0070713_100095907
423 Ga0070713_100186388
424 Ga0070713_100373266
425 Ga0070710_10011213
426 Ga0070710_10032056
427 Ga0070711_100134742
428 Ga0070711_101874990
429 Ga0070705_100919715
430 Ga0070663_100018501
431 Ga0070663_100132493
432 Ga0070662_100374042
433 Ga0070681_10405723
434 Ga0068867_100583405
435 Ga0070699_100551763
436 Ga0070679_100580397
437 Ga0070684_100380141
438 Ga0070672_101501959
439 Ga0070665_100008324
440 Ga0070665_100483214
441 Ga0070665_100553717
442 Ga0070665_100887461
443 Ga0068855_101076490
444 Ga0070664_101731488
445 Ga0068857_100941698
446 Ga0068854_100173683
447 Ga0068856_100005427
448 Ga0068856_100567844
449 Ga0068852_100802023
450 Ga0068864_100053278
451 Ga0068866_10353349
452 Ga0068861_100221524
453 Ga0068851_10392052
454 Ga0068860_100504289
455 Ga0081455_10018433
456 Ga0081455_10020418
457 Ga0081540_1014179
458 Ga0081539_10016653
459 Ga0070717_10013460
460 Ga0070717_10182002
461 Ga0075365_10364196
462 Ga0075368_10096079
463 Ga0075363_100700378
464 Ga0070715_10115201
465 Ga0070715_10236524
466 Ga0070716_100038718
467 Ga0070716_100199345
468 Ga0070716_100659027
469 Ga0070712_100421916
470 Ga0075367_10010105
471 Ga0075367_10451567
472 Ga0068871_100091643
473 Ga0068865_101661934
474 Ga0099794_10158212
475 Ga0099795_10103843
476 Ga0099795_10193563
477 Ga0105245_11726076
478 Ga0105243_10163903
479 Ga0105243_10461385
480 Ga0105242_10887695
481 Ga0105248_10100374
482 Ga0105248_10853885
483 Ga0105237_10064791
484 Ga0105238_10290503
485 Ga0105249_10315641
486 Ga0099796_10000818
487 Ga0105239_10145709
488 Ga0105239_10974976
489 Ga0105239_11312601
490 Ga0157371_10093054
491 Ga0157370_10074043
492 Ga0157370_10734437
493 Ga0157369_10164966
494 Ga0163162_10095404
495 Ga0157372_10570854
496 Ga0157372_11234075
497 Ga0157375_10031917
498 Ga0157375_12124220
499 Ga0163163_10385516
500 Ga0163161_10319410
501 Ga0213873_10012590
502 Ga0213876_10057982
503 Ga0209677_100742
504 Ga0207656_10240068
505 Ga0207692_10003649
506 Ga0207692_10058952
507 Ga0207692_10154667
508 Ga0207642_10450233
509 Ga0207685_10029091
510 Ga0207685_10373288
511 Ga0207699_10001979
512 Ga0207699_10045586
513 Ga0207699_10049091
514 Ga0207699_10123303
515 Ga0207684_10388380
516 Ga0207707_10189456
517 Ga0207671_10255358
518 Ga0207693_10026808
519 Ga0207693_10373392
520 Ga0207693_10880608
521 Ga0207663_10019345
522 Ga0207663_10158993
523 Ga0207663_10605218
524 Ga0207663_10918694
525 Ga0207681_10428446
526 Ga0207650_10798216
527 Ga0207700_10262809
528 Ga0207700_10286895
529 Ga0207664_10660055
530 Ga0207664_10821242
531 Ga0207706_11325703
532 Ga0207686_10344756
533 Ga0207709_10103100
534 Ga0207669_11071313
535 Ga0207704_10965618
536 Ga0207665_10001615
537 Ga0207665_10106399
538 Ga0207665_10131019
539 Ga0207665_10464600
540 Ga0207711_10069156
541 Ga0207689_10559024
542 Ga0207661_10182786
543 Ga0207679_11587230
544 Ga0207667_10836973
545 Ga0207712_10222265
546 Ga0207668_10085343
547 Ga0207658_10278146
548 Ga0207658_10704012
549 Ga0207678_10129047
550 Ga0207702_10110500
551 Ga0207648_10536272
552 Ga0207676_10560786
553 Ga0207674_10433665
554 Ga0207674_11115800
555 Ga0207675_100765623
556 Ga0207683_10049380
557 Ga0207698_10795713
558 Ga0207698_11356770
559 Ga0209179_1055349
560 Ga0268266_10036796
561 Ga0268266_10395164
562 Ga0265334_10010404
563 Ga0307508_10050421
564 Ga0307412_10395669
565 Ga0307412_12159896
566 Ga0307416_101929538
567 Ga0373934_0003092
568 Ga0373934_0017957
569 Ga0373934_0030357
570 Ga0373934_0085141
571 Ga0373940_0331927
572 Ga0373923_0013845
573 Ga0373923_0125898
574 Ga0373932_0422749
575 Ga0373936_0029198
576 Ga0373936_0040570
577 Ga0373945_0099981
578 Ga0373945_0129022
579 Ga0373953_0000167
580 Ga0373953_0005733
581 Ga0373953_0135840
582 Ga0373954_0043477
583 Ga0373956_0002810
584 Ga0373956_0014224
585 Ga0373957_0008523
586 Ga0373957_0037390
587 Ga0373946_0002212
588 Ga0373955_0005478
589 Ga0373955_0156574
590 Ga0373924_0010376
591 Ga0373924_0018691
592 Ga0373935_0038708
593 Ga0373935_0044876
594 Ga0373927_0040439
595 Ga0373933_0000037
596 Ga0373933_0000185
597 Ga0373933_0011381
598 Ga0373933_0152385
599 Ga0373947_0025534
600 Ga0373947_0703565
601 Ga0373937_0044161
602 Ga0373937_0290551
603 Ga0373925_0032033
604 Ga0373925_0126631
605 Ga0395905_0338229
606 Ga0436364_0340307
607 Ga0436364_0976024
608 Ga0436365_1925011
609 Ga0436360_0939149
610 Ga0436361_0437302
611 Ga0436361_0686722
612 Ga0436363_0935581
613 Ga0436363_1275158
614 Ga0436362_0092954
615 Ga0436362_1181680
616 Ga0436362_1253224
617 Ga0439465_0085658
618 Ga0439465_0219765
619 Ga0451787_419996
620 Ga0439459_0100842
621 Ga0466961_0121205
622 Ga0466963_0361761
623 Ga0466964_0098309
624 Ga0466964_0927415
625 Ga0466970_0035576
626 Ga0466957_0310986
627 Ga0466959_0321629
628 Ga0466967_0152446
629 Ga0466967_1758014
630 Ga0495592_0173547
631 Ga0495592_0203593
632 Ga0495603_0142699
633 Ga0495629_0045673
634 Ga0495638_0052646
635 Ga0495638_0261167
636 Ga0495641_0463468
637 Ga0495651_0020948
638 Ga0495653_0043181
639 Ga0495580_0038233
640 Ga0495662_0074425
641 Ga0495664_0017027
642 Ga0495664_0018533
643 Ga0495608_0021019
644 Ga0495618_0068544
645 Ga0495618_0274746
646 Ga0495628_0012174
647 Ga0495628_0098046
648 Ga0495628_0216538
649 Ga0495628_1209907
650 Ga0495630_0107683
651 Ga0495630_0232858
652 Ga0495652_0052796
653 Ga0495652_0226518
654 Ga0495652_0719967
655 Ga0495640_0049672
656 Ga0495640_0469625
657 Ga0495587_0013223
658 Ga0495587_0031452
659 Ga0495587_0146246
660 Ga0495645_0032696
661 Ga0495667_0070470
662 Ga0495667_0305088
663 Ga0495634_0023087
664 Ga0495634_0037957
665 Ga0495635_0006104
666 Ga0495635_0089352
667 Ga0495657_0072461
668 Ga0495599_0012905
669 Ga0495599_0064714
670 Ga0495599_0072820
671 Ga0495599_0251570
672 Ga0495623_0008764
673 Ga0495623_0079276
674 Ga0495646_0038024
675 Ga0495646_0067864
676 Ga0495647_0057898
677 Ga0495658_0222797
678 Ga0495613_0681140
679 Ga0495624_0042393
680 Ga0495624_0425996
681 Ga0495600_0004911
682 Ga0495600_0128042
683 Ga0495600_0687059
684 Ga0495581_0153713
685 Ga0495581_0248506
686 Ga0495604_0057681
687 Ga0495674_0086626
688 Ga0495674_0112289
689 Ga0495672_0003972
690 Ga0495676_0140942
691 Ga0495680_0045074
692 Ga0495675_0027942
693 Ga0495673_0079954
694 Ga0495684_0000184
695 Ga0495593_0402542
696 Ga0495602_0033103
697 Ga0495614_0068847
698 Ga0496101_0080745
699 Ga0496102_0016896
700 Ga0496103_0129283
701 Ga0496104_0188843
702 Ga0496105_0668315
703 Ga0496106_0016729
704 Ga0496106_0163704
705 Ga0496107_0022225
706 Ga0496108_0034224
707 Ga0496109_0014965
708 Ga0496110_0027733
709 Ga0496110_0081182
710 Ga0496110_0814944
711 Ga0496111_1137453
712 Ga0496112_0544632
713 Ga0496113_0055756
714 Ga0496115_0010545
715 Ga0496115_0360706
716 Ga0496118_0059867
717 Ga0496119_0001220
718 Ga0496119_0050635
719 Ga0496121_0214973
720 Ga0496121_0542394
721 Ga0496124_0000063
722 Ga0496126_0123572
723 Ga0496126_0137703
724 Ga0501031_0014546
725 Ga0501032_0000228
726 Ga0501033_0000256
727 Ga0501034_0000175
728 Ga0501036_0000032
729 Ga0501037_0000126
730 Ga0501038_0000114
731 Ga0501039_0002583
732 Ga0501043_0002516
733 Ga0501046_0001309
734 Ga0501047_0005183
735 Ga0501048_0009797
736 Ga0501067_0000096
737 Ga0501068_0001140
738 Ga0501069_0003223
739 Ga0501070_0010692
740 Ga0501071_0101519
741 Ga0501072_0001280
742 Ga0501073_0006779
743 Ga0501074_0002945
744 Ga0501080_0007028
745 Ga0501083_0005587
746 Ga0501035_0003496
747 Ga0501044_0000061
748 Ga0501045_0154481
749 nmdc:mga03n38_320811_c1
750 nmdc:mga06z11_169147_c1
751 nmdc:mga07m45_512500_c1
752 Ga0495601_0074435
753 Ga0495601_0307171
754 Ga0495612_0008315
755 Ga0495612_0600848
756 Ga0500635_0021080
757 Ga0495595_0001012
758 Ga0495595_0040207
759 Ga0495619_0000182
760 Ga0495619_0021826
761 Ga0495619_0106998
762 Ga0500651_0153223
763 Ga0500566_0000287
764 Ga0500640_041327
765 Ga0500641_0093703
766 Ga0500556_0000080
767 Ga0500556_0000126
768 Ga0500572_000393
769 Ga0500572_003608
770 Ga0500591_097951
771 Ga0500595_004861
772 Ga0500595_036235
773 Ga0500608_027331
774 Ga0500608_260189
775 Ga0500614_000404
776 Ga0500559_0002584
777 Ga0500559_0330889
778 Ga0500603_000603
779 Ga0500616_0030910
780 Ga0500622_0003192
781 Ga0500630_000052
782 Ga0500638_061497
783 Ga0500639_000123
784 Ga0500636_0020829
785 Ga0500636_0096364
786 Ga0500636_0101467
787 Ga0500601_001214
788 Ga0501084_0002689
789 Ga0501084_1660559
790 Ga0500661_104927
791 Ga0501082_0022061
792 2513672292
793 2513889211
794 2524466904
795 2644218014
796 2644288326
797 2728753215
798 2793077252
799 2876817354
800 2879115639
801 2889040597
802 2903772740
803 2904696565
804 2908760419
805 3005479564
806 8006988125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

24

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.8281 56 85
6q2z-assembly1.cif.gz_B nmr solution structure of the hvo_2922 protein from haloferax volcanii 0.7737 55 87
5y42-assembly2.cif.gz_E native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina 0.752 55 89
4hr6-assembly1.cif.gz_B crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips 0.7503 55 88
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7223 1 131
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7525 1 111 3.90.1590.10
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7503 55 88 3.40.420.10
af_A0A1D8PM79_595_670_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7478 57 87 3.30.160.20
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7051 1 112 2.170.150.70
af_C7IYE5_70_121_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.703 56 89 3.30.160.60
ID Description Score Start End GO Terms
AF-A0A1Z7ZI66-F1-model_v4 CENP-V/GFA domain-containing protein 0.9064 1 113 GO:0016846
GO:0046872
AF-A0A7W6PCA3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9059 1 130 GO:0016846
GO:0046872
AF-A0A024S588-F1-model_v4 CENP-V/GFA domain-containing protein 0.8992 3 112 GO:0016846
GO:0046872
AF-A0A7W5UHA0-F1-model_v4 CENP-V/GFA domain-containing protein 0.8974 1 106 GO:0016846
GO:0046872
AF-A0A2T7VBH0-F1-model_v4 deleted 0.8972 1 133

Map