F435381

General Info

Members Datasets Scaffolds Average Seq Length
403 205 806 217

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10087928|Ga0105237_100879281
Length 255
Sequence MFYPNGIKQPSFNAFRQIAVHLNRSEINSRKPYFCALIILVGKDKIRRFAEIATFSNVLQLDAGKPFKGQWAGAFFKNNNPVVLELACGKGEYTVNLAVMFPDKNFIGIDYKGNRIWRGAKTALEDGVANVAFLRIQIETLIEYFGPGEVDEIWITFPDPQPQLSREKKRLTSSRFLNMYKVILKPGGFVNLKTDNDDLHAYTADKIAETGLTLHAKTEDVYKSEYADDVLNIKTYYEKKYLKDNKNINYLKFSF

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
72 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
172 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
173 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
177 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
178 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
179 2738541302 Pedobacter sp. CF074 Isolate Unclassified
180 2739367651 Pedobacter sp. OK291 Isolate Unclassified
181 2739367663 Pedobacter sp. YR510 Isolate Unclassified
182 2818991437 Pedobacter terrae 518 Isolate Unclassified
183 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
184 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
185 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
186 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
187 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
188 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
189 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
190 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
191 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
192 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
193 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
194 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
195 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
196 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
197 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
198 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
199 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
200 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
201 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
202 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
203 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
204 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
205 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 0.25
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10087928 3300009545 Bacteria 3097
2 SwRhRL2b_contig_78349 2162886007 Bacteria 911
3 JGI24736J21556_1003296 3300001904 Bacteria 2809
4 JGI24740J21852_10006644 3300001979 Bacteria 4767
5 JGI24737J22298_10000056 3300001990 Bacteria 33642
6 JGI24737J22298_10025622 3300001990 Bacteria 1864
7 JGI24735J21928_10000011 3300002067 Bacteria 217841
8 JGI24735J21928_10035654 3300002067 Bacteria 1461
9 JGI24744J21845_10002991 3300002077 Bacteria 3465
10 JGI25162J39368_1000097 3300002737 Bacteria 96520
11 JGI25162J39368_1000818 3300002737 Bacteria 20543
12 JGI25157J39369_1006902 3300002741 Bacteria 1685
13 JGI25164J39214_1003544 3300002772 Bacteria 1957
14 JGI25165J46597_1001052 3300003214 Bacteria 17883
15 rootH1_10004367 3300003316 Bacteria 10924
16 rootH2_10003269 3300003320 Bacteria 51191
17 rootH2_10050402 3300003320 Bacteria 4731
18 rootL2_10139661 3300003322 Bacteria 5040
19 rootH1_10021521 3300003323 Bacteria 7424
20 rootH1_10039800 3300003323 Bacteria 1453
21 rootH1_10048874 3300003323 Bacteria 1163
22 rootH1_10086518 3300003323 Bacteria 5468
23 Ga0055536_1000002 3300003781 Bacteria 605605
24 Ga0055530_10006159 3300003791 Bacteria 5443
25 Ga0065714_10085808 3300005288 Bacteria 2131
26 Ga0065704_10002103 3300005289 Bacteria 8829
27 Ga0065704_10174714 3300005289 Bacteria 1271
28 Ga0070658_10000059 3300005327 Bacteria 112781
29 Ga0070658_10167705 3300005327 Bacteria 1844
30 Ga0070658_10173894 3300005327 Bacteria 1810
31 Ga0070658_10739388 3300005327 Unclassified 854
32 Ga0070676_10000106 3300005328 Bacteria 30173
33 Ga0070683_100008610 3300005329 Bacteria 8671
34 Ga0070680_100003849 3300005336 Bacteria 11216
35 Ga0068868_100061803 3300005338 Bacteria 2967
36 Ga0070660_100027667 3300005339 Bacteria 4234
37 Ga0070691_10027615 3300005341 Bacteria 2649
38 Ga0070673_100001457 3300005364 Bacteria 13846
39 Ga0070659_100000440 3300005366 Bacteria 31084
40 Ga0070659_100017160 3300005366 Bacteria 5442
41 Ga0070659_100034777 3300005366 Bacteria 3921
42 Ga0070663_100006389 3300005455 Bacteria 7084
43 Ga0070678_100001020 3300005456 Bacteria 14590
44 Ga0070662_100000057 3300005457 Bacteria 60160
45 Ga0070681_10006021 3300005458 Bacteria 11752
46 Ga0068867_100024079 3300005459 Bacteria 4363
47 Ga0070685_10117210 3300005466 Bacteria 1649
48 Ga0070679_100011061 3300005530 Bacteria 8584
49 Ga0070679_100045389 3300005530 Bacteria 4379
50 Ga0070679_100191160 3300005530 Bacteria 2016
51 Ga0070684_100346846 3300005535 Bacteria 1365
52 Ga0068853_100011618 3300005539 Bacteria 7157
53 Ga0068853_100126442 3300005539 Bacteria 2284
54 Ga0068853_100375129 3300005539 Bacteria 1327
55 Ga0070665_100000017 3300005548 Bacteria 448013
56 Ga0068855_100000060 3300005563 Bacteria 133838
57 Ga0068855_100000071 3300005563 Bacteria 122638
58 Ga0068855_100042312 3300005563 Bacteria 5398
59 Ga0068855_100069349 3300005563 Bacteria 4103
60 Ga0068855_100094942 3300005563 Bacteria 3438
61 Ga0068855_100139139 3300005563 Bacteria 2769
62 Ga0068857_100349481 3300005577 Bacteria 1369
63 Ga0068856_100002123 3300005614 Bacteria 20569
64 Ga0068856_100052902 3300005614 Bacteria 4005
65 Ga0068856_100094719 3300005614 Bacteria 2973
66 Ga0068856_100402592 3300005614 Bacteria 1388
67 Ga0068856_100701742 3300005614 Bacteria 1032
68 Ga0068852_100002456 3300005616 Bacteria 12766
69 Ga0068852_100011061 3300005616 Bacteria 6775
70 Ga0068852_100311938 3300005616 Bacteria 1525
71 Ga0068852_100457998 3300005616 Bacteria 1264
72 Ga0068866_10083888 3300005718 Bacteria 1718
73 Ga0068858_100075544 3300005842 Bacteria 3130
74 Ga0075366_10000507 3300006195 Bacteria 17971
75 Ga0075366_10023126 3300006195 Bacteria 3620
76 Ga0097621_100000994 3300006237 Bacteria 19912
77 Ga0068871_100003444 3300006358 Bacteria 10876
78 Ga0068865_100000810 3300006881 Bacteria 17586
79 Ga0105244_10012227 3300009036 Bacteria 5087
80 Ga0105240_10000083 3300009093 Bacteria 192934
81 Ga0105240_10019222 3300009093 Bacteria 9132
82 Ga0105240_10036572 3300009093 Bacteria 6313
83 Ga0105240_10155822 3300009093 Bacteria 2717
84 Ga0105240_10184753 3300009093 Unclassified 2456
85 Ga0105240_10199474 3300009093 Bacteria 2346
86 Ga0105240_10236810 3300009093 Bacteria 2118
87 Ga0105240_10709007 3300009093 Bacteria 1098
88 Ga0105240_11575953 3300009093 Bacteria 687
89 Ga0105243_10000003 3300009148 Bacteria 712931
90 Ga0105241_10004634 3300009174 Bacteria 10168
91 Ga0105241_10009121 3300009174 Bacteria 7302
92 Ga0105241_10033522 3300009174 Bacteria 3855
93 Ga0105241_10113641 3300009174 Bacteria 2171
94 Ga0105241_10293422 3300009174 Bacteria 1393
95 Ga0105242_10017354 3300009176 Bacteria 5607
96 Ga0105237_10003635 3300009545 Bacteria 18193
97 Ga0105237_10003965 3300009545 Bacteria 17322
98 Ga0105237_10004489 3300009545 Bacteria 16126
99 Ga0105237_10004990 3300009545 Bacteria 15125
100 Ga0105237_10127040 3300009545 Bacteria 2544
101 Ga0105237_10150130 3300009545 Bacteria 2326
102 Ga0105237_10280869 3300009545 Bacteria 1667
103 Ga0105237_10535724 3300009545 Bacteria 1178
104 Ga0105238_10004801 3300009551 Bacteria 13376
105 Ga0105238_10104848 3300009551 Bacteria 2808
106 Ga0105238_10468827 3300009551 Bacteria 1258
107 Ga0105249_10068007 3300009553 Bacteria 3284
108 Ga0105239_10000026 3300010375 Bacteria 248302
109 Ga0105239_10000522 3300010375 Bacteria 55530
110 Ga0105239_10000708 3300010375 Bacteria 47248
111 Ga0105239_10000821 3300010375 Bacteria 44186
112 Ga0105239_10006547 3300010375 Bacteria 13495
113 Ga0105239_10063439 3300010375 Bacteria 4057
114 Ga0105239_10102342 3300010375 Bacteria 3170
115 Ga0105239_10157720 3300010375 Bacteria 2535
116 Ga0105246_10036080 3300011119 Bacteria 3309
117 Ga0157373_10000140 3300013100 Bacteria 57694
118 Ga0157373_10011122 3300013100 Bacteria 6623
119 Ga0157373_10033655 3300013100 Bacteria 3685
120 Ga0157373_10294760 3300013100 Bacteria 1151
121 Ga0157371_10000025 3300013102 Bacteria 279746
122 Ga0157371_10006008 3300013102 Bacteria 10115
123 Ga0157371_10012944 3300013102 Bacteria 6352
124 Ga0157370_10001039 3300013104 Bacteria 34915
125 Ga0157370_10004060 3300013104 Bacteria 16973
126 Ga0157370_10014147 3300013104 Bacteria 8181
127 Ga0157370_10082639 3300013104 Bacteria 3021
128 Ga0157370_10149518 3300013104 Bacteria 2174
129 Ga0157370_10169212 3300013104 Unclassified 2032
130 Ga0157370_10258376 3300013104 Bacteria 1610
131 Ga0157370_10319793 3300013104 Bacteria 1431
132 Ga0157369_10000038 3300013105 Bacteria 189078
133 Ga0157369_10000952 3300013105 Bacteria 36747
134 Ga0157369_10027003 3300013105 Bacteria 6366
135 Ga0157369_10087331 3300013105 Bacteria 3330
136 Ga0157369_10097101 3300013105 Bacteria 3143
137 Ga0157369_10188234 3300013105 Bacteria 2169
138 Ga0157374_10002202 3300013296 Bacteria 16438
139 Ga0157374_10004753 3300013296 Bacteria 11390
140 Ga0157374_10119190 3300013296 Bacteria 2545
141 Ga0157374_10120343 3300013296 Bacteria 2533
142 Ga0157374_10784610 3300013296 Bacteria 968
143 Ga0157374_10899302 3300013296 Bacteria 903
144 Ga0157378_10008753 3300013297 Bacteria 8812
145 Ga0157378_10086490 3300013297 Bacteria 2842
146 Ga0163162_10000026 3300013306 Bacteria 178701
147 Ga0163162_10000050 3300013306 Bacteria 120151
148 Ga0163162_10016834 3300013306 Bacteria 7147
149 Ga0163162_10019343 3300013306 Bacteria 6678
150 Ga0163162_10498881 3300013306 Bacteria 1348
151 Ga0163162_10500907 3300013306 Bacteria 1345
152 Ga0157372_10000077 3300013307 Bacteria 102192
153 Ga0157372_10000870 3300013307 Bacteria 32811
154 Ga0157372_10002434 3300013307 Bacteria 20158
155 Ga0157372_10028253 3300013307 Bacteria 6121
156 Ga0157372_10303177 3300013307 Bacteria 1858
157 Ga0157372_10436187 3300013307 Bacteria 1527
158 Ga0157375_10021287 3300013308 Bacteria 5942
159 Ga0157375_10135001 3300013308 Bacteria 2590
160 Ga0157375_10763576 3300013308 Bacteria 1117
161 Ga0182008_10000052 3300014497 Bacteria 103193
162 Ga0157377_10019190 3300014745 Bacteria 3570
163 Ga0157377_10258888 3300014745 Bacteria 1131
164 Ga0182006_1000127 3300015261 Bacteria 81679
165 Ga0182006_1000645 3300015261 Bacteria 24732
166 Ga0182007_10000024 3300015262 Bacteria 181761
167 Ga0183373_1002 3300015682 Bacteria 990153
168 Ga0183368_1066 3300015687 Bacteria 795
169 Ga0163161_10001289 3300017792 Bacteria 18683
170 Ga0163161_10002479 3300017792 Bacteria 13157
171 Ga0163161_10132150 3300017792 Bacteria 1884
172 Ga0207427_100060 3300025231 Bacteria 186274
173 Ga0209437_100021 3300025233 Bacteria 646400
174 Ga0209437_100030 3300025233 Bacteria 532466
175 Ga0209026_1000239 3300025250 Bacteria 71740
176 Ga0209026_1000787 3300025250 Bacteria 17422
177 Ga0209026_1005416 3300025250 Bacteria 3442
178 Ga0209233_1000035 3300025261 Bacteria 568478
179 Ga0209233_1001683 3300025261 Bacteria 8587
180 Ga0209676_1000022 3300025292 Bacteria 605659
181 Ga0209050_1000020 3300025298 Bacteria 605671
182 Ga0207655_1036503 3300025728 Bacteria 2177
183 Ga0207647_10000012 3300025904 Bacteria 152879
184 Ga0207647_10000877 3300025904 Bacteria 23342
185 Ga0207647_10033765 3300025904 Bacteria 3272
186 Ga0207645_10000347 3300025907 Bacteria 38694
187 Ga0207705_10000216 3300025909 Bacteria 57377
188 Ga0207705_10374279 3300025909 Bacteria 1100
189 Ga0207654_10002932 3300025911 Bacteria 8651
190 Ga0207654_10012860 3300025911 Bacteria 4295
191 Ga0207654_10126294 3300025911 Bacteria 1613
192 Ga0207654_10158487 3300025911 Bacteria 1460
193 Ga0207707_10008874 3300025912 Bacteria 8731
194 Ga0207695_10000127 3300025913 Bacteria 227338
195 Ga0207695_10007509 3300025913 Bacteria 13834
196 Ga0207695_10009583 3300025913 Bacteria 11962
197 Ga0207695_10018279 3300025913 Bacteria 8111
198 Ga0207695_10072337 3300025913 Bacteria 3518
199 Ga0207695_10237877 3300025913 Bacteria 1723
200 Ga0207695_10457902 3300025913 Bacteria 1159
201 Ga0207695_10613747 3300025913 Bacteria 969
202 Ga0207695_10731306 3300025913 Bacteria 870
203 Ga0207671_10001459 3300025914 Bacteria 27307
204 Ga0207671_10003385 3300025914 Bacteria 15963
205 Ga0207671_10004562 3300025914 Bacteria 13160
206 Ga0207671_10005084 3300025914 Bacteria 12282
207 Ga0207671_10012938 3300025914 Bacteria 6679
208 Ga0207671_10091299 3300025914 Bacteria 2295
209 Ga0207671_10284264 3300025914 Bacteria 1305
210 Ga0207671_10375550 3300025914 Bacteria 1129
211 Ga0207657_10047967 3300025919 Bacteria 3730
212 Ga0207652_10390662 3300025921 Bacteria 1256
213 Ga0207694_10017408 3300025924 Bacteria 5432
214 Ga0207694_10232444 3300025924 Bacteria 1506
215 Ga0207644_10032676 3300025931 Bacteria 3632
216 Ga0207690_10000235 3300025932 Bacteria 40691
217 Ga0207690_10015849 3300025932 Bacteria 4575
218 Ga0207690_10065986 3300025932 Bacteria 2477
219 Ga0207706_10000092 3300025933 Bacteria 93227
220 Ga0207686_10213114 3300025934 Bacteria 1390
221 Ga0207709_10000008 3300025935 Bacteria 713099
222 Ga0207709_10038814 3300025935 Bacteria 2839
223 Ga0207704_10000043 3300025938 Bacteria 88714
224 Ga0207661_10007736 3300025944 Bacteria 7651
225 Ga0207667_10000033 3300025949 Bacteria 314353
226 Ga0207667_10000964 3300025949 Bacteria 36656
227 Ga0207667_10065559 3300025949 Bacteria 3787
228 Ga0207667_10087677 3300025949 Bacteria 3219
229 Ga0207667_10123298 3300025949 Bacteria 2670
230 Ga0207667_10151158 3300025949 Bacteria 2390
231 Ga0207667_10377064 3300025949 Bacteria 1445
232 Ga0207651_10061900 3300025960 Bacteria 2605
233 Ga0207677_10011989 3300026023 Bacteria 4966
234 Ga0207703_10023399 3300026035 Bacteria 4852
235 Ga0207639_10011485 3300026041 Bacteria 6153
236 Ga0207639_10062697 3300026041 Bacteria 2876
237 Ga0207639_10515519 3300026041 Bacteria 1094
238 Ga0207639_10875294 3300026041 Bacteria 839
239 Ga0207678_10249139 3300026067 Bacteria 1521
240 Ga0207702_10000042 3300026078 Bacteria 150673
241 Ga0207702_10017227 3300026078 Bacteria 5978
242 Ga0207702_10018280 3300026078 Bacteria 5800
243 Ga0207702_10717425 3300026078 Bacteria 986
244 Ga0207648_10000423 3300026089 Bacteria 46491
245 Ga0207683_10002796 3300026121 Bacteria 15239
246 Ga0207698_10011102 3300026142 Bacteria 5823
247 Ga0207698_10032617 3300026142 Bacteria 3776
248 Ga0207698_10071108 3300026142 Bacteria 2760
249 Ga0207698_10491969 3300026142 Bacteria 1192
250 Ga0207698_10695955 3300026142 Bacteria 1011
251 Ga0268266_10000037 3300028379 Bacteria 342368
252 Ga0307517_10009500 3300028786 Bacteria 13775
253 Ga0307515_10000427 3300028794 Bacteria 101325
254 Ga0307515_10001574 3300028794 Bacteria 50970
255 Ga0307515_10112594 3300028794 Bacteria 3164
256 Ga0316176_1029716 3300030732 Bacteria 6882
257 Ga0316183_1126062 3300030742 Bacteria 44101
258 Ga0316181_1121975 3300030744 Bacteria 30956
259 Ga0265327_10056161 3300031251 Bacteria 2030
260 Ga0307408_100000332 3300031548 Bacteria 45065
261 Ga0307408_100000341 3300031548 Bacteria 43952
262 Ga0307408_100006215 3300031548 Bacteria 7932
263 Ga0307405_10000011 3300031731 Bacteria 241071
264 Ga0307405_10030133 3300031731 Bacteria 3179
265 Ga0307407_10000018 3300031903 Bacteria 135979
266 Ga0307412_10001562 3300031911 Bacteria 12620
267 Ga0307412_10015169 3300031911 Bacteria 4559
268 Ga0307412_10163167 3300031911 Bacteria 1658
269 Ga0307409_100023896 3300031995 Bacteria 4247
270 Ga0307409_100147985 3300031995 Bacteria 2034
271 Ga0307416_100001355 3300032002 Bacteria 13215
272 Ga0307416_100154009 3300032002 Bacteria 2113
273 Ga0307414_10000823 3300032004 Bacteria 15850
274 Ga0307414_10029605 3300032004 Bacteria 3565
275 Ga0307414_10066156 3300032004 Bacteria 2582
276 Ga0307414_10212678 3300032004 Bacteria 1582
277 Ga0307414_10665801 3300032004 Unclassified 939
278 Ga0307414_10950700 3300032004 Bacteria 789
279 Ga0307411_10567051 3300032005 Bacteria 971
280 Ga0307415_100471418 3300032126 Bacteria 1091
281 Ga0307507_10000510 3300033179 Bacteria 81853
282 Ga0307510_10000219 3300033180 Bacteria 50940
283 Ga0395899_0000017 3300037312 Bacteria 440179
284 Ga0395899_0000257 3300037312 Bacteria 69779
285 Ga0395899_0001310 3300037312 Bacteria 21436
286 Ga0395900_0000507 3300037418 Bacteria 54887
287 Ga0395900_0001010 3300037418 Bacteria 36362
288 Ga0395900_0002104 3300037418 Bacteria 22298
289 Ga0395898_0057901 3300037466 Unclassified 3774
290 Ga0395898_0069141 3300037466 Bacteria 3417
291 Ga0395905_0000669 3300037471 Bacteria 45547
292 Ga0395905_0004119 3300037471 Bacteria 15230
293 Ga0395901_0004148 3300038443 Bacteria 14621
294 Ga0395901_0032997 3300038443 Bacteria 5342
295 Ga0395901_0159230 3300038443 Bacteria 2371
296 Ga0466969_0015414 3300044656 Bacteria 4007
297 Ga0453684_0003110 3300044712 Bacteria 38225
298 Ga0453684_0204824 3300044712 Bacteria 2297
299 Ga0453684_0546903 3300044712 Bacteria 1276
300 Ga0495638_0233913 3300046460 Bacteria 1021
301 Ga0495651_0245256 3300046462 Bacteria 1226
302 Ga0495650_0000330 3300046471 Bacteria 84849
303 Ga0495650_0013683 3300046471 Bacteria 4276
304 Ga0495650_0048302 3300046471 Bacteria 1775
305 Ga0495650_0118952 3300046471 Bacteria 974
306 Ga0495650_0128855 3300046471 Bacteria 925
307 Ga0495585_0000280 3300046492 Bacteria 51045
308 Ga0495585_0001130 3300046492 Bacteria 21890
309 Ga0495583_0131847 3300046506 Bacteria 1045
310 Ga0495606_0000531 3300046507 Bacteria 61676
311 Ga0495606_0005446 3300046507 Bacteria 12189
312 Ga0495606_0019153 3300046507 Bacteria 5103
313 Ga0495606_0055664 3300046507 Bacteria 2557
314 Ga0495606_0067259 3300046507 Bacteria 2269
315 Ga0495606_0135281 3300046507 Bacteria 1460
316 Ga0495606_0257094 3300046507 Bacteria 966
317 Ga0495610_0000037 3300046512 Bacteria 186354
318 Ga0495610_0000574 3300046512 Bacteria 36619
319 Ga0495610_0010906 3300046512 Bacteria 5607
320 Ga0495616_0003550 3300046513 Bacteria 9966
321 Ga0495616_0003620 3300046513 Bacteria 9873
322 Ga0495628_0144089 3300046516 Bacteria 1817
323 Ga0495637_0115399 3300046520 Bacteria 1037
324 Ga0495648_0016265 3300046524 Bacteria 5366
325 Ga0495648_0067904 3300046524 Bacteria 2083
326 Ga0495654_0104811 3300046530 Bacteria 1297
327 Ga0495609_0003227 3300046538 Bacteria 9456
328 Ga0495609_0044852 3300046538 Bacteria 1982
329 Ga0495622_0142494 3300046557 Bacteria 1088
330 Ga0495633_0000072 3300046558 Bacteria 131197
331 Ga0495633_0011211 3300046558 Bacteria 4849
332 Ga0495633_0014888 3300046558 Bacteria 4046
333 Ga0495668_0000009 3300046616 Bacteria 492623
334 Ga0495668_0127927 3300046616 Bacteria 1391
335 Ga0495625_0000007 3300046660 Bacteria 565749
336 Ga0495625_0000831 3300046660 Bacteria 42424
337 Ga0495625_0001804 3300046660 Bacteria 24594
338 Ga0495625_0085398 3300046660 Bacteria 2190
339 Ga0495661_0002236 3300046665 Bacteria 15020
340 Ga0495661_0013201 3300046665 Bacteria 5555
341 Ga0495661_0085892 3300046665 Bacteria 1802
342 Ga0495671_0062761 3300046692 Bacteria 1831
343 Ga0495649_0000038 3300046694 Bacteria 128764
344 Ga0495589_0012817 3300046794 Bacteria 4334
345 Ga0495600_0304912 3300046809 Bacteria 1004
346 Ga0495660_0001638 3300046810 Bacteria 15034
347 Ga0495660_0124241 3300046810 Bacteria 1302
348 Ga0495687_001024 3300047443 Bacteria 27852
349 Ga0495687_004490 3300047443 Bacteria 9393
350 Ga0495686_0000490 3300047472 Bacteria 58423
351 Ga0495686_0000783 3300047472 Bacteria 41638
352 Ga0495686_0020548 3300047472 Bacteria 4401
353 Ga0495593_0341969 3300047673 Bacteria 748
354 Ga0495614_0035002 3300048089 Bacteria 2158
355 Ga0496116_0002515 3300048919 Bacteria 19202
356 Ga0496117_0001212 3300048920 Bacteria 38690
357 Ga0496122_0002213 3300048925 Bacteria 28370
358 Ga0496123_0013682 3300048926 Bacteria 6788
359 Ga0496124_0530026 3300048927 Bacteria 782
360 Ga0495678_004679 3300049459 Bacteria 7833
361 Ga0495682_0179652 3300049460 Bacteria 752
362 Ga0501033_0285976 3300049570 Bacteria 1163
363 Ga0501223_000715 3300049663 Bacteria 7908
364 nmdc:mga0k408_1624_c2 3300050493 Bacteria 2914
365 nmdc:mga0k408_296_c1 3300050493 Bacteria 27045
366 Ga0500635_0001990 3300053080 Bacteria 4989
367 Ga0500608_031823 3300053122 Bacteria 2505
368 Ga0500608_033783 3300053122 Bacteria 2435
369 Ga0500618_000057 3300053125 Bacteria 98383
370 Ga0500618_006639 3300053125 Bacteria 3375
371 Ga0500564_050809 3300053138 Bacteria 1897
372 Ga0500622_0001643 3300053156 Bacteria 17499
373 Ga0500634_0035279 3300053161 Bacteria 2725
374 2586207193 2585427687 Bacteria 5544917
375 2599480589 2599185184 Bacteria 6430550
376 2722731011 2721755487 Bacteria 6357185
377 2738852500 2738541302 Bacteria 5944758
378 2739591392 2739367651 Bacteria 6359826
379 2739646114 2739367663 Bacteria 5040914
380 2819549643 2818991437 Bacteria 5805520
381 2842727384 2842722452 Bacteria 6263924
382 2842905444 2842903701 Bacteria 6986368
383 2842913780 2842909656 Bacteria 6185908
384 2849285391 2849281842 Bacteria 6065644
385 2852626210 2852623160 Bacteria 4376875
386 2857631986 2857627736 Bacteria 5625397
387 2884935246 2884933994 Bacteria 4535041
388 2890738426 2890737413 Bacteria 4269751
389 2896320661 2896317667 Bacteria 4606601
390 2896345893 2896344016 Bacteria 3811746
391 2898713893 2898713307 Bacteria 4110805
392 2904447243 2904445276 Bacteria 5310396
393 2904783454 2904780799 Bacteria 5840761
394 2919181320 2919177583 Bacteria 5641607
395 2919439744 2919437846 Bacteria 6199444
396 2928081339 2928078545 Bacteria 6534839
397 2928150488 2928147474 Bacteria 6512076
398 2932085310 2932082852 Bacteria 6563563
399 2945998302 2945997725 Bacteria 6404843
400 2954020760 2954016120 Bacteria 6446024
401 2977235087 2977232053 Bacteria 5485925
402 3003234291 3003233435 Bacteria 4458031
403 8055590089 8055588893 Bacteria 3619545
404 Ga0105237_10087928
405 SwRhRL2b_contig_78349
406 JGI24736J21556_1003296
407 JGI24740J21852_10006644
408 JGI24737J22298_10000056
409 JGI24737J22298_10025622
410 JGI24735J21928_10000011
411 JGI24735J21928_10035654
412 JGI24744J21845_10002991
413 JGI25162J39368_1000097
414 JGI25162J39368_1000818
415 JGI25157J39369_1006902
416 JGI25164J39214_1003544
417 JGI25165J46597_1001052
418 rootH1_10004367
419 rootH2_10003269
420 rootH2_10050402
421 rootL2_10139661
422 rootH1_10021521
423 rootH1_10039800
424 rootH1_10048874
425 rootH1_10086518
426 Ga0055536_1000002
427 Ga0055530_10006159
428 Ga0065714_10085808
429 Ga0065704_10002103
430 Ga0065704_10174714
431 Ga0070658_10000059
432 Ga0070658_10167705
433 Ga0070658_10173894
434 Ga0070658_10739388
435 Ga0070676_10000106
436 Ga0070683_100008610
437 Ga0070680_100003849
438 Ga0068868_100061803
439 Ga0070660_100027667
440 Ga0070691_10027615
441 Ga0070673_100001457
442 Ga0070659_100000440
443 Ga0070659_100017160
444 Ga0070659_100034777
445 Ga0070663_100006389
446 Ga0070678_100001020
447 Ga0070662_100000057
448 Ga0070681_10006021
449 Ga0068867_100024079
450 Ga0070685_10117210
451 Ga0070679_100011061
452 Ga0070679_100045389
453 Ga0070679_100191160
454 Ga0070684_100346846
455 Ga0068853_100011618
456 Ga0068853_100126442
457 Ga0068853_100375129
458 Ga0070665_100000017
459 Ga0068855_100000060
460 Ga0068855_100000071
461 Ga0068855_100042312
462 Ga0068855_100069349
463 Ga0068855_100094942
464 Ga0068855_100139139
465 Ga0068857_100349481
466 Ga0068856_100002123
467 Ga0068856_100052902
468 Ga0068856_100094719
469 Ga0068856_100402592
470 Ga0068856_100701742
471 Ga0068852_100002456
472 Ga0068852_100011061
473 Ga0068852_100311938
474 Ga0068852_100457998
475 Ga0068866_10083888
476 Ga0068858_100075544
477 Ga0075366_10000507
478 Ga0075366_10023126
479 Ga0097621_100000994
480 Ga0068871_100003444
481 Ga0068865_100000810
482 Ga0105244_10012227
483 Ga0105240_10000083
484 Ga0105240_10019222
485 Ga0105240_10036572
486 Ga0105240_10155822
487 Ga0105240_10184753
488 Ga0105240_10199474
489 Ga0105240_10236810
490 Ga0105240_10709007
491 Ga0105240_11575953
492 Ga0105243_10000003
493 Ga0105241_10004634
494 Ga0105241_10009121
495 Ga0105241_10033522
496 Ga0105241_10113641
497 Ga0105241_10293422
498 Ga0105242_10017354
499 Ga0105237_10003635
500 Ga0105237_10003965
501 Ga0105237_10004489
502 Ga0105237_10004990
503 Ga0105237_10127040
504 Ga0105237_10150130
505 Ga0105237_10280869
506 Ga0105237_10535724
507 Ga0105238_10004801
508 Ga0105238_10104848
509 Ga0105238_10468827
510 Ga0105249_10068007
511 Ga0105239_10000026
512 Ga0105239_10000522
513 Ga0105239_10000708
514 Ga0105239_10000821
515 Ga0105239_10006547
516 Ga0105239_10063439
517 Ga0105239_10102342
518 Ga0105239_10157720
519 Ga0105246_10036080
520 Ga0157373_10000140
521 Ga0157373_10011122
522 Ga0157373_10033655
523 Ga0157373_10294760
524 Ga0157371_10000025
525 Ga0157371_10006008
526 Ga0157371_10012944
527 Ga0157370_10001039
528 Ga0157370_10004060
529 Ga0157370_10014147
530 Ga0157370_10082639
531 Ga0157370_10149518
532 Ga0157370_10169212
533 Ga0157370_10258376
534 Ga0157370_10319793
535 Ga0157369_10000038
536 Ga0157369_10000952
537 Ga0157369_10027003
538 Ga0157369_10087331
539 Ga0157369_10097101
540 Ga0157369_10188234
541 Ga0157374_10002202
542 Ga0157374_10004753
543 Ga0157374_10119190
544 Ga0157374_10120343
545 Ga0157374_10784610
546 Ga0157374_10899302
547 Ga0157378_10008753
548 Ga0157378_10086490
549 Ga0163162_10000026
550 Ga0163162_10000050
551 Ga0163162_10016834
552 Ga0163162_10019343
553 Ga0163162_10498881
554 Ga0163162_10500907
555 Ga0157372_10000077
556 Ga0157372_10000870
557 Ga0157372_10002434
558 Ga0157372_10028253
559 Ga0157372_10303177
560 Ga0157372_10436187
561 Ga0157375_10021287
562 Ga0157375_10135001
563 Ga0157375_10763576
564 Ga0182008_10000052
565 Ga0157377_10019190
566 Ga0157377_10258888
567 Ga0182006_1000127
568 Ga0182006_1000645
569 Ga0182007_10000024
570 Ga0183373_1002
571 Ga0183368_1066
572 Ga0163161_10001289
573 Ga0163161_10002479
574 Ga0163161_10132150
575 Ga0207427_100060
576 Ga0209437_100021
577 Ga0209437_100030
578 Ga0209026_1000239
579 Ga0209026_1000787
580 Ga0209026_1005416
581 Ga0209233_1000035
582 Ga0209233_1001683
583 Ga0209676_1000022
584 Ga0209050_1000020
585 Ga0207655_1036503
586 Ga0207647_10000012
587 Ga0207647_10000877
588 Ga0207647_10033765
589 Ga0207645_10000347
590 Ga0207705_10000216
591 Ga0207705_10374279
592 Ga0207654_10002932
593 Ga0207654_10012860
594 Ga0207654_10126294
595 Ga0207654_10158487
596 Ga0207707_10008874
597 Ga0207695_10000127
598 Ga0207695_10007509
599 Ga0207695_10009583
600 Ga0207695_10018279
601 Ga0207695_10072337
602 Ga0207695_10237877
603 Ga0207695_10457902
604 Ga0207695_10613747
605 Ga0207695_10731306
606 Ga0207671_10001459
607 Ga0207671_10003385
608 Ga0207671_10004562
609 Ga0207671_10005084
610 Ga0207671_10012938
611 Ga0207671_10091299
612 Ga0207671_10284264
613 Ga0207671_10375550
614 Ga0207657_10047967
615 Ga0207652_10390662
616 Ga0207694_10017408
617 Ga0207694_10232444
618 Ga0207644_10032676
619 Ga0207690_10000235
620 Ga0207690_10015849
621 Ga0207690_10065986
622 Ga0207706_10000092
623 Ga0207686_10213114
624 Ga0207709_10000008
625 Ga0207709_10038814
626 Ga0207704_10000043
627 Ga0207661_10007736
628 Ga0207667_10000033
629 Ga0207667_10000964
630 Ga0207667_10065559
631 Ga0207667_10087677
632 Ga0207667_10123298
633 Ga0207667_10151158
634 Ga0207667_10377064
635 Ga0207651_10061900
636 Ga0207677_10011989
637 Ga0207703_10023399
638 Ga0207639_10011485
639 Ga0207639_10062697
640 Ga0207639_10515519
641 Ga0207639_10875294
642 Ga0207678_10249139
643 Ga0207702_10000042
644 Ga0207702_10017227
645 Ga0207702_10018280
646 Ga0207702_10717425
647 Ga0207648_10000423
648 Ga0207683_10002796
649 Ga0207698_10011102
650 Ga0207698_10032617
651 Ga0207698_10071108
652 Ga0207698_10491969
653 Ga0207698_10695955
654 Ga0268266_10000037
655 Ga0307517_10009500
656 Ga0307515_10000427
657 Ga0307515_10001574
658 Ga0307515_10112594
659 Ga0316176_1029716
660 Ga0316183_1126062
661 Ga0316181_1121975
662 Ga0265327_10056161
663 Ga0307408_100000332
664 Ga0307408_100000341
665 Ga0307408_100006215
666 Ga0307405_10000011
667 Ga0307405_10030133
668 Ga0307407_10000018
669 Ga0307412_10001562
670 Ga0307412_10015169
671 Ga0307412_10163167
672 Ga0307409_100023896
673 Ga0307409_100147985
674 Ga0307416_100001355
675 Ga0307416_100154009
676 Ga0307414_10000823
677 Ga0307414_10029605
678 Ga0307414_10066156
679 Ga0307414_10212678
680 Ga0307414_10665801
681 Ga0307414_10950700
682 Ga0307411_10567051
683 Ga0307415_100471418
684 Ga0307507_10000510
685 Ga0307510_10000219
686 Ga0395899_0000017
687 Ga0395899_0000257
688 Ga0395899_0001310
689 Ga0395900_0000507
690 Ga0395900_0001010
691 Ga0395900_0002104
692 Ga0395898_0057901
693 Ga0395898_0069141
694 Ga0395905_0000669
695 Ga0395905_0004119
696 Ga0395901_0004148
697 Ga0395901_0032997
698 Ga0395901_0159230
699 Ga0466969_0015414
700 Ga0453684_0003110
701 Ga0453684_0204824
702 Ga0453684_0546903
703 Ga0495638_0233913
704 Ga0495651_0245256
705 Ga0495650_0000330
706 Ga0495650_0013683
707 Ga0495650_0048302
708 Ga0495650_0118952
709 Ga0495650_0128855
710 Ga0495585_0000280
711 Ga0495585_0001130
712 Ga0495583_0131847
713 Ga0495606_0000531
714 Ga0495606_0005446
715 Ga0495606_0019153
716 Ga0495606_0055664
717 Ga0495606_0067259
718 Ga0495606_0135281
719 Ga0495606_0257094
720 Ga0495610_0000037
721 Ga0495610_0000574
722 Ga0495610_0010906
723 Ga0495616_0003550
724 Ga0495616_0003620
725 Ga0495628_0144089
726 Ga0495637_0115399
727 Ga0495648_0016265
728 Ga0495648_0067904
729 Ga0495654_0104811
730 Ga0495609_0003227
731 Ga0495609_0044852
732 Ga0495622_0142494
733 Ga0495633_0000072
734 Ga0495633_0011211
735 Ga0495633_0014888
736 Ga0495668_0000009
737 Ga0495668_0127927
738 Ga0495625_0000007
739 Ga0495625_0000831
740 Ga0495625_0001804
741 Ga0495625_0085398
742 Ga0495661_0002236
743 Ga0495661_0013201
744 Ga0495661_0085892
745 Ga0495671_0062761
746 Ga0495649_0000038
747 Ga0495589_0012817
748 Ga0495600_0304912
749 Ga0495660_0001638
750 Ga0495660_0124241
751 Ga0495687_001024
752 Ga0495687_004490
753 Ga0495686_0000490
754 Ga0495686_0000783
755 Ga0495686_0020548
756 Ga0495593_0341969
757 Ga0495614_0035002
758 Ga0496116_0002515
759 Ga0496117_0001212
760 Ga0496122_0002213
761 Ga0496123_0013682
762 Ga0496124_0530026
763 Ga0495678_004679
764 Ga0495682_0179652
765 Ga0501033_0285976
766 Ga0501223_000715
767 nmdc:mga0k408_1624_c2
768 nmdc:mga0k408_296_c1
769 Ga0500635_0001990
770 Ga0500608_031823
771 Ga0500608_033783
772 Ga0500618_000057
773 Ga0500618_006639
774 Ga0500564_050809
775 Ga0500622_0001643
776 Ga0500634_0035279
777 2586207193
778 2599480589
779 2722731011
780 2738852500
781 2739591392
782 2739646114
783 2819549643
784 2842727384
785 2842905444
786 2842913780
787 2849285391
788 2852626210
789 2857631986
790 2884935246
791 2890738426
792 2896320661
793 2896345893
794 2898713893
795 2904447243
796 2904783454
797 2919181320
798 2919439744
799 2928081339
800 2928150488
801 2932085310
802 2945998302
803 2954020760
804 2977235087
805 3003234291
806 8055590089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

79

251

0.93

PF13649

Methyltransf_25

Methyltransferase domain

83

188

0.84

PF13847

Methyltransf_31

Methyltransferase domain

77

238

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.9073 9 215
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.9028 7 216
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.8989 9 215
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.882 7 216
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8427 18 217
ID Description Score Start End Superfamily
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9043 9 215 3.40.50.150
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8959 9 215 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8841 41 116 3.40.50.150
af_Q9VDC8_53_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8458 38 152 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8434 36 214 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A520BI54-F1-model_v4 Methyltransferase domain-containing protein 0.9915 1 110 GO:0008176
GO:0043527
AF-A0A520BI54-F1-model_v4 Methyltransferase domain-containing protein 0.9827 1 110 GO:0008176
GO:0043527
AF-A0A3N7HXB8-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9767 1 216 GO:0008176
GO:0043527
AF-A0A520AUB9-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.976 1 216 GO:0008176
GO:0043527
AF-R9GQF9-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9759 1 216 GO:0008176
GO:0043527

Map