F435388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 403 | 247 | 807 | 510 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10000642|Ga0157372_1000064214 |
| Length | 555 |
| Sequence | LELILACPANLLKNAELVTVFSKQTRRFKMCARAMRCTAQFCIFARMQETILILDFGSQYTQLIARRVRELNVYCEIHPFNKIPEITGNIKGVILSGSPFSVRASDAPNPDLSAFKNKLPLLGVCYGAQLMAHKFGGEVQKSEHREYGRANLSFVKADNELFKGVSNNSQVWMSHADTITKIPDNYEIISSTKDVKFAGYQVKGEQTYGIQFHPEVYHSTEGAVLLKNFVVEICGCRQDWTPDSFVETTVKELQQKIGNDKVVLGLSGGVDSSVAAVLLHKAIGKNLYCIFVDNGLLRKNEFETVLDSYKHMGLNVKGVNAKDRFYAELAGVSDPEKKRKAIGKVFIDVFDDESKRIEDVKWLGQGTIYPDVIESVSVKGPSATIKSHHNVGGLPDFMKLKIVEPLNTLFKDEVRRVGKTLQIDDAILGRHPFPGPGLAIRILGDITAEKVRILQEVDSIFIDNLKSADLYKDVWQAGAIFLPVQSVGVMGDERTYENAVALRAVTSTDGMTADWCHLPYEFLGKVSNEIINKVKGINRVVYDISSKPPATIEWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 114 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 127 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 128 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 160 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 175 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 176 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 178 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 182 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 183 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 185 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 186 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 187 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 188 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 191 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 192 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 193 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 194 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 195 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 196 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 197 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 198 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 199 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 200 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 201 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 202 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 203 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 204 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 205 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 206 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 207 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 208 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 209 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 210 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 211 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 212 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 213 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 214 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 215 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 216 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 217 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 218 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 219 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 220 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 221 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 222 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 223 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 224 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 225 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 226 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 227 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 228 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 229 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 230 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 231 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 232 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 233 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 234 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 235 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 236 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 237 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 238 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 239 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 240 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 241 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 242 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 243 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 244 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 245 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 246 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
| 247 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.6 |
| Metatranscriptomes | 0.5 |
| Isolates | 12.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.65 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 71.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10000642 | 3300013307 | Bacteria | 38382 |
| 2 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 3 | SwRhRL2b_contig_1785592 | 2162886007 | Bacteria | 28394 |
| 4 | SwRhRL2b_contig_2693654 | 2162886007 | Bacteria | 123938 |
| 5 | SwRhRL2b_contig_38688 | 2162886007 | Bacteria | 22286 |
| 6 | JGI24740J21852_10000503 | 3300001979 | Bacteria | 16803 |
| 7 | JGI24737J22298_10002164 | 3300001990 | Bacteria | 7008 |
| 8 | JGI24737J22298_10006779 | 3300001990 | Bacteria | 3890 |
| 9 | JGI24735J21928_10000038 | 3300002067 | Bacteria | 64134 |
| 10 | JGI25162J39368_1000047 | 3300002737 | Viruses | 167507 |
| 11 | JGI25162J39368_1000940 | 3300002737 | Bacteria | 18700 |
| 12 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 13 | JGI25152J39213_1000195 | 3300002773 | Bacteria | 40804 |
| 14 | JGI25150J39212_1000014 | 3300002774 | Bacteria | 170955 |
| 15 | JGI25151J46595_10000042 | 3300003187 | Bacteria | 170955 |
| 16 | JGI25165J46597_1001356 | 3300003214 | Bacteria | 13638 |
| 17 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 18 | rootH1_10022825 | 3300003316 | Bacteria | 10594 |
| 19 | rootH2_10002048 | 3300003320 | Bacteria | 70313 |
| 20 | rootH2_10013605 | 3300003320 | Bacteria | 52813 |
| 21 | rootL2_10012658 | 3300003322 | Bacteria | 11372 |
| 22 | rootL2_10012659 | 3300003322 | Bacteria | 3258 |
| 23 | rootH1_10003426 | 3300003323 | Bacteria | 42703 |
| 24 | rootH1_10004301 | 3300003316 | Bacteria | 2946 |
| 25 | rootH1_10004301 | 3300003323 | Bacteria | 21275 |
| 26 | rootH1_10050816 | 3300003323 | Bacteria | 5399 |
| 27 | rootH1_10210593 | 3300003323 | Bacteria | 6674 |
| 28 | JGI25160J50197_1004415 | 3300003354 | Bacteria | 6095 |
| 29 | JGI25160J50197_1004554 | 3300003354 | Bacteria | 5971 |
| 30 | Ga0055536_1000019 | 3300003781 | Bacteria | 203087 |
| 31 | Ga0055530_10001246 | 3300003791 | Bacteria | 19383 |
| 32 | Ga0055531_10000171 | 3300003794 | Bacteria | 73046 |
| 33 | Ga0058863_11968118 | 3300004799 | Bacteria | 4912 |
| 34 | Ga0058862_12403007 | 3300004803 | Bacteria | 2888 |
| 35 | Ga0065165_1000060 | 3300005262 | Bacteria | 180226 |
| 36 | Ga0065714_10002525 | 3300005288 | Bacteria | 27682 |
| 37 | Ga0065714_10064969 | 3300005288 | Bacteria | 14694 |
| 38 | Ga0065714_10065104 | 3300005288 | Bacteria | 12936 |
| 39 | Ga0065714_10074878 | 3300005288 | Bacteria | 2979 |
| 40 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 41 | Ga0065704_10000301 | 3300005289 | Bacteria | 42046 |
| 42 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 43 | Ga0065704_10075020 | 3300005289 | Bacteria | 5840 |
| 44 | Ga0065704_10081460 | 3300005289 | Bacteria | 3741 |
| 45 | Ga0065704_10083738 | 3300005289 | Bacteria | 3425 |
| 46 | Ga0065715_10003509 | 3300005293 | Bacteria | 5698 |
| 47 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 48 | Ga0070658_10079249 | 3300005327 | Bacteria | 2697 |
| 49 | Ga0070676_10000619 | 3300005328 | Bacteria | 17345 |
| 50 | Ga0070683_100129177 | 3300005329 | Bacteria | 2390 |
| 51 | Ga0068868_100046733 | 3300005338 | Bacteria | 3389 |
| 52 | Ga0070660_100004154 | 3300005339 | Bacteria | 9997 |
| 53 | Ga0070660_100006750 | 3300005339 | Bacteria | 7963 |
| 54 | Ga0070673_100004298 | 3300005364 | Bacteria | 8997 |
| 55 | Ga0070659_100000253 | 3300005366 | Bacteria | 42218 |
| 56 | Ga0070659_100023927 | 3300005366 | Bacteria | 4679 |
| 57 | Ga0070714_100085776 | 3300005435 | Bacteria | 2751 |
| 58 | Ga0070713_100215477 | 3300005436 | Bacteria | 1740 |
| 59 | Ga0070662_100000054 | 3300005457 | Bacteria | 60719 |
| 60 | Ga0070681_10004904 | 3300005458 | Bacteria | 12846 |
| 61 | Ga0068853_100006872 | 3300005539 | Bacteria | 9077 |
| 62 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 63 | Ga0070665_100002844 | 3300005548 | Bacteria | 18745 |
| 64 | Ga0068855_100000927 | 3300005563 | Bacteria | 36472 |
| 65 | Ga0068855_100003209 | 3300005563 | Bacteria | 20016 |
| 66 | Ga0068855_100036016 | 3300005563 | Bacteria | 5892 |
| 67 | Ga0068855_100161484 | 3300005563 | Bacteria | 2543 |
| 68 | Ga0068856_100000023 | 3300005614 | Bacteria | 141671 |
| 69 | Ga0068856_100023566 | 3300005614 | Bacteria | 5985 |
| 70 | Ga0068856_100095462 | 3300005614 | Bacteria | 2961 |
| 71 | Ga0068856_100102395 | 3300005614 | Bacteria | 2857 |
| 72 | Ga0068856_100113219 | 3300005614 | Bacteria | 2711 |
| 73 | Ga0068852_100001687 | 3300005616 | Bacteria | 15044 |
| 74 | Ga0068851_10000739 | 3300005834 | Bacteria | 13977 |
| 75 | Ga0068870_10025269 | 3300005840 | Bacteria | 2947 |
| 76 | Ga0075366_10003370 | 3300006195 | Bacteria | 8415 |
| 77 | Ga0075366_10025107 | 3300006195 | Bacteria | 3478 |
| 78 | Ga0068871_100004730 | 3300006358 | Bacteria | 9526 |
| 79 | Ga0068865_100000076 | 3300006881 | Bacteria | 51732 |
| 80 | Ga0105244_10000003 | 3300009036 | Bacteria | 494610 |
| 81 | Ga0105240_10000294 | 3300009093 | Bacteria | 97108 |
| 82 | Ga0105240_10113800 | 3300009093 | Bacteria | 3269 |
| 83 | Ga0105240_10135564 | 3300009093 | Bacteria | 2949 |
| 84 | Ga0105243_10021331 | 3300009148 | Bacteria | 4916 |
| 85 | Ga0105241_10003146 | 3300009174 | Bacteria | 12277 |
| 86 | Ga0105242_10060473 | 3300009176 | Bacteria | 3113 |
| 87 | Ga0105242_10087653 | 3300009176 | Bacteria | 2613 |
| 88 | Ga0105237_10000109 | 3300009545 | Bacteria | 115699 |
| 89 | Ga0105237_10000578 | 3300009545 | Bacteria | 51257 |
| 90 | Ga0105237_10000994 | 3300009545 | Bacteria | 38153 |
| 91 | Ga0105237_10016843 | 3300009545 | Bacteria | 7585 |
| 92 | Ga0105237_10103845 | 3300009545 | Bacteria | 2834 |
| 93 | Ga0105238_10093622 | 3300009551 | Bacteria | 2993 |
| 94 | Ga0105239_10000040 | 3300010375 | Bacteria | 201445 |
| 95 | Ga0105239_10000162 | 3300010375 | Bacteria | 95804 |
| 96 | Ga0105239_10020511 | 3300010375 | Bacteria | 7289 |
| 97 | Ga0105239_10028567 | 3300010375 | Bacteria | 6132 |
| 98 | Ga0105239_10214748 | 3300010375 | Bacteria | 2156 |
| 99 | Ga0157373_10000284 | 3300013100 | Bacteria | 40521 |
| 100 | Ga0157373_10002793 | 3300013100 | Bacteria | 13213 |
| 101 | Ga0157373_10003236 | 3300013100 | Bacteria | 12311 |
| 102 | Ga0157373_10006735 | 3300013100 | Bacteria | 8552 |
| 103 | Ga0157373_10010686 | 3300013100 | Bacteria | 6752 |
| 104 | Ga0157373_10087011 | 3300013100 | Bacteria | 2202 |
| 105 | Ga0157371_10000298 | 3300013102 | Bacteria | 65719 |
| 106 | Ga0157371_10000918 | 3300013102 | Bacteria | 33144 |
| 107 | Ga0157371_10001041 | 3300013102 | Bacteria | 30406 |
| 108 | Ga0157371_10001311 | 3300013102 | Bacteria | 26152 |
| 109 | Ga0157371_10017950 | 3300013102 | Bacteria | 5243 |
| 110 | Ga0157371_10021981 | 3300013102 | Bacteria | 4682 |
| 111 | Ga0157371_10034017 | 3300013102 | Bacteria | 3660 |
| 112 | Ga0157370_10000197 | 3300013104 | Bacteria | 75846 |
| 113 | Ga0157370_10000382 | 3300013104 | Bacteria | 55802 |
| 114 | Ga0157370_10038016 | 3300013104 | Bacteria | 4659 |
| 115 | Ga0157370_10095953 | 3300013104 | Bacteria | 2782 |
| 116 | Ga0157369_10000031 | 3300013105 | Bacteria | 203214 |
| 117 | Ga0157369_10001423 | 3300013105 | Bacteria | 29363 |
| 118 | Ga0157369_10072354 | 3300013105 | Bacteria | 3700 |
| 119 | Ga0157374_10000391 | 3300013296 | Bacteria | 40035 |
| 120 | Ga0157374_10003495 | 3300013296 | Bacteria | 13206 |
| 121 | Ga0157374_10012252 | 3300013296 | Bacteria | 7455 |
| 122 | Ga0157374_10062171 | 3300013296 | Bacteria | 3499 |
| 123 | Ga0157378_10068949 | 3300013297 | Bacteria | 3172 |
| 124 | Ga0163162_10000082 | 3300013306 | Bacteria | 86888 |
| 125 | Ga0163162_10000093 | 3300013306 | Bacteria | 82738 |
| 126 | Ga0163162_10027158 | 3300013306 | Bacteria | 5659 |
| 127 | Ga0157372_10000026 | 3300013307 | Bacteria | 195407 |
| 128 | Ga0157372_10000071 | 3300013307 | Bacteria | 109638 |
| 129 | Ga0157372_10012580 | 3300013307 | Bacteria | 9011 |
| 130 | Ga0157372_10041404 | 3300013307 | Bacteria | 5094 |
| 131 | Ga0157375_10143642 | 3300013308 | Bacteria | 2516 |
| 132 | Ga0157375_10170321 | 3300013308 | Bacteria | 2325 |
| 133 | Ga0157380_10000021 | 3300014326 | Bacteria | 114368 |
| 134 | Ga0157380_10000054 | 3300014326 | Bacteria | 65705 |
| 135 | Ga0182008_10000024 | 3300014497 | Bacteria | 199978 |
| 136 | Ga0182008_10000082 | 3300014497 | Bacteria | 74716 |
| 137 | Ga0182008_10000503 | 3300014497 | Bacteria | 29456 |
| 138 | Ga0157377_10048959 | 3300014745 | Bacteria | 2374 |
| 139 | Ga0182006_1000424 | 3300015261 | Bacteria | 33825 |
| 140 | Ga0182006_1001382 | 3300015261 | Bacteria | 14763 |
| 141 | Ga0182006_1002791 | 3300015261 | Bacteria | 9323 |
| 142 | Ga0182006_1003339 | 3300015261 | Bacteria | 8263 |
| 143 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 144 | Ga0182007_10009933 | 3300015262 | Bacteria | 3792 |
| 145 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 146 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 147 | Ga0163161_10000831 | 3300017792 | Bacteria | 24092 |
| 148 | Ga0163161_10000856 | 3300017792 | Bacteria | 23716 |
| 149 | Ga0163161_10001453 | 3300017792 | Bacteria | 17518 |
| 150 | Ga0163161_10001812 | 3300017792 | Bacteria | 15609 |
| 151 | Ga0163161_10014594 | 3300017792 | Bacteria | 5470 |
| 152 | Ga0209436_101268 | 3300025208 | Bacteria | 9071 |
| 153 | Ga0207427_100137 | 3300025231 | Bacteria | 88182 |
| 154 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 155 | Ga0209437_100112 | 3300025233 | Bacteria | 214292 |
| 156 | Ga0209258_100476 | 3300025242 | Bacteria | 42226 |
| 157 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 158 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 159 | Ga0209026_1000189 | 3300025250 | Bacteria | 89924 |
| 160 | Ga0209026_1003466 | 3300025250 | Bacteria | 5156 |
| 161 | Ga0209148_1000129 | 3300025254 | Bacteria | 175720 |
| 162 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 163 | Ga0209233_1000126 | 3300025261 | Bacteria | 214298 |
| 164 | Ga0209455_1008622 | 3300025272 | Bacteria | 2755 |
| 165 | Ga0209130_1001332 | 3300025284 | Bacteria | 16720 |
| 166 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 167 | Ga0209676_1000351 | 3300025292 | Bacteria | 87135 |
| 168 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 169 | Ga0209758_1000145 | 3300025297 | Bacteria | 170553 |
| 170 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 171 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 172 | Ga0207426_1000604 | 3300025302 | Bacteria | 46749 |
| 173 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 174 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 175 | Ga0207656_10000115 | 3300025321 | Bacteria | 30785 |
| 176 | Ga0207655_1000010 | 3300025728 | Bacteria | 649325 |
| 177 | Ga0207647_10000046 | 3300025904 | Bacteria | 90148 |
| 178 | Ga0207647_10000617 | 3300025904 | Bacteria | 27702 |
| 179 | Ga0207647_10033547 | 3300025904 | Bacteria | 3287 |
| 180 | Ga0207645_10001668 | 3300025907 | Bacteria | 18063 |
| 181 | Ga0207705_10000107 | 3300025909 | Bacteria | 94984 |
| 182 | Ga0207654_10003529 | 3300025911 | Bacteria | 7910 |
| 183 | Ga0207654_10020448 | 3300025911 | Bacteria | 3509 |
| 184 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 185 | Ga0207695_10006220 | 3300025913 | Bacteria | 15543 |
| 186 | Ga0207695_10018989 | 3300025913 | Bacteria | 7928 |
| 187 | Ga0207695_10021471 | 3300025913 | Bacteria | 7363 |
| 188 | Ga0207695_10112816 | 3300025913 | Bacteria | 2695 |
| 189 | Ga0207671_10000063 | 3300025914 | Bacteria | 170060 |
| 190 | Ga0207671_10000407 | 3300025914 | Bacteria | 60207 |
| 191 | Ga0207671_10003029 | 3300025914 | Bacteria | 17218 |
| 192 | Ga0207671_10005221 | 3300025914 | Bacteria | 12074 |
| 193 | Ga0207671_10006948 | 3300025914 | Bacteria | 9958 |
| 194 | Ga0207657_10016593 | 3300025919 | Bacteria | 7095 |
| 195 | Ga0207657_10051242 | 3300025919 | Bacteria | 3588 |
| 196 | Ga0207664_10069251 | 3300025929 | Bacteria | 2837 |
| 197 | Ga0207690_10000293 | 3300025932 | Bacteria | 35416 |
| 198 | Ga0207706_10000669 | 3300025933 | Bacteria | 36066 |
| 199 | Ga0207686_10007074 | 3300025934 | Bacteria | 6039 |
| 200 | Ga0207709_10012838 | 3300025935 | Bacteria | 4619 |
| 201 | Ga0207704_10000169 | 3300025938 | Bacteria | 34738 |
| 202 | Ga0207661_10102425 | 3300025944 | Bacteria | 2407 |
| 203 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 204 | Ga0207667_10002558 | 3300025949 | Bacteria | 22619 |
| 205 | Ga0207667_10005697 | 3300025949 | Bacteria | 15190 |
| 206 | Ga0207667_10069562 | 3300025949 | Bacteria | 3663 |
| 207 | Ga0207667_10108810 | 3300025949 | Bacteria | 2859 |
| 208 | Ga0207639_10033656 | 3300026041 | Bacteria | 3782 |
| 209 | Ga0207702_10001259 | 3300026078 | Bacteria | 25526 |
| 210 | Ga0207702_10155054 | 3300026078 | Bacteria | 2087 |
| 211 | Ga0207648_10000220 | 3300026089 | Bacteria | 61703 |
| 212 | Ga0207683_10003089 | 3300026121 | Bacteria | 14546 |
| 213 | Ga0210002_1001131 | 3300027617 | Bacteria | 3709 |
| 214 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 215 | Ga0268266_10015425 | 3300028379 | Bacteria | 6556 |
| 216 | Ga0307517_10000429 | 3300028786 | Bacteria | 72171 |
| 217 | Ga0307515_10000226 | 3300028794 | Bacteria | 139533 |
| 218 | Ga0307515_10000507 | 3300028794 | Bacteria | 93166 |
| 219 | Ga0307515_10041837 | 3300028794 | Bacteria | 7190 |
| 220 | Ga0265338_10002045 | 3300028800 | Bacteria | 31180 |
| 221 | Ga0265338_10035591 | 3300028800 | Bacteria | 4782 |
| 222 | Ga0265338_10173311 | 3300028800 | Bacteria | 1652 |
| 223 | Ga0265327_10000338 | 3300031251 | Bacteria | 88898 |
| 224 | Ga0265327_10043374 | 3300031251 | Bacteria | 2407 |
| 225 | Ga0307513_10233389 | 3300031456 | Bacteria | 1651 |
| 226 | Ga0307509_10051189 | 3300031507 | Bacteria | 4419 |
| 227 | Ga0307408_100000602 | 3300031548 | Bacteria | 30924 |
| 228 | Ga0307408_100002002 | 3300031548 | Bacteria | 14726 |
| 229 | Ga0307408_100002436 | 3300031548 | Bacteria | 13085 |
| 230 | Ga0307408_100004578 | 3300031548 | Bacteria | 9365 |
| 231 | Ga0316576_10009716 | 3300031727 | Bacteria | 6222 |
| 232 | Ga0307405_10000015 | 3300031731 | Bacteria | 206299 |
| 233 | Ga0307405_10011401 | 3300031731 | Bacteria | 4657 |
| 234 | Ga0307407_10000027 | 3300031903 | Bacteria | 107307 |
| 235 | Ga0307412_10000030 | 3300031911 | Bacteria | 208541 |
| 236 | Ga0307412_10003168 | 3300031911 | Bacteria | 9142 |
| 237 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 238 | Ga0307414_10000038 | 3300032004 | Bacteria | 150774 |
| 239 | Ga0307414_10001228 | 3300032004 | Bacteria | 13211 |
| 240 | Ga0307414_10007266 | 3300032004 | Bacteria | 6222 |
| 241 | Ga0307414_10028893 | 3300032004 | Bacteria | 3602 |
| 242 | Ga0307414_10036885 | 3300032004 | Bacteria | 3268 |
| 243 | Ga0307414_10069492 | 3300032004 | Bacteria | 2532 |
| 244 | Ga0307414_10091575 | 3300032004 | Bacteria | 2260 |
| 245 | Ga0307507_10000023 | 3300033179 | Bacteria | 212423 |
| 246 | Ga0307510_10001152 | 3300033180 | Bacteria | 28416 |
| 247 | Ga0316584_0004789 | 3300036712 | Bacteria | 8984 |
| 248 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 249 | Ga0395899_0000055 | 3300037312 | Bacteria | 220579 |
| 250 | Ga0395899_0000084 | 3300037312 | Bacteria | 159161 |
| 251 | Ga0395899_0020990 | 3300037312 | Bacteria | 4953 |
| 252 | Ga0395900_0000194 | 3300037418 | Bacteria | 97768 |
| 253 | Ga0395900_0008131 | 3300037418 | Bacteria | 10800 |
| 254 | Ga0395900_0036640 | 3300037418 | Bacteria | 5057 |
| 255 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 256 | Ga0395905_0000340 | 3300037471 | Bacteria | 66412 |
| 257 | Ga0395905_0003171 | 3300037471 | Bacteria | 17718 |
| 258 | Ga0395905_0022429 | 3300037471 | Bacteria | 5971 |
| 259 | Ga0400483_174860 | 3300039062 | Bacteria | 22336 |
| 260 | Ga0451577_0003251 | 3300042876 | Bacteria | 18269 |
| 261 | Ga0466966_0010875 | 3300044684 | Bacteria | 6044 |
| 262 | Ga0453684_0001838 | 3300044712 | Bacteria | 55467 |
| 263 | Ga0453684_0003191 | 3300044712 | Bacteria | 37570 |
| 264 | Ga0453684_0004741 | 3300044712 | Bacteria | 28097 |
| 265 | Ga0453684_0015662 | 3300044712 | Bacteria | 11950 |
| 266 | Ga0453684_0055232 | 3300044712 | Bacteria | 5165 |
| 267 | Ga0453684_0095703 | 3300044712 | Bacteria | 3649 |
| 268 | Ga0453684_0108580 | 3300044712 | Bacteria | 3376 |
| 269 | Ga0466959_0017617 | 3300045049 | Bacteria | 5238 |
| 270 | Ga0466959_0034565 | 3300045049 | Bacteria | 3739 |
| 271 | Ga0451576_0000020 | 3300045051 | Bacteria | 529568 |
| 272 | Ga0451576_0000625 | 3300045051 | Bacteria | 73634 |
| 273 | Ga0451576_0020091 | 3300045051 | Bacteria | 7280 |
| 274 | Ga0495627_004478 | 3300046453 | Bacteria | 5843 |
| 275 | Ga0495627_018500 | 3300046453 | Bacteria | 2347 |
| 276 | Ga0495650_0000198 | 3300046471 | Bacteria | 130455 |
| 277 | Ga0495585_0000391 | 3300046492 | Bacteria | 42399 |
| 278 | Ga0495606_0000003 | 3300046507 | Bacteria | 449402 |
| 279 | Ga0495606_0007202 | 3300046507 | Bacteria | 10030 |
| 280 | Ga0495606_0046189 | 3300046507 | Bacteria | 2880 |
| 281 | Ga0495610_0000197 | 3300046512 | Bacteria | 67429 |
| 282 | Ga0495610_0002942 | 3300046512 | Bacteria | 13760 |
| 283 | Ga0495616_0006818 | 3300046513 | Bacteria | 6884 |
| 284 | Ga0495631_0009584 | 3300046518 | Bacteria | 4831 |
| 285 | Ga0495637_0033578 | 3300046520 | Bacteria | 2252 |
| 286 | Ga0495644_0005095 | 3300046523 | Bacteria | 5142 |
| 287 | Ga0495586_0030350 | 3300046535 | Bacteria | 2893 |
| 288 | Ga0495609_0009453 | 3300046538 | Bacteria | 4715 |
| 289 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 290 | Ga0495633_0000267 | 3300046558 | Bacteria | 61184 |
| 291 | Ga0495633_0003424 | 3300046558 | Bacteria | 10562 |
| 292 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 293 | Ga0495625_0000524 | 3300046660 | Bacteria | 56526 |
| 294 | Ga0495625_0010537 | 3300046660 | Bacteria | 7635 |
| 295 | Ga0495625_0013186 | 3300046660 | Bacteria | 6657 |
| 296 | Ga0495625_0017936 | 3300046660 | Bacteria | 5532 |
| 297 | Ga0495661_0000778 | 3300046665 | Bacteria | 30455 |
| 298 | Ga0495661_0006247 | 3300046665 | Bacteria | 8376 |
| 299 | Ga0495649_0000168 | 3300046694 | Bacteria | 57053 |
| 300 | Ga0495683_0038225 | 3300047323 | Bacteria | 2431 |
| 301 | Ga0495687_001711 | 3300047443 | Bacteria | 19448 |
| 302 | Ga0495687_032152 | 3300047443 | Bacteria | 2399 |
| 303 | Ga0495686_0000845 | 3300047472 | Bacteria | 39321 |
| 304 | Ga0495686_0002919 | 3300047472 | Bacteria | 15334 |
| 305 | Ga0495686_0079601 | 3300047472 | Bacteria | 2004 |
| 306 | Ga0495614_0043223 | 3300048089 | Bacteria | 1932 |
| 307 | Ga0496115_0009216 | 3300048918 | Bacteria | 7328 |
| 308 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 309 | Ga0496122_0000869 | 3300048925 | Bacteria | 56890 |
| 310 | Ga0496124_0016764 | 3300048927 | Bacteria | 6948 |
| 311 | Ga0496125_0001552 | 3300048928 | Bacteria | 32788 |
| 312 | Ga0496126_0010572 | 3300048929 | Bacteria | 9652 |
| 313 | Ga0496126_0013000 | 3300048929 | Bacteria | 8495 |
| 314 | Ga0501031_0000669 | 3300049568 | Bacteria | 20380 |
| 315 | Ga0501032_0003006 | 3300049569 | Bacteria | 13083 |
| 316 | Ga0501033_0000005 | 3300049570 | Bacteria | 379089 |
| 317 | Ga0501034_0000052 | 3300049571 | Bacteria | 207572 |
| 318 | Ga0501034_0029160 | 3300049571 | Bacteria | 5610 |
| 319 | Ga0501037_0004892 | 3300049573 | Bacteria | 9745 |
| 320 | Ga0501038_0002931 | 3300049574 | Bacteria | 15917 |
| 321 | Ga0501039_0008402 | 3300049575 | Bacteria | 7869 |
| 322 | Ga0501043_0002243 | 3300049579 | Bacteria | 16460 |
| 323 | Ga0501047_0056643 | 3300049581 | Bacteria | 3791 |
| 324 | Ga0501223_000806 | 3300049663 | Bacteria | 7419 |
| 325 | Ga0501223_001917 | 3300049663 | Bacteria | 4676 |
| 326 | Ga0501257_002934 | 3300049686 | Bacteria | 3623 |
| 327 | Ga0501259_001902 | 3300049688 | Bacteria | 3458 |
| 328 | Ga0501241_001051 | 3300049758 | Bacteria | 5829 |
| 329 | Ga0501264_000564 | 3300049761 | Bacteria | 5364 |
| 330 | Ga0501035_0004866 | 3300049822 | Bacteria | 12739 |
| 331 | Ga0501044_0001723 | 3300049823 | Bacteria | 25593 |
| 332 | Ga0501045_0011792 | 3300049824 | Bacteria | 6140 |
| 333 | nmdc:mga0k408_156_c2 | 3300050493 | Bacteria | 15182 |
| 334 | Ga0500635_0001979 | 3300053080 | Bacteria | 5003 |
| 335 | Ga0500644_0000491 | 3300053088 | Bacteria | 17275 |
| 336 | Ga0500644_0006977 | 3300053088 | Bacteria | 2921 |
| 337 | Ga0500651_0000455 | 3300053093 | Bacteria | 21853 |
| 338 | Ga0500641_0000119 | 3300053096 | Bacteria | 30093 |
| 339 | Ga0500562_000055 | 3300053108 | Bacteria | 58655 |
| 340 | Ga0500569_000961 | 3300053109 | Bacteria | 5183 |
| 341 | Ga0500618_000489 | 3300053125 | Bacteria | 25319 |
| 342 | Ga0500658_0003022 | 3300053134 | Bacteria | 6452 |
| 343 | Ga0500577_0002420 | 3300053142 | Bacteria | 4770 |
| 344 | Ga0500604_0005011 | 3300053151 | Bacteria | 3506 |
| 345 | Ga0500622_0000041 | 3300053156 | Bacteria | 170067 |
| 346 | Ga0500622_0000045 | 3300053156 | Bacteria | 158316 |
| 347 | Ga0500622_0000059 | 3300053156 | Bacteria | 134223 |
| 348 | Ga0500622_0002792 | 3300053156 | Bacteria | 12270 |
| 349 | Ga0500622_0016378 | 3300053156 | Bacteria | 3962 |
| 350 | Ga0500624_000278 | 3300053157 | Bacteria | 17649 |
| 351 | Ga0500636_0035545 | 3300053177 | Bacteria | 2948 |
| 352 | Ga0500661_000611 | 3300055283 | Bacteria | 6689 |
| 353 | 2522548252 | 2522125168 | Bacteria | 7376607 |
| 354 | 2524000871 | 2523533628 | Bacteria | 4098242 |
| 355 | 2586206310 | 2585427687 | Bacteria | 5544917 |
| 356 | 2599479059 | 2599185184 | Bacteria | 6430550 |
| 357 | 2738755404 | 2738541283 | Bacteria | 7222293 |
| 358 | 2738763541 | 2738541284 | Bacteria | 5199923 |
| 359 | 2738856143 | 2738541302 | Bacteria | 5944758 |
| 360 | 2739303238 | 2738543023 | Bacteria | 6767879 |
| 361 | 2739588296 | 2739367651 | Bacteria | 6359826 |
| 362 | 2739613926 | 2739367656 | Bacteria | 5152243 |
| 363 | 2739648577 | 2739367663 | Bacteria | 5040914 |
| 364 | 2776615021 | 2775506987 | Bacteria | 5373360 |
| 365 | 2819546278 | 2818991437 | Bacteria | 5805520 |
| 366 | 2819572090 | 2818991442 | Bacteria | 8318214 |
| 367 | 2819586696 | 2818991444 | Bacteria | 6968812 |
| 368 | 2821141667 | 2821136567 | Bacteria | 8080116 |
| 369 | 2840677935 | 2840677318 | Bacteria | 2664183 |
| 370 | 2842723891 | 2842722452 | Bacteria | 6263924 |
| 371 | 2842912377 | 2842909656 | Bacteria | 6185908 |
| 372 | 2849282804 | 2849281842 | Bacteria | 6065644 |
| 373 | 2852624884 | 2852623160 | Bacteria | 4376875 |
| 374 | 2852629521 | 2852627209 | Bacteria | 5896285 |
| 375 | 2857629279 | 2857627736 | Bacteria | 5625397 |
| 376 | 2883070897 | 2883068021 | Bacteria | 6192739 |
| 377 | 2884637803 | 2884634485 | Bacteria | 3928637 |
| 378 | 2884797796 | 2884791551 | Bacteria | 8511252 |
| 379 | 2884936221 | 2884933994 | Bacteria | 4535041 |
| 380 | 2896085752 | 2896085136 | Bacteria | 6129793 |
| 381 | 2896113990 | 2896109856 | Bacteria | 7140722 |
| 382 | 2902051351 | 2902048731 | Bacteria | 4976191 |
| 383 | 2904446549 | 2904445276 | Bacteria | 5310396 |
| 384 | 2904469919 | 2904467357 | Bacteria | 8057758 |
| 385 | 2911142703 | 2911138879 | Bacteria | 5811561 |
| 386 | 2919190255 | 2919186247 | Bacteria | 6244071 |
| 387 | 2919442743 | 2919437846 | Bacteria | 6199444 |
| 388 | 2919512405 | 2919509842 | Bacteria | 4104664 |
| 389 | 2919696781 | 2919692658 | Bacteria | 5943958 |
| 390 | 2928082627 | 2928078545 | Bacteria | 6534839 |
| 391 | 2928148786 | 2928147474 | Bacteria | 6512076 |
| 392 | 2929155381 | 2929154850 | Bacteria | 6753285 |
| 393 | 2929245275 | 2929239360 | Bacteria | 7745570 |
| 394 | 2929927506 | 2929921140 | Bacteria | 8649150 |
| 395 | 2932086416 | 2932082852 | Bacteria | 6563563 |
| 396 | 2939668536 | 2939664404 | Bacteria | 6364494 |
| 397 | 2945999360 | 2945997725 | Bacteria | 6404843 |
| 398 | 2954021757 | 2954016120 | Bacteria | 6446024 |
| 399 | 2958515918 | 2958512119 | Bacteria | 4528530 |
| 400 | 2965323609 | 2965320100 | Bacteria | 3975600 |
| 401 | 2977235783 | 2977232053 | Bacteria | 5485925 |
| 402 | 8003151359 | 8003151029 | Bacteria | 8187759 |
| 403 | 8015557277 | 8015556637 | Bacteria | 3582323 |
| 404 | 8056444587 | 8056440228 | Bacteria | 4946504 |
| 405 | Ga0157372_10000642 | |||
| 406 | SwRhRL2b_contig_1761633 | |||
| 407 | SwRhRL2b_contig_1785592 | |||
| 408 | SwRhRL2b_contig_2693654 | |||
| 409 | SwRhRL2b_contig_38688 | |||
| 410 | JGI24740J21852_10000503 | |||
| 411 | JGI24737J22298_10002164 | |||
| 412 | JGI24737J22298_10006779 | |||
| 413 | JGI24735J21928_10000038 | |||
| 414 | JGI25162J39368_1000047 | |||
| 415 | JGI25162J39368_1000940 | |||
| 416 | JGI25154J39366_1000004 | |||
| 417 | JGI25152J39213_1000195 | |||
| 418 | JGI25150J39212_1000014 | |||
| 419 | JGI25151J46595_10000042 | |||
| 420 | JGI25165J46597_1001356 | |||
| 421 | JGI25153J46596_10000009 | |||
| 422 | rootH1_10022825 | |||
| 423 | rootH2_10002048 | |||
| 424 | rootH2_10013605 | |||
| 425 | rootL2_10012658 | |||
| 426 | rootL2_10012659 | |||
| 427 | rootH1_10003426 | |||
| 428 | rootH1_10004301 | |||
| 429 | rootH1_10050816 | |||
| 430 | rootH1_10210593 | |||
| 431 | JGI25160J50197_1004415 | |||
| 432 | JGI25160J50197_1004554 | |||
| 433 | Ga0055536_1000019 | |||
| 434 | Ga0055530_10001246 | |||
| 435 | Ga0055531_10000171 | |||
| 436 | Ga0058863_11968118 | |||
| 437 | Ga0058862_12403007 | |||
| 438 | Ga0065165_1000060 | |||
| 439 | Ga0065714_10002525 | |||
| 440 | Ga0065714_10064969 | |||
| 441 | Ga0065714_10065104 | |||
| 442 | Ga0065714_10074878 | |||
| 443 | Ga0065704_10000195 | |||
| 444 | Ga0065704_10000301 | |||
| 445 | Ga0065704_10070132 | |||
| 446 | Ga0065704_10075020 | |||
| 447 | Ga0065704_10081460 | |||
| 448 | Ga0065704_10083738 | |||
| 449 | Ga0065715_10003509 | |||
| 450 | Ga0070658_10000014 | |||
| 451 | Ga0070658_10079249 | |||
| 452 | Ga0070676_10000619 | |||
| 453 | Ga0070683_100129177 | |||
| 454 | Ga0068868_100046733 | |||
| 455 | Ga0070660_100004154 | |||
| 456 | Ga0070660_100006750 | |||
| 457 | Ga0070673_100004298 | |||
| 458 | Ga0070659_100000253 | |||
| 459 | Ga0070659_100023927 | |||
| 460 | Ga0070714_100085776 | |||
| 461 | Ga0070713_100215477 | |||
| 462 | Ga0070662_100000054 | |||
| 463 | Ga0070681_10004904 | |||
| 464 | Ga0068853_100006872 | |||
| 465 | Ga0070665_100000010 | |||
| 466 | Ga0070665_100002844 | |||
| 467 | Ga0068855_100000927 | |||
| 468 | Ga0068855_100003209 | |||
| 469 | Ga0068855_100036016 | |||
| 470 | Ga0068855_100161484 | |||
| 471 | Ga0068856_100000023 | |||
| 472 | Ga0068856_100023566 | |||
| 473 | Ga0068856_100095462 | |||
| 474 | Ga0068856_100102395 | |||
| 475 | Ga0068856_100113219 | |||
| 476 | Ga0068852_100001687 | |||
| 477 | Ga0068851_10000739 | |||
| 478 | Ga0068870_10025269 | |||
| 479 | Ga0075366_10003370 | |||
| 480 | Ga0075366_10025107 | |||
| 481 | Ga0068871_100004730 | |||
| 482 | Ga0068865_100000076 | |||
| 483 | Ga0105244_10000003 | |||
| 484 | Ga0105240_10000294 | |||
| 485 | Ga0105240_10113800 | |||
| 486 | Ga0105240_10135564 | |||
| 487 | Ga0105243_10021331 | |||
| 488 | Ga0105241_10003146 | |||
| 489 | Ga0105242_10060473 | |||
| 490 | Ga0105242_10087653 | |||
| 491 | Ga0105237_10000109 | |||
| 492 | Ga0105237_10000578 | |||
| 493 | Ga0105237_10000994 | |||
| 494 | Ga0105237_10016843 | |||
| 495 | Ga0105237_10103845 | |||
| 496 | Ga0105238_10093622 | |||
| 497 | Ga0105239_10000040 | |||
| 498 | Ga0105239_10000162 | |||
| 499 | Ga0105239_10020511 | |||
| 500 | Ga0105239_10028567 | |||
| 501 | Ga0105239_10214748 | |||
| 502 | Ga0157373_10000284 | |||
| 503 | Ga0157373_10002793 | |||
| 504 | Ga0157373_10003236 | |||
| 505 | Ga0157373_10006735 | |||
| 506 | Ga0157373_10010686 | |||
| 507 | Ga0157373_10087011 | |||
| 508 | Ga0157371_10000298 | |||
| 509 | Ga0157371_10000918 | |||
| 510 | Ga0157371_10001041 | |||
| 511 | Ga0157371_10001311 | |||
| 512 | Ga0157371_10017950 | |||
| 513 | Ga0157371_10021981 | |||
| 514 | Ga0157371_10034017 | |||
| 515 | Ga0157370_10000197 | |||
| 516 | Ga0157370_10000382 | |||
| 517 | Ga0157370_10038016 | |||
| 518 | Ga0157370_10095953 | |||
| 519 | Ga0157369_10000031 | |||
| 520 | Ga0157369_10001423 | |||
| 521 | Ga0157369_10072354 | |||
| 522 | Ga0157374_10000391 | |||
| 523 | Ga0157374_10003495 | |||
| 524 | Ga0157374_10012252 | |||
| 525 | Ga0157374_10062171 | |||
| 526 | Ga0157378_10068949 | |||
| 527 | Ga0163162_10000082 | |||
| 528 | Ga0163162_10000093 | |||
| 529 | Ga0163162_10027158 | |||
| 530 | Ga0157372_10000026 | |||
| 531 | Ga0157372_10000071 | |||
| 532 | Ga0157372_10012580 | |||
| 533 | Ga0157372_10041404 | |||
| 534 | Ga0157375_10143642 | |||
| 535 | Ga0157375_10170321 | |||
| 536 | Ga0157380_10000021 | |||
| 537 | Ga0157380_10000054 | |||
| 538 | Ga0182008_10000024 | |||
| 539 | Ga0182008_10000082 | |||
| 540 | Ga0182008_10000503 | |||
| 541 | Ga0157377_10048959 | |||
| 542 | Ga0182006_1000424 | |||
| 543 | Ga0182006_1001382 | |||
| 544 | Ga0182006_1002791 | |||
| 545 | Ga0182006_1003339 | |||
| 546 | Ga0182007_10000002 | |||
| 547 | Ga0182007_10009933 | |||
| 548 | Ga0182005_1000040 | |||
| 549 | Ga0183373_1004 | |||
| 550 | Ga0163161_10000831 | |||
| 551 | Ga0163161_10000856 | |||
| 552 | Ga0163161_10001453 | |||
| 553 | Ga0163161_10001812 | |||
| 554 | Ga0163161_10014594 | |||
| 555 | Ga0209436_101268 | |||
| 556 | Ga0207427_100137 | |||
| 557 | Ga0209437_100089 | |||
| 558 | Ga0209437_100112 | |||
| 559 | Ga0209258_100476 | |||
| 560 | Ga0207425_1000023 | |||
| 561 | Ga0209646_1000025 | |||
| 562 | Ga0209026_1000189 | |||
| 563 | Ga0209026_1003466 | |||
| 564 | Ga0209148_1000129 | |||
| 565 | Ga0209129_1000032 | |||
| 566 | Ga0209233_1000126 | |||
| 567 | Ga0209455_1008622 | |||
| 568 | Ga0209130_1001332 | |||
| 569 | Ga0209676_1000009 | |||
| 570 | Ga0209676_1000351 | |||
| 571 | Ga0209025_1000047 | |||
| 572 | Ga0209758_1000145 | |||
| 573 | Ga0209050_1000094 | |||
| 574 | Ga0207426_1000057 | |||
| 575 | Ga0207426_1000604 | |||
| 576 | Ga0209257_1000004 | |||
| 577 | Ga0209257_1000006 | |||
| 578 | Ga0207656_10000115 | |||
| 579 | Ga0207655_1000010 | |||
| 580 | Ga0207647_10000046 | |||
| 581 | Ga0207647_10000617 | |||
| 582 | Ga0207647_10033547 | |||
| 583 | Ga0207645_10001668 | |||
| 584 | Ga0207705_10000107 | |||
| 585 | Ga0207654_10003529 | |||
| 586 | Ga0207654_10020448 | |||
| 587 | Ga0207695_10000142 | |||
| 588 | Ga0207695_10006220 | |||
| 589 | Ga0207695_10018989 | |||
| 590 | Ga0207695_10021471 | |||
| 591 | Ga0207695_10112816 | |||
| 592 | Ga0207671_10000063 | |||
| 593 | Ga0207671_10000407 | |||
| 594 | Ga0207671_10003029 | |||
| 595 | Ga0207671_10005221 | |||
| 596 | Ga0207671_10006948 | |||
| 597 | Ga0207657_10016593 | |||
| 598 | Ga0207657_10051242 | |||
| 599 | Ga0207664_10069251 | |||
| 600 | Ga0207690_10000293 | |||
| 601 | Ga0207706_10000669 | |||
| 602 | Ga0207686_10007074 | |||
| 603 | Ga0207709_10012838 | |||
| 604 | Ga0207704_10000169 | |||
| 605 | Ga0207661_10102425 | |||
| 606 | Ga0207667_10000015 | |||
| 607 | Ga0207667_10002558 | |||
| 608 | Ga0207667_10005697 | |||
| 609 | Ga0207667_10069562 | |||
| 610 | Ga0207667_10108810 | |||
| 611 | Ga0207639_10033656 | |||
| 612 | Ga0207702_10001259 | |||
| 613 | Ga0207702_10155054 | |||
| 614 | Ga0207648_10000220 | |||
| 615 | Ga0207683_10003089 | |||
| 616 | Ga0210002_1001131 | |||
| 617 | Ga0268266_10000032 | |||
| 618 | Ga0268266_10015425 | |||
| 619 | Ga0307517_10000429 | |||
| 620 | Ga0307515_10000226 | |||
| 621 | Ga0307515_10000507 | |||
| 622 | Ga0307515_10041837 | |||
| 623 | Ga0265338_10002045 | |||
| 624 | Ga0265338_10035591 | |||
| 625 | Ga0265338_10173311 | |||
| 626 | Ga0265327_10000338 | |||
| 627 | Ga0265327_10043374 | |||
| 628 | Ga0307513_10233389 | |||
| 629 | Ga0307509_10051189 | |||
| 630 | Ga0307408_100000602 | |||
| 631 | Ga0307408_100002002 | |||
| 632 | Ga0307408_100002436 | |||
| 633 | Ga0307408_100004578 | |||
| 634 | Ga0316576_10009716 | |||
| 635 | Ga0307405_10000015 | |||
| 636 | Ga0307405_10011401 | |||
| 637 | Ga0307407_10000027 | |||
| 638 | Ga0307412_10000030 | |||
| 639 | Ga0307412_10003168 | |||
| 640 | Ga0307416_100000002 | |||
| 641 | Ga0307414_10000038 | |||
| 642 | Ga0307414_10001228 | |||
| 643 | Ga0307414_10007266 | |||
| 644 | Ga0307414_10028893 | |||
| 645 | Ga0307414_10036885 | |||
| 646 | Ga0307414_10069492 | |||
| 647 | Ga0307414_10091575 | |||
| 648 | Ga0307507_10000023 | |||
| 649 | Ga0307510_10001152 | |||
| 650 | Ga0316584_0004789 | |||
| 651 | Ga0395899_0000034 | |||
| 652 | Ga0395899_0000055 | |||
| 653 | Ga0395899_0000084 | |||
| 654 | Ga0395899_0020990 | |||
| 655 | Ga0395900_0000194 | |||
| 656 | Ga0395900_0008131 | |||
| 657 | Ga0395900_0036640 | |||
| 658 | Ga0395905_0000003 | |||
| 659 | Ga0395905_0000340 | |||
| 660 | Ga0395905_0003171 | |||
| 661 | Ga0395905_0022429 | |||
| 662 | Ga0400483_174860 | |||
| 663 | Ga0451577_0003251 | |||
| 664 | Ga0466966_0010875 | |||
| 665 | Ga0453684_0001838 | |||
| 666 | Ga0453684_0003191 | |||
| 667 | Ga0453684_0004741 | |||
| 668 | Ga0453684_0015662 | |||
| 669 | Ga0453684_0055232 | |||
| 670 | Ga0453684_0095703 | |||
| 671 | Ga0453684_0108580 | |||
| 672 | Ga0466959_0017617 | |||
| 673 | Ga0466959_0034565 | |||
| 674 | Ga0451576_0000020 | |||
| 675 | Ga0451576_0000625 | |||
| 676 | Ga0451576_0020091 | |||
| 677 | Ga0495627_004478 | |||
| 678 | Ga0495627_018500 | |||
| 679 | Ga0495650_0000198 | |||
| 680 | Ga0495585_0000391 | |||
| 681 | Ga0495606_0000003 | |||
| 682 | Ga0495606_0007202 | |||
| 683 | Ga0495606_0046189 | |||
| 684 | Ga0495610_0000197 | |||
| 685 | Ga0495610_0002942 | |||
| 686 | Ga0495616_0006818 | |||
| 687 | Ga0495631_0009584 | |||
| 688 | Ga0495637_0033578 | |||
| 689 | Ga0495644_0005095 | |||
| 690 | Ga0495586_0030350 | |||
| 691 | Ga0495609_0009453 | |||
| 692 | Ga0495633_0000017 | |||
| 693 | Ga0495633_0000267 | |||
| 694 | Ga0495633_0003424 | |||
| 695 | Ga0495668_0000010 | |||
| 696 | Ga0495625_0000524 | |||
| 697 | Ga0495625_0010537 | |||
| 698 | Ga0495625_0013186 | |||
| 699 | Ga0495625_0017936 | |||
| 700 | Ga0495661_0000778 | |||
| 701 | Ga0495661_0006247 | |||
| 702 | Ga0495649_0000168 | |||
| 703 | Ga0495683_0038225 | |||
| 704 | Ga0495687_001711 | |||
| 705 | Ga0495687_032152 | |||
| 706 | Ga0495686_0000845 | |||
| 707 | Ga0495686_0002919 | |||
| 708 | Ga0495686_0079601 | |||
| 709 | Ga0495614_0043223 | |||
| 710 | Ga0496115_0009216 | |||
| 711 | Ga0496121_0000010 | |||
| 712 | Ga0496122_0000869 | |||
| 713 | Ga0496124_0016764 | |||
| 714 | Ga0496125_0001552 | |||
| 715 | Ga0496126_0010572 | |||
| 716 | Ga0496126_0013000 | |||
| 717 | Ga0501031_0000669 | |||
| 718 | Ga0501032_0003006 | |||
| 719 | Ga0501033_0000005 | |||
| 720 | Ga0501034_0000052 | |||
| 721 | Ga0501034_0029160 | |||
| 722 | Ga0501037_0004892 | |||
| 723 | Ga0501038_0002931 | |||
| 724 | Ga0501039_0008402 | |||
| 725 | Ga0501043_0002243 | |||
| 726 | Ga0501047_0056643 | |||
| 727 | Ga0501223_000806 | |||
| 728 | Ga0501223_001917 | |||
| 729 | Ga0501257_002934 | |||
| 730 | Ga0501259_001902 | |||
| 731 | Ga0501241_001051 | |||
| 732 | Ga0501264_000564 | |||
| 733 | Ga0501035_0004866 | |||
| 734 | Ga0501044_0001723 | |||
| 735 | Ga0501045_0011792 | |||
| 736 | nmdc:mga0k408_156_c2 | |||
| 737 | Ga0500635_0001979 | |||
| 738 | Ga0500644_0000491 | |||
| 739 | Ga0500644_0006977 | |||
| 740 | Ga0500651_0000455 | |||
| 741 | Ga0500641_0000119 | |||
| 742 | Ga0500562_000055 | |||
| 743 | Ga0500569_000961 | |||
| 744 | Ga0500618_000489 | |||
| 745 | Ga0500658_0003022 | |||
| 746 | Ga0500577_0002420 | |||
| 747 | Ga0500604_0005011 | |||
| 748 | Ga0500622_0000041 | |||
| 749 | Ga0500622_0000045 | |||
| 750 | Ga0500622_0000059 | |||
| 751 | Ga0500622_0002792 | |||
| 752 | Ga0500622_0016378 | |||
| 753 | Ga0500624_000278 | |||
| 754 | Ga0500636_0035545 | |||
| 755 | Ga0500661_000611 | |||
| 756 | 2522548252 | |||
| 757 | 2524000871 | |||
| 758 | 2586206310 | |||
| 759 | 2599479059 | |||
| 760 | 2738755404 | |||
| 761 | 2738763541 | |||
| 762 | 2738856143 | |||
| 763 | 2739303238 | |||
| 764 | 2739588296 | |||
| 765 | 2739613926 | |||
| 766 | 2739648577 | |||
| 767 | 2776615021 | |||
| 768 | 2819546278 | |||
| 769 | 2819572090 | |||
| 770 | 2819586696 | |||
| 771 | 2821141667 | |||
| 772 | 2840677935 | |||
| 773 | 2842723891 | |||
| 774 | 2842912377 | |||
| 775 | 2849282804 | |||
| 776 | 2852624884 | |||
| 777 | 2852629521 | |||
| 778 | 2857629279 | |||
| 779 | 2883070897 | |||
| 780 | 2884637803 | |||
| 781 | 2884797796 | |||
| 782 | 2884936221 | |||
| 783 | 2896085752 | |||
| 784 | 2896113990 | |||
| 785 | 2902051351 | |||
| 786 | 2904446549 | |||
| 787 | 2904469919 | |||
| 788 | 2911142703 | |||
| 789 | 2919190255 | |||
| 790 | 2919442743 | |||
| 791 | 2919512405 | |||
| 792 | 2919696781 | |||
| 793 | 2928082627 | |||
| 794 | 2928148786 | |||
| 795 | 2929155381 | |||
| 796 | 2929245275 | |||
| 797 | 2929927506 | |||
| 798 | 2932086416 | |||
| 799 | 2939668536 | |||
| 800 | 2945999360 | |||
| 801 | 2954021757 | |||
| 802 | 2958515918 | |||
| 803 | 2965323609 | |||
| 804 | 2977235783 | |||
| 805 | 8003151359 | |||
| 806 | 8015557277 | |||
| 807 | 8056444587 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a4i-assembly1.cif.gz_B | crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 | 0.9481 | 199 | 512 |
| 2dpl-assembly1.cif.gz_B | crystal structure of the gmp synthase from pyrococcus horikoshii ot3 | 0.943 | 203 | 512 |
| 2dpl-assembly1.cif.gz_A | crystal structure of the gmp synthase from pyrococcus horikoshii ot3 | 0.9409 | 199 | 512 |
| 3a4i-assembly1.cif.gz_B | crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 | 0.9385 | 199 | 512 |
| 2dpl-assembly1.cif.gz_B | crystal structure of the gmp synthase from pyrococcus horikoshii ot3 | 0.9365 | 203 | 512 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ywcA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9453 | 196 | 387 | 3.40.50.620 |
| 2dplA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9412 | 199 | 387 | 3.40.50.620 |
| 2ywcA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9401 | 196 | 387 | 3.40.50.620 |
| af_Q2G0Y6_200_393_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9384 | 198 | 391 | 3.40.50.620 |
| af_Q2G0Y6_200_393_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9291 | 198 | 391 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0EJG3-F1-model_v4 | GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) | 0.9752 | 363 | 504 |
GO:0003921
GO:0005524 GO:0005829 |
| AF-A0A7V2X9Y9-F1-model_v4 | ExsB family transcriptional regulator | 0.9721 | 200 | 286 |
GO:0003921
GO:0005524 GO:0005829 |
| AF-X1ISV3-F1-model_v4 | GMPS ATP-PPase domain-containing protein | 0.9709 | 183 | 324 |
GO:0003921
GO:0005524 GO:0005829 |
| AF-A0A3C0EJG3-F1-model_v4 | GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) | 0.9685 | 363 | 504 |
GO:0003921
GO:0005524 GO:0005829 |
| AF-A0A641V1T5-F1-model_v4 | deleted | 0.9658 | 1 | 155 |
|