F435388

General Info

Members Datasets Scaffolds Average Seq Length
403 247 807 510

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10000642|Ga0157372_1000064214
Length 555
Sequence LELILACPANLLKNAELVTVFSKQTRRFKMCARAMRCTAQFCIFARMQETILILDFGSQYTQLIARRVRELNVYCEIHPFNKIPEITGNIKGVILSGSPFSVRASDAPNPDLSAFKNKLPLLGVCYGAQLMAHKFGGEVQKSEHREYGRANLSFVKADNELFKGVSNNSQVWMSHADTITKIPDNYEIISSTKDVKFAGYQVKGEQTYGIQFHPEVYHSTEGAVLLKNFVVEICGCRQDWTPDSFVETTVKELQQKIGNDKVVLGLSGGVDSSVAAVLLHKAIGKNLYCIFVDNGLLRKNEFETVLDSYKHMGLNVKGVNAKDRFYAELAGVSDPEKKRKAIGKVFIDVFDDESKRIEDVKWLGQGTIYPDVIESVSVKGPSATIKSHHNVGGLPDFMKLKIVEPLNTLFKDEVRRVGKTLQIDDAILGRHPFPGPGLAIRILGDITAEKVRILQEVDSIFIDNLKSADLYKDVWQAGAIFLPVQSVGVMGDERTYENAVALRAVTSTDGMTADWCHLPYEFLGKVSNEIINKVKGINRVVYDISSKPPATIEWE

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
176 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
177 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
196 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
197 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
198 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
199 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
200 2738541283 Pedobacter sp. OK701 Isolate Unclassified
201 2738541284 Pedobacter sp. YR016 Isolate Unclassified
202 2738541302 Pedobacter sp. CF074 Isolate Unclassified
203 2738543023 Pedobacter sp. OK628 Isolate Unclassified
204 2739367651 Pedobacter sp. OK291 Isolate Unclassified
205 2739367656 Pedobacter sp. CF523 Isolate Unclassified
206 2739367663 Pedobacter sp. YR510 Isolate Unclassified
207 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
208 2818991437 Pedobacter terrae 518 Isolate Unclassified
209 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
210 2818991444 Filimonas endophytica 3197 Isolate Unclassified
211 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
212 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
213 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
214 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
215 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
216 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
217 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
218 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
219 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
220 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
221 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
222 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
223 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
224 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
225 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
226 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
227 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
228 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
229 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
230 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
231 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
232 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
233 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
234 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
235 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
236 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
237 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
238 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
239 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
240 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
241 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
242 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
243 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
244 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
245 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
246 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
247 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.6
Metatranscriptomes 0.5
Isolates 12.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.65
Nodule 0
Rhizoplane 0.5
Rhizosphere 71.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10000642 3300013307 Bacteria 38382
2 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
3 SwRhRL2b_contig_1785592 2162886007 Bacteria 28394
4 SwRhRL2b_contig_2693654 2162886007 Bacteria 123938
5 SwRhRL2b_contig_38688 2162886007 Bacteria 22286
6 JGI24740J21852_10000503 3300001979 Bacteria 16803
7 JGI24737J22298_10002164 3300001990 Bacteria 7008
8 JGI24737J22298_10006779 3300001990 Bacteria 3890
9 JGI24735J21928_10000038 3300002067 Bacteria 64134
10 JGI25162J39368_1000047 3300002737 Viruses 167507
11 JGI25162J39368_1000940 3300002737 Bacteria 18700
12 JGI25154J39366_1000004 3300002738 Bacteria 346460
13 JGI25152J39213_1000195 3300002773 Bacteria 40804
14 JGI25150J39212_1000014 3300002774 Bacteria 170955
15 JGI25151J46595_10000042 3300003187 Bacteria 170955
16 JGI25165J46597_1001356 3300003214 Bacteria 13638
17 JGI25153J46596_10000009 3300003215 Bacteria 340925
18 rootH1_10022825 3300003316 Bacteria 10594
19 rootH2_10002048 3300003320 Bacteria 70313
20 rootH2_10013605 3300003320 Bacteria 52813
21 rootL2_10012658 3300003322 Bacteria 11372
22 rootL2_10012659 3300003322 Bacteria 3258
23 rootH1_10003426 3300003323 Bacteria 42703
24 rootH1_10004301 3300003316 Bacteria 2946
25 rootH1_10004301 3300003323 Bacteria 21275
26 rootH1_10050816 3300003323 Bacteria 5399
27 rootH1_10210593 3300003323 Bacteria 6674
28 JGI25160J50197_1004415 3300003354 Bacteria 6095
29 JGI25160J50197_1004554 3300003354 Bacteria 5971
30 Ga0055536_1000019 3300003781 Bacteria 203087
31 Ga0055530_10001246 3300003791 Bacteria 19383
32 Ga0055531_10000171 3300003794 Bacteria 73046
33 Ga0058863_11968118 3300004799 Bacteria 4912
34 Ga0058862_12403007 3300004803 Bacteria 2888
35 Ga0065165_1000060 3300005262 Bacteria 180226
36 Ga0065714_10002525 3300005288 Bacteria 27682
37 Ga0065714_10064969 3300005288 Bacteria 14694
38 Ga0065714_10065104 3300005288 Bacteria 12936
39 Ga0065714_10074878 3300005288 Bacteria 2979
40 Ga0065704_10000195 3300005289 Bacteria 195830
41 Ga0065704_10000301 3300005289 Bacteria 42046
42 Ga0065704_10070132 3300005289 Bacteria 1955461
43 Ga0065704_10075020 3300005289 Bacteria 5840
44 Ga0065704_10081460 3300005289 Bacteria 3741
45 Ga0065704_10083738 3300005289 Bacteria 3425
46 Ga0065715_10003509 3300005293 Bacteria 5698
47 Ga0070658_10000014 3300005327 Bacteria 244978
48 Ga0070658_10079249 3300005327 Bacteria 2697
49 Ga0070676_10000619 3300005328 Bacteria 17345
50 Ga0070683_100129177 3300005329 Bacteria 2390
51 Ga0068868_100046733 3300005338 Bacteria 3389
52 Ga0070660_100004154 3300005339 Bacteria 9997
53 Ga0070660_100006750 3300005339 Bacteria 7963
54 Ga0070673_100004298 3300005364 Bacteria 8997
55 Ga0070659_100000253 3300005366 Bacteria 42218
56 Ga0070659_100023927 3300005366 Bacteria 4679
57 Ga0070714_100085776 3300005435 Bacteria 2751
58 Ga0070713_100215477 3300005436 Bacteria 1740
59 Ga0070662_100000054 3300005457 Bacteria 60719
60 Ga0070681_10004904 3300005458 Bacteria 12846
61 Ga0068853_100006872 3300005539 Bacteria 9077
62 Ga0070665_100000010 3300005548 Bacteria 529545
63 Ga0070665_100002844 3300005548 Bacteria 18745
64 Ga0068855_100000927 3300005563 Bacteria 36472
65 Ga0068855_100003209 3300005563 Bacteria 20016
66 Ga0068855_100036016 3300005563 Bacteria 5892
67 Ga0068855_100161484 3300005563 Bacteria 2543
68 Ga0068856_100000023 3300005614 Bacteria 141671
69 Ga0068856_100023566 3300005614 Bacteria 5985
70 Ga0068856_100095462 3300005614 Bacteria 2961
71 Ga0068856_100102395 3300005614 Bacteria 2857
72 Ga0068856_100113219 3300005614 Bacteria 2711
73 Ga0068852_100001687 3300005616 Bacteria 15044
74 Ga0068851_10000739 3300005834 Bacteria 13977
75 Ga0068870_10025269 3300005840 Bacteria 2947
76 Ga0075366_10003370 3300006195 Bacteria 8415
77 Ga0075366_10025107 3300006195 Bacteria 3478
78 Ga0068871_100004730 3300006358 Bacteria 9526
79 Ga0068865_100000076 3300006881 Bacteria 51732
80 Ga0105244_10000003 3300009036 Bacteria 494610
81 Ga0105240_10000294 3300009093 Bacteria 97108
82 Ga0105240_10113800 3300009093 Bacteria 3269
83 Ga0105240_10135564 3300009093 Bacteria 2949
84 Ga0105243_10021331 3300009148 Bacteria 4916
85 Ga0105241_10003146 3300009174 Bacteria 12277
86 Ga0105242_10060473 3300009176 Bacteria 3113
87 Ga0105242_10087653 3300009176 Bacteria 2613
88 Ga0105237_10000109 3300009545 Bacteria 115699
89 Ga0105237_10000578 3300009545 Bacteria 51257
90 Ga0105237_10000994 3300009545 Bacteria 38153
91 Ga0105237_10016843 3300009545 Bacteria 7585
92 Ga0105237_10103845 3300009545 Bacteria 2834
93 Ga0105238_10093622 3300009551 Bacteria 2993
94 Ga0105239_10000040 3300010375 Bacteria 201445
95 Ga0105239_10000162 3300010375 Bacteria 95804
96 Ga0105239_10020511 3300010375 Bacteria 7289
97 Ga0105239_10028567 3300010375 Bacteria 6132
98 Ga0105239_10214748 3300010375 Bacteria 2156
99 Ga0157373_10000284 3300013100 Bacteria 40521
100 Ga0157373_10002793 3300013100 Bacteria 13213
101 Ga0157373_10003236 3300013100 Bacteria 12311
102 Ga0157373_10006735 3300013100 Bacteria 8552
103 Ga0157373_10010686 3300013100 Bacteria 6752
104 Ga0157373_10087011 3300013100 Bacteria 2202
105 Ga0157371_10000298 3300013102 Bacteria 65719
106 Ga0157371_10000918 3300013102 Bacteria 33144
107 Ga0157371_10001041 3300013102 Bacteria 30406
108 Ga0157371_10001311 3300013102 Bacteria 26152
109 Ga0157371_10017950 3300013102 Bacteria 5243
110 Ga0157371_10021981 3300013102 Bacteria 4682
111 Ga0157371_10034017 3300013102 Bacteria 3660
112 Ga0157370_10000197 3300013104 Bacteria 75846
113 Ga0157370_10000382 3300013104 Bacteria 55802
114 Ga0157370_10038016 3300013104 Bacteria 4659
115 Ga0157370_10095953 3300013104 Bacteria 2782
116 Ga0157369_10000031 3300013105 Bacteria 203214
117 Ga0157369_10001423 3300013105 Bacteria 29363
118 Ga0157369_10072354 3300013105 Bacteria 3700
119 Ga0157374_10000391 3300013296 Bacteria 40035
120 Ga0157374_10003495 3300013296 Bacteria 13206
121 Ga0157374_10012252 3300013296 Bacteria 7455
122 Ga0157374_10062171 3300013296 Bacteria 3499
123 Ga0157378_10068949 3300013297 Bacteria 3172
124 Ga0163162_10000082 3300013306 Bacteria 86888
125 Ga0163162_10000093 3300013306 Bacteria 82738
126 Ga0163162_10027158 3300013306 Bacteria 5659
127 Ga0157372_10000026 3300013307 Bacteria 195407
128 Ga0157372_10000071 3300013307 Bacteria 109638
129 Ga0157372_10012580 3300013307 Bacteria 9011
130 Ga0157372_10041404 3300013307 Bacteria 5094
131 Ga0157375_10143642 3300013308 Bacteria 2516
132 Ga0157375_10170321 3300013308 Bacteria 2325
133 Ga0157380_10000021 3300014326 Bacteria 114368
134 Ga0157380_10000054 3300014326 Bacteria 65705
135 Ga0182008_10000024 3300014497 Bacteria 199978
136 Ga0182008_10000082 3300014497 Bacteria 74716
137 Ga0182008_10000503 3300014497 Bacteria 29456
138 Ga0157377_10048959 3300014745 Bacteria 2374
139 Ga0182006_1000424 3300015261 Bacteria 33825
140 Ga0182006_1001382 3300015261 Bacteria 14763
141 Ga0182006_1002791 3300015261 Bacteria 9323
142 Ga0182006_1003339 3300015261 Bacteria 8263
143 Ga0182007_10000002 3300015262 Bacteria 564661
144 Ga0182007_10009933 3300015262 Bacteria 3792
145 Ga0182005_1000040 3300015265 Bacteria 151222
146 Ga0183373_1004 3300015682 Bacteria 537398
147 Ga0163161_10000831 3300017792 Bacteria 24092
148 Ga0163161_10000856 3300017792 Bacteria 23716
149 Ga0163161_10001453 3300017792 Bacteria 17518
150 Ga0163161_10001812 3300017792 Bacteria 15609
151 Ga0163161_10014594 3300017792 Bacteria 5470
152 Ga0209436_101268 3300025208 Bacteria 9071
153 Ga0207427_100137 3300025231 Bacteria 88182
154 Ga0209437_100089 3300025233 Bacteria 250476
155 Ga0209437_100112 3300025233 Bacteria 214292
156 Ga0209258_100476 3300025242 Bacteria 42226
157 Ga0207425_1000023 3300025245 Bacteria 341339
158 Ga0209646_1000025 3300025246 Bacteria 406493
159 Ga0209026_1000189 3300025250 Bacteria 89924
160 Ga0209026_1003466 3300025250 Bacteria 5156
161 Ga0209148_1000129 3300025254 Bacteria 175720
162 Ga0209129_1000032 3300025258 Bacteria 341150
163 Ga0209233_1000126 3300025261 Bacteria 214298
164 Ga0209455_1008622 3300025272 Bacteria 2755
165 Ga0209130_1001332 3300025284 Bacteria 16720
166 Ga0209676_1000009 3300025292 Bacteria 981719
167 Ga0209676_1000351 3300025292 Bacteria 87135
168 Ga0209025_1000047 3300025294 Bacteria 341150
169 Ga0209758_1000145 3300025297 Bacteria 170553
170 Ga0209050_1000094 3300025298 Bacteria 242893
171 Ga0207426_1000057 3300025302 Bacteria 369548
172 Ga0207426_1000604 3300025302 Bacteria 46749
173 Ga0209257_1000004 3300025304 Bacteria 1678347
174 Ga0209257_1000006 3300025304 Bacteria 1570111
175 Ga0207656_10000115 3300025321 Bacteria 30785
176 Ga0207655_1000010 3300025728 Bacteria 649325
177 Ga0207647_10000046 3300025904 Bacteria 90148
178 Ga0207647_10000617 3300025904 Bacteria 27702
179 Ga0207647_10033547 3300025904 Bacteria 3287
180 Ga0207645_10001668 3300025907 Bacteria 18063
181 Ga0207705_10000107 3300025909 Bacteria 94984
182 Ga0207654_10003529 3300025911 Bacteria 7910
183 Ga0207654_10020448 3300025911 Bacteria 3509
184 Ga0207695_10000142 3300025913 Bacteria 214715
185 Ga0207695_10006220 3300025913 Bacteria 15543
186 Ga0207695_10018989 3300025913 Bacteria 7928
187 Ga0207695_10021471 3300025913 Bacteria 7363
188 Ga0207695_10112816 3300025913 Bacteria 2695
189 Ga0207671_10000063 3300025914 Bacteria 170060
190 Ga0207671_10000407 3300025914 Bacteria 60207
191 Ga0207671_10003029 3300025914 Bacteria 17218
192 Ga0207671_10005221 3300025914 Bacteria 12074
193 Ga0207671_10006948 3300025914 Bacteria 9958
194 Ga0207657_10016593 3300025919 Bacteria 7095
195 Ga0207657_10051242 3300025919 Bacteria 3588
196 Ga0207664_10069251 3300025929 Bacteria 2837
197 Ga0207690_10000293 3300025932 Bacteria 35416
198 Ga0207706_10000669 3300025933 Bacteria 36066
199 Ga0207686_10007074 3300025934 Bacteria 6039
200 Ga0207709_10012838 3300025935 Bacteria 4619
201 Ga0207704_10000169 3300025938 Bacteria 34738
202 Ga0207661_10102425 3300025944 Bacteria 2407
203 Ga0207667_10000015 3300025949 Bacteria 417534
204 Ga0207667_10002558 3300025949 Bacteria 22619
205 Ga0207667_10005697 3300025949 Bacteria 15190
206 Ga0207667_10069562 3300025949 Bacteria 3663
207 Ga0207667_10108810 3300025949 Bacteria 2859
208 Ga0207639_10033656 3300026041 Bacteria 3782
209 Ga0207702_10001259 3300026078 Bacteria 25526
210 Ga0207702_10155054 3300026078 Bacteria 2087
211 Ga0207648_10000220 3300026089 Bacteria 61703
212 Ga0207683_10003089 3300026121 Bacteria 14546
213 Ga0210002_1001131 3300027617 Bacteria 3709
214 Ga0268266_10000032 3300028379 Bacteria 395079
215 Ga0268266_10015425 3300028379 Bacteria 6556
216 Ga0307517_10000429 3300028786 Bacteria 72171
217 Ga0307515_10000226 3300028794 Bacteria 139533
218 Ga0307515_10000507 3300028794 Bacteria 93166
219 Ga0307515_10041837 3300028794 Bacteria 7190
220 Ga0265338_10002045 3300028800 Bacteria 31180
221 Ga0265338_10035591 3300028800 Bacteria 4782
222 Ga0265338_10173311 3300028800 Bacteria 1652
223 Ga0265327_10000338 3300031251 Bacteria 88898
224 Ga0265327_10043374 3300031251 Bacteria 2407
225 Ga0307513_10233389 3300031456 Bacteria 1651
226 Ga0307509_10051189 3300031507 Bacteria 4419
227 Ga0307408_100000602 3300031548 Bacteria 30924
228 Ga0307408_100002002 3300031548 Bacteria 14726
229 Ga0307408_100002436 3300031548 Bacteria 13085
230 Ga0307408_100004578 3300031548 Bacteria 9365
231 Ga0316576_10009716 3300031727 Bacteria 6222
232 Ga0307405_10000015 3300031731 Bacteria 206299
233 Ga0307405_10011401 3300031731 Bacteria 4657
234 Ga0307407_10000027 3300031903 Bacteria 107307
235 Ga0307412_10000030 3300031911 Bacteria 208541
236 Ga0307412_10003168 3300031911 Bacteria 9142
237 Ga0307416_100000002 3300032002 Bacteria 509907
238 Ga0307414_10000038 3300032004 Bacteria 150774
239 Ga0307414_10001228 3300032004 Bacteria 13211
240 Ga0307414_10007266 3300032004 Bacteria 6222
241 Ga0307414_10028893 3300032004 Bacteria 3602
242 Ga0307414_10036885 3300032004 Bacteria 3268
243 Ga0307414_10069492 3300032004 Bacteria 2532
244 Ga0307414_10091575 3300032004 Bacteria 2260
245 Ga0307507_10000023 3300033179 Bacteria 212423
246 Ga0307510_10001152 3300033180 Bacteria 28416
247 Ga0316584_0004789 3300036712 Bacteria 8984
248 Ga0395899_0000034 3300037312 Bacteria 302623
249 Ga0395899_0000055 3300037312 Bacteria 220579
250 Ga0395899_0000084 3300037312 Bacteria 159161
251 Ga0395899_0020990 3300037312 Bacteria 4953
252 Ga0395900_0000194 3300037418 Bacteria 97768
253 Ga0395900_0008131 3300037418 Bacteria 10800
254 Ga0395900_0036640 3300037418 Bacteria 5057
255 Ga0395905_0000003 3300037471 Bacteria 1347396
256 Ga0395905_0000340 3300037471 Bacteria 66412
257 Ga0395905_0003171 3300037471 Bacteria 17718
258 Ga0395905_0022429 3300037471 Bacteria 5971
259 Ga0400483_174860 3300039062 Bacteria 22336
260 Ga0451577_0003251 3300042876 Bacteria 18269
261 Ga0466966_0010875 3300044684 Bacteria 6044
262 Ga0453684_0001838 3300044712 Bacteria 55467
263 Ga0453684_0003191 3300044712 Bacteria 37570
264 Ga0453684_0004741 3300044712 Bacteria 28097
265 Ga0453684_0015662 3300044712 Bacteria 11950
266 Ga0453684_0055232 3300044712 Bacteria 5165
267 Ga0453684_0095703 3300044712 Bacteria 3649
268 Ga0453684_0108580 3300044712 Bacteria 3376
269 Ga0466959_0017617 3300045049 Bacteria 5238
270 Ga0466959_0034565 3300045049 Bacteria 3739
271 Ga0451576_0000020 3300045051 Bacteria 529568
272 Ga0451576_0000625 3300045051 Bacteria 73634
273 Ga0451576_0020091 3300045051 Bacteria 7280
274 Ga0495627_004478 3300046453 Bacteria 5843
275 Ga0495627_018500 3300046453 Bacteria 2347
276 Ga0495650_0000198 3300046471 Bacteria 130455
277 Ga0495585_0000391 3300046492 Bacteria 42399
278 Ga0495606_0000003 3300046507 Bacteria 449402
279 Ga0495606_0007202 3300046507 Bacteria 10030
280 Ga0495606_0046189 3300046507 Bacteria 2880
281 Ga0495610_0000197 3300046512 Bacteria 67429
282 Ga0495610_0002942 3300046512 Bacteria 13760
283 Ga0495616_0006818 3300046513 Bacteria 6884
284 Ga0495631_0009584 3300046518 Bacteria 4831
285 Ga0495637_0033578 3300046520 Bacteria 2252
286 Ga0495644_0005095 3300046523 Bacteria 5142
287 Ga0495586_0030350 3300046535 Bacteria 2893
288 Ga0495609_0009453 3300046538 Bacteria 4715
289 Ga0495633_0000017 3300046558 Bacteria 249973
290 Ga0495633_0000267 3300046558 Bacteria 61184
291 Ga0495633_0003424 3300046558 Bacteria 10562
292 Ga0495668_0000010 3300046616 Bacteria 487308
293 Ga0495625_0000524 3300046660 Bacteria 56526
294 Ga0495625_0010537 3300046660 Bacteria 7635
295 Ga0495625_0013186 3300046660 Bacteria 6657
296 Ga0495625_0017936 3300046660 Bacteria 5532
297 Ga0495661_0000778 3300046665 Bacteria 30455
298 Ga0495661_0006247 3300046665 Bacteria 8376
299 Ga0495649_0000168 3300046694 Bacteria 57053
300 Ga0495683_0038225 3300047323 Bacteria 2431
301 Ga0495687_001711 3300047443 Bacteria 19448
302 Ga0495687_032152 3300047443 Bacteria 2399
303 Ga0495686_0000845 3300047472 Bacteria 39321
304 Ga0495686_0002919 3300047472 Bacteria 15334
305 Ga0495686_0079601 3300047472 Bacteria 2004
306 Ga0495614_0043223 3300048089 Bacteria 1932
307 Ga0496115_0009216 3300048918 Bacteria 7328
308 Ga0496121_0000010 3300048924 Bacteria 793488
309 Ga0496122_0000869 3300048925 Bacteria 56890
310 Ga0496124_0016764 3300048927 Bacteria 6948
311 Ga0496125_0001552 3300048928 Bacteria 32788
312 Ga0496126_0010572 3300048929 Bacteria 9652
313 Ga0496126_0013000 3300048929 Bacteria 8495
314 Ga0501031_0000669 3300049568 Bacteria 20380
315 Ga0501032_0003006 3300049569 Bacteria 13083
316 Ga0501033_0000005 3300049570 Bacteria 379089
317 Ga0501034_0000052 3300049571 Bacteria 207572
318 Ga0501034_0029160 3300049571 Bacteria 5610
319 Ga0501037_0004892 3300049573 Bacteria 9745
320 Ga0501038_0002931 3300049574 Bacteria 15917
321 Ga0501039_0008402 3300049575 Bacteria 7869
322 Ga0501043_0002243 3300049579 Bacteria 16460
323 Ga0501047_0056643 3300049581 Bacteria 3791
324 Ga0501223_000806 3300049663 Bacteria 7419
325 Ga0501223_001917 3300049663 Bacteria 4676
326 Ga0501257_002934 3300049686 Bacteria 3623
327 Ga0501259_001902 3300049688 Bacteria 3458
328 Ga0501241_001051 3300049758 Bacteria 5829
329 Ga0501264_000564 3300049761 Bacteria 5364
330 Ga0501035_0004866 3300049822 Bacteria 12739
331 Ga0501044_0001723 3300049823 Bacteria 25593
332 Ga0501045_0011792 3300049824 Bacteria 6140
333 nmdc:mga0k408_156_c2 3300050493 Bacteria 15182
334 Ga0500635_0001979 3300053080 Bacteria 5003
335 Ga0500644_0000491 3300053088 Bacteria 17275
336 Ga0500644_0006977 3300053088 Bacteria 2921
337 Ga0500651_0000455 3300053093 Bacteria 21853
338 Ga0500641_0000119 3300053096 Bacteria 30093
339 Ga0500562_000055 3300053108 Bacteria 58655
340 Ga0500569_000961 3300053109 Bacteria 5183
341 Ga0500618_000489 3300053125 Bacteria 25319
342 Ga0500658_0003022 3300053134 Bacteria 6452
343 Ga0500577_0002420 3300053142 Bacteria 4770
344 Ga0500604_0005011 3300053151 Bacteria 3506
345 Ga0500622_0000041 3300053156 Bacteria 170067
346 Ga0500622_0000045 3300053156 Bacteria 158316
347 Ga0500622_0000059 3300053156 Bacteria 134223
348 Ga0500622_0002792 3300053156 Bacteria 12270
349 Ga0500622_0016378 3300053156 Bacteria 3962
350 Ga0500624_000278 3300053157 Bacteria 17649
351 Ga0500636_0035545 3300053177 Bacteria 2948
352 Ga0500661_000611 3300055283 Bacteria 6689
353 2522548252 2522125168 Bacteria 7376607
354 2524000871 2523533628 Bacteria 4098242
355 2586206310 2585427687 Bacteria 5544917
356 2599479059 2599185184 Bacteria 6430550
357 2738755404 2738541283 Bacteria 7222293
358 2738763541 2738541284 Bacteria 5199923
359 2738856143 2738541302 Bacteria 5944758
360 2739303238 2738543023 Bacteria 6767879
361 2739588296 2739367651 Bacteria 6359826
362 2739613926 2739367656 Bacteria 5152243
363 2739648577 2739367663 Bacteria 5040914
364 2776615021 2775506987 Bacteria 5373360
365 2819546278 2818991437 Bacteria 5805520
366 2819572090 2818991442 Bacteria 8318214
367 2819586696 2818991444 Bacteria 6968812
368 2821141667 2821136567 Bacteria 8080116
369 2840677935 2840677318 Bacteria 2664183
370 2842723891 2842722452 Bacteria 6263924
371 2842912377 2842909656 Bacteria 6185908
372 2849282804 2849281842 Bacteria 6065644
373 2852624884 2852623160 Bacteria 4376875
374 2852629521 2852627209 Bacteria 5896285
375 2857629279 2857627736 Bacteria 5625397
376 2883070897 2883068021 Bacteria 6192739
377 2884637803 2884634485 Bacteria 3928637
378 2884797796 2884791551 Bacteria 8511252
379 2884936221 2884933994 Bacteria 4535041
380 2896085752 2896085136 Bacteria 6129793
381 2896113990 2896109856 Bacteria 7140722
382 2902051351 2902048731 Bacteria 4976191
383 2904446549 2904445276 Bacteria 5310396
384 2904469919 2904467357 Bacteria 8057758
385 2911142703 2911138879 Bacteria 5811561
386 2919190255 2919186247 Bacteria 6244071
387 2919442743 2919437846 Bacteria 6199444
388 2919512405 2919509842 Bacteria 4104664
389 2919696781 2919692658 Bacteria 5943958
390 2928082627 2928078545 Bacteria 6534839
391 2928148786 2928147474 Bacteria 6512076
392 2929155381 2929154850 Bacteria 6753285
393 2929245275 2929239360 Bacteria 7745570
394 2929927506 2929921140 Bacteria 8649150
395 2932086416 2932082852 Bacteria 6563563
396 2939668536 2939664404 Bacteria 6364494
397 2945999360 2945997725 Bacteria 6404843
398 2954021757 2954016120 Bacteria 6446024
399 2958515918 2958512119 Bacteria 4528530
400 2965323609 2965320100 Bacteria 3975600
401 2977235783 2977232053 Bacteria 5485925
402 8003151359 8003151029 Bacteria 8187759
403 8015557277 8015556637 Bacteria 3582323
404 8056444587 8056440228 Bacteria 4946504
405 Ga0157372_10000642
406 SwRhRL2b_contig_1761633
407 SwRhRL2b_contig_1785592
408 SwRhRL2b_contig_2693654
409 SwRhRL2b_contig_38688
410 JGI24740J21852_10000503
411 JGI24737J22298_10002164
412 JGI24737J22298_10006779
413 JGI24735J21928_10000038
414 JGI25162J39368_1000047
415 JGI25162J39368_1000940
416 JGI25154J39366_1000004
417 JGI25152J39213_1000195
418 JGI25150J39212_1000014
419 JGI25151J46595_10000042
420 JGI25165J46597_1001356
421 JGI25153J46596_10000009
422 rootH1_10022825
423 rootH2_10002048
424 rootH2_10013605
425 rootL2_10012658
426 rootL2_10012659
427 rootH1_10003426
428 rootH1_10004301
429 rootH1_10050816
430 rootH1_10210593
431 JGI25160J50197_1004415
432 JGI25160J50197_1004554
433 Ga0055536_1000019
434 Ga0055530_10001246
435 Ga0055531_10000171
436 Ga0058863_11968118
437 Ga0058862_12403007
438 Ga0065165_1000060
439 Ga0065714_10002525
440 Ga0065714_10064969
441 Ga0065714_10065104
442 Ga0065714_10074878
443 Ga0065704_10000195
444 Ga0065704_10000301
445 Ga0065704_10070132
446 Ga0065704_10075020
447 Ga0065704_10081460
448 Ga0065704_10083738
449 Ga0065715_10003509
450 Ga0070658_10000014
451 Ga0070658_10079249
452 Ga0070676_10000619
453 Ga0070683_100129177
454 Ga0068868_100046733
455 Ga0070660_100004154
456 Ga0070660_100006750
457 Ga0070673_100004298
458 Ga0070659_100000253
459 Ga0070659_100023927
460 Ga0070714_100085776
461 Ga0070713_100215477
462 Ga0070662_100000054
463 Ga0070681_10004904
464 Ga0068853_100006872
465 Ga0070665_100000010
466 Ga0070665_100002844
467 Ga0068855_100000927
468 Ga0068855_100003209
469 Ga0068855_100036016
470 Ga0068855_100161484
471 Ga0068856_100000023
472 Ga0068856_100023566
473 Ga0068856_100095462
474 Ga0068856_100102395
475 Ga0068856_100113219
476 Ga0068852_100001687
477 Ga0068851_10000739
478 Ga0068870_10025269
479 Ga0075366_10003370
480 Ga0075366_10025107
481 Ga0068871_100004730
482 Ga0068865_100000076
483 Ga0105244_10000003
484 Ga0105240_10000294
485 Ga0105240_10113800
486 Ga0105240_10135564
487 Ga0105243_10021331
488 Ga0105241_10003146
489 Ga0105242_10060473
490 Ga0105242_10087653
491 Ga0105237_10000109
492 Ga0105237_10000578
493 Ga0105237_10000994
494 Ga0105237_10016843
495 Ga0105237_10103845
496 Ga0105238_10093622
497 Ga0105239_10000040
498 Ga0105239_10000162
499 Ga0105239_10020511
500 Ga0105239_10028567
501 Ga0105239_10214748
502 Ga0157373_10000284
503 Ga0157373_10002793
504 Ga0157373_10003236
505 Ga0157373_10006735
506 Ga0157373_10010686
507 Ga0157373_10087011
508 Ga0157371_10000298
509 Ga0157371_10000918
510 Ga0157371_10001041
511 Ga0157371_10001311
512 Ga0157371_10017950
513 Ga0157371_10021981
514 Ga0157371_10034017
515 Ga0157370_10000197
516 Ga0157370_10000382
517 Ga0157370_10038016
518 Ga0157370_10095953
519 Ga0157369_10000031
520 Ga0157369_10001423
521 Ga0157369_10072354
522 Ga0157374_10000391
523 Ga0157374_10003495
524 Ga0157374_10012252
525 Ga0157374_10062171
526 Ga0157378_10068949
527 Ga0163162_10000082
528 Ga0163162_10000093
529 Ga0163162_10027158
530 Ga0157372_10000026
531 Ga0157372_10000071
532 Ga0157372_10012580
533 Ga0157372_10041404
534 Ga0157375_10143642
535 Ga0157375_10170321
536 Ga0157380_10000021
537 Ga0157380_10000054
538 Ga0182008_10000024
539 Ga0182008_10000082
540 Ga0182008_10000503
541 Ga0157377_10048959
542 Ga0182006_1000424
543 Ga0182006_1001382
544 Ga0182006_1002791
545 Ga0182006_1003339
546 Ga0182007_10000002
547 Ga0182007_10009933
548 Ga0182005_1000040
549 Ga0183373_1004
550 Ga0163161_10000831
551 Ga0163161_10000856
552 Ga0163161_10001453
553 Ga0163161_10001812
554 Ga0163161_10014594
555 Ga0209436_101268
556 Ga0207427_100137
557 Ga0209437_100089
558 Ga0209437_100112
559 Ga0209258_100476
560 Ga0207425_1000023
561 Ga0209646_1000025
562 Ga0209026_1000189
563 Ga0209026_1003466
564 Ga0209148_1000129
565 Ga0209129_1000032
566 Ga0209233_1000126
567 Ga0209455_1008622
568 Ga0209130_1001332
569 Ga0209676_1000009
570 Ga0209676_1000351
571 Ga0209025_1000047
572 Ga0209758_1000145
573 Ga0209050_1000094
574 Ga0207426_1000057
575 Ga0207426_1000604
576 Ga0209257_1000004
577 Ga0209257_1000006
578 Ga0207656_10000115
579 Ga0207655_1000010
580 Ga0207647_10000046
581 Ga0207647_10000617
582 Ga0207647_10033547
583 Ga0207645_10001668
584 Ga0207705_10000107
585 Ga0207654_10003529
586 Ga0207654_10020448
587 Ga0207695_10000142
588 Ga0207695_10006220
589 Ga0207695_10018989
590 Ga0207695_10021471
591 Ga0207695_10112816
592 Ga0207671_10000063
593 Ga0207671_10000407
594 Ga0207671_10003029
595 Ga0207671_10005221
596 Ga0207671_10006948
597 Ga0207657_10016593
598 Ga0207657_10051242
599 Ga0207664_10069251
600 Ga0207690_10000293
601 Ga0207706_10000669
602 Ga0207686_10007074
603 Ga0207709_10012838
604 Ga0207704_10000169
605 Ga0207661_10102425
606 Ga0207667_10000015
607 Ga0207667_10002558
608 Ga0207667_10005697
609 Ga0207667_10069562
610 Ga0207667_10108810
611 Ga0207639_10033656
612 Ga0207702_10001259
613 Ga0207702_10155054
614 Ga0207648_10000220
615 Ga0207683_10003089
616 Ga0210002_1001131
617 Ga0268266_10000032
618 Ga0268266_10015425
619 Ga0307517_10000429
620 Ga0307515_10000226
621 Ga0307515_10000507
622 Ga0307515_10041837
623 Ga0265338_10002045
624 Ga0265338_10035591
625 Ga0265338_10173311
626 Ga0265327_10000338
627 Ga0265327_10043374
628 Ga0307513_10233389
629 Ga0307509_10051189
630 Ga0307408_100000602
631 Ga0307408_100002002
632 Ga0307408_100002436
633 Ga0307408_100004578
634 Ga0316576_10009716
635 Ga0307405_10000015
636 Ga0307405_10011401
637 Ga0307407_10000027
638 Ga0307412_10000030
639 Ga0307412_10003168
640 Ga0307416_100000002
641 Ga0307414_10000038
642 Ga0307414_10001228
643 Ga0307414_10007266
644 Ga0307414_10028893
645 Ga0307414_10036885
646 Ga0307414_10069492
647 Ga0307414_10091575
648 Ga0307507_10000023
649 Ga0307510_10001152
650 Ga0316584_0004789
651 Ga0395899_0000034
652 Ga0395899_0000055
653 Ga0395899_0000084
654 Ga0395899_0020990
655 Ga0395900_0000194
656 Ga0395900_0008131
657 Ga0395900_0036640
658 Ga0395905_0000003
659 Ga0395905_0000340
660 Ga0395905_0003171
661 Ga0395905_0022429
662 Ga0400483_174860
663 Ga0451577_0003251
664 Ga0466966_0010875
665 Ga0453684_0001838
666 Ga0453684_0003191
667 Ga0453684_0004741
668 Ga0453684_0015662
669 Ga0453684_0055232
670 Ga0453684_0095703
671 Ga0453684_0108580
672 Ga0466959_0017617
673 Ga0466959_0034565
674 Ga0451576_0000020
675 Ga0451576_0000625
676 Ga0451576_0020091
677 Ga0495627_004478
678 Ga0495627_018500
679 Ga0495650_0000198
680 Ga0495585_0000391
681 Ga0495606_0000003
682 Ga0495606_0007202
683 Ga0495606_0046189
684 Ga0495610_0000197
685 Ga0495610_0002942
686 Ga0495616_0006818
687 Ga0495631_0009584
688 Ga0495637_0033578
689 Ga0495644_0005095
690 Ga0495586_0030350
691 Ga0495609_0009453
692 Ga0495633_0000017
693 Ga0495633_0000267
694 Ga0495633_0003424
695 Ga0495668_0000010
696 Ga0495625_0000524
697 Ga0495625_0010537
698 Ga0495625_0013186
699 Ga0495625_0017936
700 Ga0495661_0000778
701 Ga0495661_0006247
702 Ga0495649_0000168
703 Ga0495683_0038225
704 Ga0495687_001711
705 Ga0495687_032152
706 Ga0495686_0000845
707 Ga0495686_0002919
708 Ga0495686_0079601
709 Ga0495614_0043223
710 Ga0496115_0009216
711 Ga0496121_0000010
712 Ga0496122_0000869
713 Ga0496124_0016764
714 Ga0496125_0001552
715 Ga0496126_0010572
716 Ga0496126_0013000
717 Ga0501031_0000669
718 Ga0501032_0003006
719 Ga0501033_0000005
720 Ga0501034_0000052
721 Ga0501034_0029160
722 Ga0501037_0004892
723 Ga0501038_0002931
724 Ga0501039_0008402
725 Ga0501043_0002243
726 Ga0501047_0056643
727 Ga0501223_000806
728 Ga0501223_001917
729 Ga0501257_002934
730 Ga0501259_001902
731 Ga0501241_001051
732 Ga0501264_000564
733 Ga0501035_0004866
734 Ga0501044_0001723
735 Ga0501045_0011792
736 nmdc:mga0k408_156_c2
737 Ga0500635_0001979
738 Ga0500644_0000491
739 Ga0500644_0006977
740 Ga0500651_0000455
741 Ga0500641_0000119
742 Ga0500562_000055
743 Ga0500569_000961
744 Ga0500618_000489
745 Ga0500658_0003022
746 Ga0500577_0002420
747 Ga0500604_0005011
748 Ga0500622_0000041
749 Ga0500622_0000045
750 Ga0500622_0000059
751 Ga0500622_0002792
752 Ga0500622_0016378
753 Ga0500624_000278
754 Ga0500636_0035545
755 Ga0500661_000611
756 2522548252
757 2524000871
758 2586206310
759 2599479059
760 2738755404
761 2738763541
762 2738856143
763 2739303238
764 2739588296
765 2739613926
766 2739648577
767 2776615021
768 2819546278
769 2819572090
770 2819586696
771 2821141667
772 2840677935
773 2842723891
774 2842912377
775 2849282804
776 2852624884
777 2852629521
778 2857629279
779 2883070897
780 2884637803
781 2884797796
782 2884936221
783 2896085752
784 2896113990
785 2902051351
786 2904446549
787 2904469919
788 2911142703
789 2919190255
790 2919442743
791 2919512405
792 2919696781
793 2928082627
794 2928148786
795 2929155381
796 2929245275
797 2929927506
798 2932086416
799 2939668536
800 2945999360
801 2954021757
802 2958515918
803 2965323609
804 2977235783
805 8003151359
806 8015557277
807 8056444587

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00958

GMP_synt_C

GMP synthase C terminal domain

463

554

0.99

PF00117

GATase

Glutamine amidotransferase class-I

52

233

0.95

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

260

325

0.86

PF02540

NAD_synthase

NAD synthase

244

342

0.83

PF07722

Peptidase_C26

Peptidase C26

112

215

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a4i-assembly1.cif.gz_B crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 0.9481 199 512
2dpl-assembly1.cif.gz_B crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.943 203 512
2dpl-assembly1.cif.gz_A crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.9409 199 512
3a4i-assembly1.cif.gz_B crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 0.9385 199 512
2dpl-assembly1.cif.gz_B crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.9365 203 512
ID Description Score Start End Superfamily
2ywcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9453 196 387 3.40.50.620
2dplA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9412 199 387 3.40.50.620
2ywcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9401 196 387 3.40.50.620
af_Q2G0Y6_200_393_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9384 198 391 3.40.50.620
af_Q2G0Y6_200_393_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9291 198 391 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3C0EJG3-F1-model_v4 GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) 0.9752 363 504 GO:0003921
GO:0005524
GO:0005829
AF-A0A7V2X9Y9-F1-model_v4 ExsB family transcriptional regulator 0.9721 200 286 GO:0003921
GO:0005524
GO:0005829
AF-X1ISV3-F1-model_v4 GMPS ATP-PPase domain-containing protein 0.9709 183 324 GO:0003921
GO:0005524
GO:0005829
AF-A0A3C0EJG3-F1-model_v4 GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) 0.9685 363 504 GO:0003921
GO:0005524
GO:0005829
AF-A0A641V1T5-F1-model_v4 deleted 0.9658 1 155

Map