F435397

General Info

Members Datasets Scaffolds Average Seq Length
403 192 401 171

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10938404|Ga0157377_109384041
Length 197
Sequence LARGYWAFEKKENLLVYLPGKSLRMTVNKKAEVWLRGPLPGILPALQPVAHALLQAREELNELTKDFPDALLWNQPAGMASVGFHLEHMAGVLDRLFTYAKGELLSAQQLQALQEEGKPKPQEVTASILVAQFNNQVELSLAHIKNTPEEGLFETRSVGRARIPSTVLGKLVHAAEHTMRHLGQLLVTVKVVKSGRL

Samples

Sample ID Description Type Environment
1 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 0.5
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10075496 3300001991 Bacteria 707
2 JGI24744J21845_10006759 3300002077 Bacteria 2373
3 JGI25162J39368_1000012 3300002737 Bacteria 373191
4 rootL2_10021352 3300003322 Bacteria 2226
5 rootL2_10121507 3300003322 Bacteria 1713
6 Ga0065714_10301353 3300005288 Bacteria 694
7 Ga0065704_10192035 3300005289 Bacteria 1185
8 Ga0070676_10000225 3300005328 Bacteria 24165
9 Ga0070683_100057285 3300005329 Bacteria 3620
10 Ga0070683_100971695 3300005329 Unclassified 815
11 Ga0070670_100007515 3300005331 Bacteria 9251
12 Ga0070670_100211552 3300005331 Unclassified 1686
13 Ga0070677_10371451 3300005333 Unclassified 746
14 Ga0070677_10429285 3300005333 Bacteria 702
15 Ga0068869_100011799 3300005334 Bacteria 5747
16 Ga0068869_100064199 3300005334 Bacteria 2700
17 Ga0068869_100117994 3300005334 Bacteria 2026
18 Ga0070666_10000036 3300005335 Bacteria 119230
19 Ga0070666_10054134 3300005335 Bacteria 2707
20 Ga0070680_100042718 3300005336 Bacteria 3680
21 Ga0070680_100343290 3300005336 Bacteria 1269
22 Ga0070682_100058308 3300005337 Bacteria 2435
23 Ga0068868_100003873 3300005338 Bacteria 10445
24 Ga0068868_100004676 3300005338 Bacteria 9615
25 Ga0068868_100008703 3300005338 Bacteria 7267
26 Ga0070660_100132626 3300005339 Bacteria 1995
27 Ga0070660_100235906 3300005339 Archaea 1489
28 Ga0070689_100174238 3300005340 Bacteria 1744
29 Ga0070687_100030677 3300005343 Bacteria 2630
30 Ga0070661_100097989 3300005344 Bacteria 2177
31 Ga0070661_100165199 3300005344 Unclassified 1678
32 Ga0070668_100003558 3300005347 Bacteria 11486
33 Ga0070668_100261191 3300005347 Bacteria 1440
34 Ga0070668_100300865 3300005347 Bacteria 1345
35 Ga0070669_100028419 3300005353 Bacteria 4027
36 Ga0070675_100007418 3300005354 Bacteria 8472
37 Ga0070671_100049533 3300005355 Bacteria 3495
38 Ga0070671_100144640 3300005355 Bacteria 2007
39 Ga0070671_100321848 3300005355 Bacteria 1318
40 Ga0070673_100003988 3300005364 Bacteria 9288
41 Ga0070673_100031436 3300005364 Bacteria 3983
42 Ga0070673_100050914 3300005364 Bacteria 3240
43 Ga0070673_101125884 3300005364 Unclassified 734
44 Ga0070659_100031210 3300005366 Bacteria 4126
45 Ga0070659_100042926 3300005366 Bacteria 3536
46 Ga0070659_100363695 3300005366 Bacteria 1216
47 Ga0070667_100001551 3300005367 Bacteria 20596
48 Ga0070667_100023710 3300005367 Bacteria 5094
49 Ga0070667_100704527 3300005367 Unclassified 934
50 Ga0070667_100850865 3300005367 Archaea 848
51 Ga0070701_10007575 3300005438 Bacteria 4648
52 Ga0070701_10163806 3300005438 Bacteria 1290
53 Ga0070711_100555761 3300005439 Unclassified 953
54 Ga0070700_100004652 3300005441 Bacteria 7190
55 Ga0070700_100461110 3300005441 Unclassified 969
56 Ga0070700_100841793 3300005441 Bacteria 742
57 Ga0070663_100037590 3300005455 Bacteria 3371
58 Ga0070678_100315090 3300005456 Unclassified 1334
59 Ga0070681_10001156 3300005458 Bacteria 22806
60 Ga0068867_100003538 3300005459 Bacteria 10981
61 Ga0068867_100320084 3300005459 Bacteria 1285
62 Ga0068867_100353504 3300005459 Archaea 1227
63 Ga0070685_10259267 3300005466 Bacteria 1155
64 Ga0070698_100084240 3300005471 Bacteria 3167
65 Ga0070698_100872232 3300005471 Archaea 845
66 Ga0070679_100139373 3300005530 Bacteria 2406
67 Ga0070679_100159257 3300005530 Bacteria 2232
68 Ga0070684_100014193 3300005535 Bacteria 6444
69 Ga0070684_100165351 3300005535 Unclassified 2008
70 Ga0070684_100187903 3300005535 Bacteria 1879
71 Ga0070684_100448506 3300005535 Unclassified 1192
72 Ga0070684_100688113 3300005535 Bacteria 953
73 Ga0068853_100026177 3300005539 Bacteria 4898
74 Ga0068853_100124898 3300005539 Bacteria 2298
75 Ga0068853_100326299 3300005539 Bacteria 1424
76 Ga0070672_100014499 3300005543 Bacteria 5588
77 Ga0070672_100048769 3300005543 Bacteria 3292
78 Ga0070672_100152368 3300005543 Unclassified 1913
79 Ga0070672_100356904 3300005543 Bacteria 1247
80 Ga0070686_100090474 3300005544 Bacteria 2046
81 Ga0070696_100953036 3300005546 Unclassified 714
82 Ga0070665_100701929 3300005548 Bacteria 1025
83 Ga0068855_100000506 3300005563 Bacteria 48223
84 Ga0068855_100024540 3300005563 Bacteria 7214
85 Ga0068855_100034688 3300005563 Bacteria 6014
86 Ga0068855_100150146 3300005563 Bacteria 2650
87 Ga0068855_100850097 3300005563 Unclassified 967
88 Ga0070664_100014906 3300005564 Bacteria 6342
89 Ga0070664_100026602 3300005564 Bacteria 4800
90 Ga0070664_100047500 3300005564 Unclassified 3626
91 Ga0070664_100444821 3300005564 Bacteria 1189
92 Ga0068857_100012325 3300005577 Bacteria 7441
93 Ga0068857_100025033 3300005577 Bacteria 5257
94 Ga0068857_100067502 3300005577 Bacteria 3183
95 Ga0068854_100016923 3300005578 Bacteria 4870
96 Ga0068854_100055911 3300005578 Bacteria 2843
97 Ga0068854_101021282 3300005578 Bacteria 733
98 Ga0068856_100033708 3300005614 Bacteria 5015
99 Ga0068856_100196536 3300005614 Bacteria 2031
100 Ga0068852_100001292 3300005616 Bacteria 16731
101 Ga0068852_100057742 3300005616 Bacteria 3359
102 Ga0068852_100322965 3300005616 Unclassified 1499
103 Ga0068859_100000037 3300005617 Bacteria 165480
104 Ga0068859_100063224 3300005617 Bacteria 3732
105 Ga0068859_100168538 3300005617 Bacteria 2270
106 Ga0068859_100862750 3300005617 Bacteria 991
107 Ga0068864_100009987 3300005618 Bacteria 7833
108 Ga0068864_100012240 3300005618 Bacteria 7090
109 Ga0068864_100226076 3300005618 Bacteria 1729
110 Ga0068861_100002089 3300005719 Bacteria 12949
111 Ga0068861_100230309 3300005719 Bacteria 1571
112 Ga0068851_10020445 3300005834 Unclassified 3207
113 Ga0068851_10056650 3300005834 Bacteria 2000
114 Ga0068870_10058543 3300005840 Bacteria 2063
115 Ga0068870_10363560 3300005840 Archaea 932
116 Ga0068863_100011860 3300005841 Bacteria 8424
117 Ga0068863_100016628 3300005841 Bacteria 7059
118 Ga0068863_100251583 3300005841 Unclassified 1707
119 Ga0068858_100010814 3300005842 Bacteria 8628
120 Ga0068858_100426890 3300005842 Bacteria 1275
121 Ga0068860_100002354 3300005843 Bacteria 19854
122 Ga0068860_100004043 3300005843 Bacteria 15061
123 Ga0068860_100173312 3300005843 Bacteria 2084
124 Ga0068862_100001130 3300005844 Bacteria 25337
125 Ga0068862_100057403 3300005844 Bacteria 3338
126 Ga0075369_10442215 3300006186 Bacteria 615
127 Ga0097621_100000909 3300006237 Bacteria 20674
128 Ga0097621_100330016 3300006237 Bacteria 1353
129 Ga0068871_100000653 3300006358 Bacteria 23842
130 Ga0068871_100408768 3300006358 Archaea 1210
131 Ga0075428_100172859 3300006844 Bacteria 2341
132 Ga0075430_100171847 3300006846 Bacteria 1803
133 Ga0075430_100676060 3300006846 Bacteria 851
134 Ga0075431_100154898 3300006847 Unclassified 2358
135 Ga0075431_100191802 3300006847 Bacteria 2093
136 Ga0075433_10024658 3300006852 Bacteria 5080
137 Ga0075433_10246912 3300006852 Unclassified 1584
138 Ga0075434_100046151 3300006871 Bacteria 4324
139 Ga0068865_100000049 3300006881 Bacteria 65689
140 Ga0068865_100015493 3300006881 Bacteria 4863
141 Ga0097620_100000037 3300006931 Bacteria 165480
142 Ga0097620_100063224 3300006931 Bacteria 3732
143 Ga0097620_100168539 3300006931 Bacteria 2270
144 Ga0097620_100862669 3300006931 Bacteria 991
145 Ga0075435_100152116 3300007076 Bacteria 1946
146 Ga0075435_100340461 3300007076 Bacteria 1285
147 Ga0105240_10052686 3300009093 Bacteria 5113
148 Ga0105240_10256349 3300009093 Bacteria 2020
149 Ga0105240_10360139 3300009093 Bacteria 1648
150 Ga0105240_10965472 3300009093 Bacteria 913
151 Ga0111539_10311479 3300009094 Bacteria 1832
152 Ga0105247_10045005 3300009101 Bacteria 2708
153 Ga0114129_10184901 3300009147 Bacteria 2833
154 Ga0114129_10449832 3300009147 Bacteria 1689
155 Ga0105241_10000763 3300009174 Bacteria 24480
156 Ga0105241_10014971 3300009174 Bacteria 5680
157 Ga0105241_10040728 3300009174 Bacteria 3508
158 Ga0105241_10062061 3300009174 Bacteria 2880
159 Ga0105241_10341785 3300009174 Bacteria 1297
160 Ga0105242_10034818 3300009176 Bacteria 4037
161 Ga0105242_10116354 3300009176 Bacteria 2287
162 Ga0105248_10012503 3300009177 Bacteria 9363
163 Ga0105248_10185687 3300009177 Bacteria 2343
164 Ga0105237_10001979 3300009545 Bacteria 26062
165 Ga0105237_10004376 3300009545 Bacteria 16371
166 Ga0105237_10024043 3300009545 Bacteria 6233
167 Ga0105237_10077485 3300009545 Bacteria 3314
168 Ga0105237_10180539 3300009545 Bacteria 2111
169 Ga0105249_10000733 3300009553 Bacteria 29716
170 Ga0105249_10001080 3300009553 Bacteria 24205
171 Ga0105249_10006300 3300009553 Bacteria 10308
172 Ga0105249_10010756 3300009553 Bacteria 8040
173 Ga0105239_10000163 3300010375 Bacteria 95477
174 Ga0105239_10007238 3300010375 Bacteria 12748
175 Ga0105239_10009346 3300010375 Bacteria 11064
176 Ga0105239_10009934 3300010375 Bacteria 10684
177 Ga0105239_10349960 3300010375 Bacteria 1668
178 Ga0105239_10498103 3300010375 Bacteria 1385
179 Ga0105246_10120242 3300011119 Bacteria 1945
180 Ga0157373_10002565 3300013100 Bacteria 13803
181 Ga0157371_10006099 3300013102 Bacteria 10023
182 Ga0157371_10490201 3300013102 Unclassified 907
183 Ga0157370_11706117 3300013104 Unclassified 565
184 Ga0157369_10023573 3300013105 Bacteria 6854
185 Ga0157369_10304918 3300013105 Bacteria 1656
186 Ga0157374_10004451 3300013296 Bacteria 11775
187 Ga0157374_10023531 3300013296 Bacteria 5511
188 Ga0157374_10427702 3300013296 Bacteria 1323
189 Ga0157374_10675183 3300013296 Bacteria 1045
190 Ga0157378_10003777 3300013297 Bacteria 13417
191 Ga0157378_10017949 3300013297 Bacteria 6212
192 Ga0157378_10064322 3300013297 Bacteria 3281
193 Ga0157378_10087057 3300013297 Bacteria 2833
194 Ga0157378_10244377 3300013297 Bacteria 1716
195 Ga0157378_11656327 3300013297 Archaea 686
196 Ga0163162_10000241 3300013306 Bacteria 49773
197 Ga0163162_10003629 3300013306 Bacteria 14799
198 Ga0163162_10003639 3300013306 Bacteria 14775
199 Ga0163162_10044091 3300013306 Bacteria 4466
200 Ga0157372_10049110 3300013307 Bacteria 4691
201 Ga0157372_10545613 3300013307 Bacteria 1351
202 Ga0157375_10006360 3300013308 Bacteria 10295
203 Ga0157375_10016854 3300013308 Bacteria 6577
204 Ga0157375_10148756 3300013308 Bacteria 2475
205 Ga0157375_10357837 3300013308 Bacteria 1626
206 Ga0157375_10371409 3300013308 Unclassified 1597
207 Ga0163163_10187128 3300014325 Bacteria 2118
208 Ga0157380_10037701 3300014326 Bacteria 3747
209 Ga0157380_10082583 3300014326 Bacteria 2630
210 Ga0157377_10003385 3300014745 Bacteria 7210
211 Ga0157377_10938404 3300014745 Unclassified 650
212 Ga0157379_10019150 3300014968 Bacteria 6043
213 Ga0157379_10037714 3300014968 Bacteria 4310
214 Ga0157379_10038668 3300014968 Bacteria 4256
215 Ga0157376_10199362 3300014969 Bacteria 1840
216 Ga0157376_10202447 3300014969 Bacteria 1828
217 Ga0157376_10612537 3300014969 Bacteria 1085
218 Ga0163161_10100663 3300017792 Bacteria 2151
219 Ga0163161_10147866 3300017792 Bacteria 1784
220 Ga0163161_10750515 3300017792 Bacteria 816
221 Ga0163161_11179402 3300017792 Unclassified 661
222 Ga0209437_100041 3300025233 Bacteria 444465
223 Ga0209129_1007786 3300025258 Bacteria 3104
224 Ga0207697_10001572 3300025315 Bacteria 12328
225 Ga0207656_10003225 3300025321 Bacteria 5579
226 Ga0207656_10035482 3300025321 Bacteria 2089
227 Ga0207710_10049602 3300025900 Bacteria 1881
228 Ga0207688_10010717 3300025901 Bacteria 4990
229 Ga0207680_10000051 3300025903 Bacteria 56289
230 Ga0207680_10190922 3300025903 Bacteria 1390
231 Ga0207645_10000415 3300025907 Bacteria 35412
232 Ga0207645_10003798 3300025907 Bacteria 11336
233 Ga0207645_10381246 3300025907 Bacteria 946
234 Ga0207643_10001445 3300025908 Bacteria 13635
235 Ga0207654_10004661 3300025911 Bacteria 6930
236 Ga0207654_10017842 3300025911 Bacteria 3718
237 Ga0207654_10033072 3300025911 Bacteria 2864
238 Ga0207654_10091984 3300025911 Bacteria 1851
239 Ga0207707_10002480 3300025912 Bacteria 16615
240 Ga0207695_10204389 3300025913 Bacteria 1888
241 Ga0207671_10000807 3300025914 Bacteria 39591
242 Ga0207671_10003565 3300025914 Bacteria 15409
243 Ga0207671_10009343 3300025914 Bacteria 8202
244 Ga0207671_10012133 3300025914 Bacteria 6955
245 Ga0207693_10020867 3300025915 Bacteria 5208
246 Ga0207660_10027504 3300025917 Bacteria 3882
247 Ga0207662_10103538 3300025918 Bacteria 1766
248 Ga0207657_10018906 3300025919 Bacteria 6559
249 Ga0207657_10084294 3300025919 Bacteria 2664
250 Ga0207649_10004368 3300025920 Bacteria 7671
251 Ga0207649_10074841 3300025920 Bacteria 2174
252 Ga0207649_10487766 3300025920 Bacteria 935
253 Ga0207652_10042551 3300025921 Unclassified 3867
254 Ga0207652_10081538 3300025921 Unclassified 2830
255 Ga0207681_10003859 3300025923 Bacteria 9309
256 Ga0207694_10025902 3300025924 Bacteria 4459
257 Ga0207650_10155861 3300025925 Bacteria 1806
258 Ga0207650_10186249 3300025925 Bacteria 1656
259 Ga0207650_10266928 3300025925 Unclassified 1390
260 Ga0207650_10381224 3300025925 Bacteria 1164
261 Ga0207650_10522702 3300025925 Unclassified 993
262 Ga0207650_10774826 3300025925 Bacteria 812
263 Ga0207700_10811474 3300025928 Bacteria 837
264 Ga0207644_10072943 3300025931 Bacteria 2516
265 Ga0207690_10035562 3300025932 Bacteria 3219
266 Ga0207690_10193884 3300025932 Bacteria 1538
267 Ga0207706_10020702 3300025933 Bacteria 5911
268 Ga0207686_10081138 3300025934 Bacteria 2116
269 Ga0207670_10286918 3300025936 Unclassified 1285
270 Ga0207704_10000057 3300025938 Bacteria 78383
271 Ga0207704_10007068 3300025938 Bacteria 5278
272 Ga0207704_10035601 3300025938 Bacteria 2854
273 Ga0207691_10002133 3300025940 Bacteria 19357
274 Ga0207691_10004010 3300025940 Bacteria 14272
275 Ga0207691_10098672 3300025940 Bacteria 2609
276 Ga0207691_10466885 3300025940 Bacteria 1073
277 Ga0207711_10048648 3300025941 Bacteria 3627
278 Ga0207711_10119896 3300025941 Unclassified 2348
279 Ga0207689_10002762 3300025942 Bacteria 16235
280 Ga0207689_10013486 3300025942 Bacteria 6981
281 Ga0207661_10117356 3300025944 Bacteria 2260
282 Ga0207661_10779222 3300025944 Unclassified 880
283 Ga0207661_11511643 3300025944 Bacteria 615
284 Ga0207679_10002293 3300025945 Bacteria 11794
285 Ga0207679_10024858 3300025945 Bacteria 4112
286 Ga0207679_10044006 3300025945 Unclassified 3219
287 Ga0207679_10057309 3300025945 Unclassified 2881
288 Ga0207679_10128907 3300025945 Bacteria 2026
289 Ga0207667_10001511 3300025949 Bacteria 29216
290 Ga0207667_10027516 3300025949 Bacteria 6187
291 Ga0207667_10116724 3300025949 Bacteria 2750
292 Ga0207651_10002891 3300025960 Bacteria 8286
293 Ga0207651_10090254 3300025960 Bacteria 2240
294 Ga0207651_10118050 3300025960 Bacteria 2006
295 Ga0207712_10013275 3300025961 Bacteria 5280
296 Ga0207668_10265911 3300025972 Bacteria 1400
297 Ga0207668_11018540 3300025972 Bacteria 740
298 Ga0207640_10073754 3300025981 Bacteria 2307
299 Ga0207640_10246142 3300025981 Archaea 1385
300 Ga0207640_10962483 3300025981 Unclassified 749
301 Ga0207640_11755495 3300025981 Bacteria 560
302 Ga0207658_10013251 3300025986 Bacteria 5631
303 Ga0207658_10019060 3300025986 Bacteria 4746
304 Ga0207677_10006246 3300026023 Bacteria 6515
305 Ga0207677_10007120 3300026023 Bacteria 6158
306 Ga0207677_10028722 3300026023 Unclassified 3523
307 Ga0207677_10143369 3300026023 Unclassified 1832
308 Ga0207703_10009005 3300026035 Bacteria 7860
309 Ga0207639_10031189 3300026041 Bacteria 3916
310 Ga0207639_10037346 3300026041 Unclassified 3607
311 Ga0207678_10016672 3300026067 Bacteria 6454
312 Ga0207678_10967623 3300026067 Bacteria 753
313 Ga0207708_10013163 3300026075 Bacteria 6174
314 Ga0207708_10013768 3300026075 Bacteria 6046
315 Ga0207702_10125157 3300026078 Bacteria 2306
316 Ga0207702_10451631 3300026078 Unclassified 1247
317 Ga0207641_10000121 3300026088 Bacteria 114943
318 Ga0207641_10072387 3300026088 Bacteria 2968
319 Ga0207641_10105548 3300026088 Unclassified 2488
320 Ga0207641_10313318 3300026088 Unclassified 1486
321 Ga0207648_10002065 3300026089 Bacteria 21891
322 Ga0207648_10041245 3300026089 Bacteria 4053
323 Ga0207648_10146807 3300026089 Bacteria 2080
324 Ga0207676_10014944 3300026095 Bacteria 5593
325 Ga0207676_10648521 3300026095 Bacteria 1019
326 Ga0207676_11180385 3300026095 Archaea 758
327 Ga0207674_10001427 3300026116 Bacteria 30867
328 Ga0207674_10001988 3300026116 Bacteria 25906
329 Ga0207674_10066718 3300026116 Bacteria 3623
330 Ga0207675_100007048 3300026118 Bacteria 10620
331 Ga0207675_100217135 3300026118 Bacteria 1841
332 Ga0207683_10282322 3300026121 Bacteria 1517
333 Ga0207683_10428398 3300026121 Bacteria 1219
334 Ga0207698_10001807 3300026142 Bacteria 12501
335 Ga0207698_10011924 3300026142 Bacteria 5662
336 Ga0207698_10213452 3300026142 Bacteria 1738
337 Ga0207698_10560622 3300026142 Unclassified 1121
338 Ga0207428_10160314 3300027907 Bacteria 1708
339 Ga0268266_10558143 3300028379 Bacteria 1098
340 Ga0268265_10005172 3300028380 Bacteria 8939
341 Ga0268264_10002376 3300028381 Bacteria 16599
342 Ga0268264_10006199 3300028381 Bacteria 10097
343 Ga0268264_10100844 3300028381 Bacteria 2508
344 Ga0307515_10001823 3300028794 Bacteria 47533
345 Ga0307515_10002904 3300028794 Bacteria 36409
346 Ga0307515_10056911 3300028794 Bacteria 5671
347 Ga0307515_10330948 3300028794 Bacteria 1182
348 Ga0307408_100015476 3300031548 Bacteria 5078
349 Ga0307408_100293984 3300031548 Bacteria 1358
350 Ga0307405_10914278 3300031731 Bacteria 743
351 Ga0307405_11272224 3300031731 Bacteria 639
352 Ga0307406_10004846 3300031901 Bacteria 7330
353 Ga0307406_11039030 3300031901 Bacteria 705
354 Ga0307414_10274288 3300032004 Bacteria 1414
355 Ga0307414_10311248 3300032004 Bacteria 1337
356 Ga0373940_0094429 3300035088 Unclassified 900
357 Ga0373946_0149173 3300035171 Unclassified 1090
358 Ga0373931_0177480 3300035691 Bacteria 1259
359 Ga0373931_0388047 3300035691 Bacteria 882
360 Ga0451807_0833849 3300041486 Bacteria 851
361 Ga0439455_0072554 3300042012 Unclassified 927
362 Ga0439459_0094598 3300042438 Bacteria 723
363 Ga0453683_1084127 3300044673 Bacteria 534
364 Ga0495629_0094869 3300046459 Bacteria 2082
365 Ga0495585_0001088 3300046492 Bacteria 22366
366 Ga0495606_0000010 3300046507 Bacteria 299893
367 Ga0495606_0157855 3300046507 Bacteria 1326
368 Ga0495616_0012194 3300046513 Bacteria 4891
369 Ga0495632_0317199 3300046519 Bacteria 689
370 Ga0495648_0181242 3300046524 Bacteria 1070
371 Ga0495648_0250370 3300046524 Bacteria 855
372 Ga0495609_0008800 3300046538 Bacteria 4913
373 Ga0495622_0088060 3300046557 Bacteria 1427
374 Ga0495668_0000044 3300046616 Bacteria 227585
375 Ga0495625_0000100 3300046660 Bacteria 139983
376 Ga0495625_0001346 3300046660 Bacteria 30375
377 Ga0495625_0002354 3300046660 Bacteria 20604
378 Ga0495625_0610637 3300046660 Bacteria 654
379 Ga0495658_0061151 3300046683 Bacteria 2162
380 Ga0495686_0000150 3300047472 Bacteria 135172
381 Ga0495686_0015867 3300047472 Bacteria 5124
382 Ga0496108_0512700 3300048911 Bacteria 1047
383 Ga0495678_073844 3300049459 Bacteria 1242
384 Ga0495682_0073829 3300049460 Bacteria 1227
385 Ga0501034_0022151 3300049571 Bacteria 6473
386 Ga0501043_0060301 3300049579 Bacteria 2978
387 Ga0501043_0098022 3300049579 Bacteria 2304
388 Ga0501047_0018925 3300049581 Bacteria 6605
389 Ga0501047_0744767 3300049581 Bacteria 796
390 Ga0501202_136863 3300049652 Bacteria 630
391 nmdc:mga05p37_495293_c1 3300050507 Bacteria 1404
392 nmdc:mga05p37_52053_c1 3300050507 Bacteria 5035
393 nmdc:mga06r32_138772_c1 3300050510 Unclassified 2406
394 nmdc:mga06r32_1673147_c1 3300050510 Bacteria 574
395 nmdc:mga08y16_227787_c1 3300050511 Unclassified 1928
396 nmdc:mga0n895_42078_c1 3300050512 Bacteria 4444
397 nmdc:mga0rr50_149680_c1 3300050513 Bacteria 1885
398 nmdc:mga0a205_59616_c1 3300050515 Bacteria 3686
399 nmdc:mga0a205_8082_c1 3300050515 Bacteria 9561
400 Ga0500614_129455 3300053123 Bacteria 748
401 Ga0500624_000474 3300053157 Bacteria 11954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0157855 Ga0495606_0157855_26_469 138
2 3300006846 Ga0075430_100171847 Ga0075430_1001718472 141
3 3300006846 Ga0075430_100676060 Ga0075430_1006760602 141
4 3300006847 Ga0075431_100191802 Ga0075431_1001918022 141
5 3300044673 Ga0453683_1084127 Ga0453683_1084127_20_496 142
6 3300047472 Ga0495686_0015867 Ga0495686_0015867_2641_3123 148
7 3300005328 Ga0070676_10000225 Ga0070676_100002259 149
8 3300005338 Ga0068868_100004676 Ga0068868_1000046768 149
9 3300005364 Ga0070673_100003988 Ga0070673_1000039887 149
10 3300005459 Ga0068867_100003538 Ga0068867_1000035387 149
11 3300005539 Ga0068853_100026177 Ga0068853_1000261774 149
12 3300005616 Ga0068852_100001292 Ga0068852_10000129214 149
13 3300006237 Ga0097621_100000909 Ga0097621_10000090919 149
14 3300006358 Ga0068871_100000653 Ga0068871_10000065324 149
15 3300006881 Ga0068865_100000049 Ga0068865_10000004913 149
16 3300025907 Ga0207645_10000415 Ga0207645_1000041523 149
17 3300025911 Ga0207654_10033072 Ga0207654_100330723 149
18 3300025914 Ga0207671_10009343 Ga0207671_100093431 149
19 3300025924 Ga0207694_10025902 Ga0207694_100259023 149
20 3300025938 Ga0207704_10000057 Ga0207704_1000005749 149
21 3300025960 Ga0207651_10002891 Ga0207651_100028918 149
22 3300026023 Ga0207677_10007120 Ga0207677_100071206 149
23 3300026041 Ga0207639_10031189 Ga0207639_100311894 149
24 3300026089 Ga0207648_10002065 Ga0207648_100020659 149
25 3300026142 Ga0207698_10001807 Ga0207698_100018079 149
26 3300013297 Ga0157378_10244377 Ga0157378_102443772 150
27 3300025938 Ga0207704_10035601 Ga0207704_100356012 150
28 3300005578 Ga0068854_101021282 Ga0068854_1010212822 151
29 3300025981 Ga0207640_10962483 Ga0207640_109624832 151
30 3300005334 Ga0068869_100064199 Ga0068869_1000641992 152
31 3300005335 Ga0070666_10000036 Ga0070666_1000003629 152
32 3300005347 Ga0070668_100261191 Ga0070668_1002611912 152
33 3300005355 Ga0070671_100321848 Ga0070671_1003218482 152
34 3300005367 Ga0070667_100704527 Ga0070667_1007045272 152
35 3300005466 Ga0070685_10259267 Ga0070685_102592672 152
36 3300005616 Ga0068852_100057742 Ga0068852_1000577422 152
37 3300005617 Ga0068859_100000037 Ga0068859_100000037151 152
38 3300005618 Ga0068864_100009987 Ga0068864_1000099872 152
39 3300005841 Ga0068863_100016628 Ga0068863_1000166285 152
40 3300005842 Ga0068858_100010814 Ga0068858_1000108146 152
41 3300005843 Ga0068860_100004043 Ga0068860_1000040436 152
42 3300006931 Ga0097620_100000037 Ga0097620_100000037151 152
43 3300009101 Ga0105247_10045005 Ga0105247_100450053 152
44 3300009174 Ga0105241_10000763 Ga0105241_1000076317 152
45 3300009545 Ga0105237_10077485 Ga0105237_100774853 152
46 3300009553 Ga0105249_10001080 Ga0105249_1000108020 152
47 3300010375 Ga0105239_10498103 Ga0105239_104981032 152
48 3300011119 Ga0105246_10120242 Ga0105246_101202422 152
49 3300013306 Ga0163162_10003629 Ga0163162_1000362912 152
50 3300013308 Ga0157375_10357837 Ga0157375_103578372 152
51 3300014325 Ga0163163_10187128 Ga0163163_101871283 152
52 3300014968 Ga0157379_10038668 Ga0157379_100386682 152
53 3300014969 Ga0157376_10202447 Ga0157376_102024472 152
54 3300025900 Ga0207710_10049602 Ga0207710_100496023 152
55 3300025903 Ga0207680_10000051 Ga0207680_1000005116 152
56 3300025911 Ga0207654_10004661 Ga0207654_100046613 152
57 3300025914 Ga0207671_10003565 Ga0207671_1000356510 152
58 3300025931 Ga0207644_10072943 Ga0207644_100729432 152
59 3300025942 Ga0207689_10013486 Ga0207689_100134863 152
60 3300025972 Ga0207668_10265911 Ga0207668_102659112 152
61 3300026023 Ga0207677_10028722 Ga0207677_100287222 152
62 3300026035 Ga0207703_10009005 Ga0207703_100090052 152
63 3300026088 Ga0207641_10000121 Ga0207641_1000012198 152
64 3300026142 Ga0207698_10011924 Ga0207698_100119243 152
65 3300028381 Ga0268264_10006199 Ga0268264_100061992 152
66 3300031548 Ga0307408_100293984 Ga0307408_1002939843 152
67 3300031731 Ga0307405_10914278 Ga0307405_109142781 152
68 3300032004 Ga0307414_10311248 Ga0307414_103112481 152
69 3300005614 Ga0068856_100033708 Ga0068856_1000337087 157
70 3300009553 Ga0105249_10006300 Ga0105249_100063005 157
71 3300013306 Ga0163162_10000241 Ga0163162_1000024113 157
72 3300013308 Ga0157375_10016854 Ga0157375_100168544 157
73 3300014968 Ga0157379_10019150 Ga0157379_100191507 157
74 3300017792 Ga0163161_11179402 Ga0163161_111794021 157
75 3300005333 Ga0070677_10429285 Ga0070677_104292851 158
76 3300005563 Ga0068855_100000506 Ga0068855_10000050617 158
77 3300025928 Ga0207700_10811474 Ga0207700_108114741 158
78 3300025949 Ga0207667_10001511 Ga0207667_1000151114 158
79 iso_pu_bacteria 2919437846 2919441981 158
80 iso_pu_bacteria 2928078545 2928079764 158
81 3300005333 Ga0070677_10371451 Ga0070677_103714511 159
82 3300005438 Ga0070701_10163806 Ga0070701_101638062 159
83 3300005441 Ga0070700_100841793 Ga0070700_1008417932 159
84 3300005456 Ga0070678_100315090 Ga0070678_1003150902 159
85 3300005459 Ga0068867_100320084 Ga0068867_1003200841 159
86 3300005471 Ga0070698_100872232 Ga0070698_1008722322 159
87 3300005543 Ga0070672_100152368 Ga0070672_1001523682 159
88 3300005543 Ga0070672_100356904 Ga0070672_1003569043 159
89 3300005577 Ga0068857_100067502 Ga0068857_1000675024 159
90 3300005617 Ga0068859_100862750 Ga0068859_1008627502 159
91 3300005719 Ga0068861_100230309 Ga0068861_1002303093 159
92 3300005840 Ga0068870_10058543 Ga0068870_100585432 159
93 3300005842 Ga0068858_100426890 Ga0068858_1004268903 159
94 3300005844 Ga0068862_100001130 Ga0068862_10000113016 159
95 3300006237 Ga0097621_100330016 Ga0097621_1003300163 159
96 3300006931 Ga0097620_100862669 Ga0097620_1008626692 159
97 3300009553 Ga0105249_10000733 Ga0105249_100007333 159
98 3300013306 Ga0163162_10044091 Ga0163162_100440913 159
99 3300013308 Ga0157375_10371409 Ga0157375_103714092 159
100 3300014326 Ga0157380_10082583 Ga0157380_100825832 159
101 3300017792 Ga0163161_10750515 Ga0163161_107505152 159
102 3300025907 Ga0207645_10381246 Ga0207645_103812462 159
103 3300025908 Ga0207643_10001445 Ga0207643_100014452 159
104 3300025925 Ga0207650_10155861 Ga0207650_101558612 159
105 3300025940 Ga0207691_10098672 Ga0207691_100986722 159
106 3300025940 Ga0207691_10466885 Ga0207691_104668852 159
107 3300025961 Ga0207712_10013275 Ga0207712_100132752 159
108 3300025972 Ga0207668_11018540 Ga0207668_110185401 159
109 3300026067 Ga0207678_10967623 Ga0207678_109676232 159
110 3300026075 Ga0207708_10013768 Ga0207708_100137684 159
111 3300026089 Ga0207648_10041245 Ga0207648_100412453 159
112 3300026116 Ga0207674_10066718 Ga0207674_100667184 159
113 3300026118 Ga0207675_100217135 Ga0207675_1002171353 159
114 3300028380 Ga0268265_10005172 Ga0268265_100051725 159
115 3300028794 Ga0307515_10056911 Ga0307515_100569114 159
116 3300031731 Ga0307405_11272224 Ga0307405_112722241 159
117 3300031901 Ga0307406_11039030 Ga0307406_110390302 159
118 3300035088 Ga0373940_0094429 Ga0373940_0094429_116_640 159
119 3300035691 Ga0373931_0388047 Ga0373931_0388047_200_724 159
120 3300041486 Ga0451807_0833849 Ga0451807_0833849_152_679 159
121 3300005338 Ga0068868_100008703 Ga0068868_10000870310 160
122 3300005355 Ga0070671_100049533 Ga0070671_1000495333 160
123 3300005364 Ga0070673_100050914 Ga0070673_1000509142 160
124 3300005367 Ga0070667_100001551 Ga0070667_1000015514 160
125 3300005617 Ga0068859_100063224 Ga0068859_1000632242 160
126 3300005618 Ga0068864_100226076 Ga0068864_1002260762 160
127 3300005834 Ga0068851_10056650 Ga0068851_100566502 160
128 3300005841 Ga0068863_100011860 Ga0068863_1000118604 160
129 3300005843 Ga0068860_100002354 Ga0068860_1000023547 160
130 3300006931 Ga0097620_100063224 Ga0097620_1000632242 160
131 3300013296 Ga0157374_10675183 Ga0157374_106751831 160
132 3300013297 Ga0157378_10003777 Ga0157378_100037771 160
133 3300013297 Ga0157378_10064322 Ga0157378_100643222 160
134 3300025925 Ga0207650_10774826 Ga0207650_107748261 160
135 3300025986 Ga0207658_10013251 Ga0207658_100132512 160
136 3300026023 Ga0207677_10143369 Ga0207677_101433691 160
137 3300026088 Ga0207641_10105548 Ga0207641_101055484 160
138 3300028381 Ga0268264_10002376 Ga0268264_1000237612 160
139 3300028794 Ga0307515_10330948 Ga0307515_103309482 160
140 3300035691 Ga0373931_0177480 Ga0373931_0177480_353_859 160
141 3300042438 Ga0439459_0094598 Ga0439459_0094598_94_600 160
142 3300046660 Ga0495625_0610637 Ga0495625_0610637_76_594 160
143 3300002737 JGI25162J39368_1000012 JGI25162J39368_1000012214 161
144 3300003322 rootL2_10021352 rootL2_100213522 161
145 3300003322 rootL2_10121507 rootL2_101215071 161
146 3300005288 Ga0065714_10301353 Ga0065714_103013531 161
147 3300005329 Ga0070683_100057285 Ga0070683_1000572852 161
148 3300005331 Ga0070670_100007515 Ga0070670_1000075152 161
149 3300005331 Ga0070670_100211552 Ga0070670_1002115522 161
150 3300005334 Ga0068869_100011799 Ga0068869_1000117994 161
151 3300005335 Ga0070666_10054134 Ga0070666_100541342 161
152 3300005336 Ga0070680_100042718 Ga0070680_1000427182 161
153 3300005336 Ga0070680_100343290 Ga0070680_1003432902 161
154 3300005337 Ga0070682_100058308 Ga0070682_1000583082 161
155 3300005338 Ga0068868_100003873 Ga0068868_1000038737 161
156 3300005339 Ga0070660_100132626 Ga0070660_1001326262 161
157 3300005339 Ga0070660_100235906 Ga0070660_1002359062 161
158 3300005340 Ga0070689_100174238 Ga0070689_1001742381 161
159 3300005343 Ga0070687_100030677 Ga0070687_1000306772 161
160 3300005344 Ga0070661_100097989 Ga0070661_1000979893 161
161 3300005344 Ga0070661_100165199 Ga0070661_1001651992 161
162 3300005347 Ga0070668_100003558 Ga0070668_1000035583 161
163 3300005353 Ga0070669_100028419 Ga0070669_1000284195 161
164 3300005354 Ga0070675_100007418 Ga0070675_1000074185 161
165 3300005355 Ga0070671_100144640 Ga0070671_1001446402 161
166 3300005364 Ga0070673_100031436 Ga0070673_1000314362 161
167 3300005364 Ga0070673_101125884 Ga0070673_1011258841 161
168 3300005366 Ga0070659_100031210 Ga0070659_1000312105 161
169 3300005366 Ga0070659_100042926 Ga0070659_1000429262 161
170 3300005367 Ga0070667_100023710 Ga0070667_1000237102 161
171 3300005367 Ga0070667_100850865 Ga0070667_1008508652 161
172 3300005438 Ga0070701_10007575 Ga0070701_100075755 161
173 3300005439 Ga0070711_100555761 Ga0070711_1005557611 161
174 3300005441 Ga0070700_100004652 Ga0070700_1000046523 161
175 3300005441 Ga0070700_100461110 Ga0070700_1004611102 161
176 3300005455 Ga0070663_100037590 Ga0070663_1000375902 161
177 3300005458 Ga0070681_10001156 Ga0070681_100011568 161
178 3300005459 Ga0068867_100353504 Ga0068867_1003535042 161
179 3300005530 Ga0070679_100139373 Ga0070679_1001393732 161
180 3300005530 Ga0070679_100159257 Ga0070679_1001592572 161
181 3300005535 Ga0070684_100014193 Ga0070684_1000141934 161
182 3300005535 Ga0070684_100187903 Ga0070684_1001879032 161
183 3300005539 Ga0068853_100124898 Ga0068853_1001248982 161
184 3300005539 Ga0068853_100326299 Ga0068853_1003262992 161
185 3300005543 Ga0070672_100014499 Ga0070672_1000144996 161
186 3300005544 Ga0070686_100090474 Ga0070686_1000904743 161
187 3300005546 Ga0070696_100953036 Ga0070696_1009530361 161
188 3300005548 Ga0070665_100701929 Ga0070665_1007019291 161
189 3300005563 Ga0068855_100024540 Ga0068855_1000245408 161
190 3300005563 Ga0068855_100034688 Ga0068855_1000346889 161
191 3300005563 Ga0068855_100150146 Ga0068855_1001501463 161
192 3300005563 Ga0068855_100850097 Ga0068855_1008500971 161
193 3300005564 Ga0070664_100014906 Ga0070664_1000149065 161
194 3300005564 Ga0070664_100047500 Ga0070664_1000475003 161
195 3300005577 Ga0068857_100012325 Ga0068857_1000123253 161
196 3300005577 Ga0068857_100025033 Ga0068857_1000250334 161
197 3300005578 Ga0068854_100016923 Ga0068854_1000169232 161
198 3300005578 Ga0068854_100055911 Ga0068854_1000559113 161
199 3300005614 Ga0068856_100196536 Ga0068856_1001965362 161
200 3300005616 Ga0068852_100322965 Ga0068852_1003229652 161
201 3300005617 Ga0068859_100168538 Ga0068859_1001685382 161
202 3300005618 Ga0068864_100012240 Ga0068864_1000122402 161
203 3300005719 Ga0068861_100002089 Ga0068861_10000208915 161
204 3300005834 Ga0068851_10020445 Ga0068851_100204452 161
205 3300005840 Ga0068870_10363560 Ga0068870_103635601 161
206 3300005841 Ga0068863_100251583 Ga0068863_1002515832 161
207 3300005843 Ga0068860_100173312 Ga0068860_1001733122 161
208 3300005844 Ga0068862_100057403 Ga0068862_1000574032 161
209 3300006186 Ga0075369_10442215 Ga0075369_104422151 161
210 3300006358 Ga0068871_100408768 Ga0068871_1004087682 161
211 3300006844 Ga0075428_100172859 Ga0075428_1001728591 161
212 3300006847 Ga0075431_100154898 Ga0075431_1001548982 161
213 3300006852 Ga0075433_10024658 Ga0075433_100246582 161
214 3300006852 Ga0075433_10246912 Ga0075433_102469122 161
215 3300006871 Ga0075434_100046151 Ga0075434_1000461513 161
216 3300006881 Ga0068865_100015493 Ga0068865_1000154934 161
217 3300006931 Ga0097620_100168539 Ga0097620_1001685392 161
218 3300007076 Ga0075435_100152116 Ga0075435_1001521163 161
219 3300007076 Ga0075435_100340461 Ga0075435_1003404612 161
220 3300009093 Ga0105240_10052686 Ga0105240_100526862 161
221 3300009093 Ga0105240_10360139 Ga0105240_103601392 161
222 3300009093 Ga0105240_10965472 Ga0105240_109654722 161
223 3300009094 Ga0111539_10311479 Ga0111539_103114793 161
224 3300009147 Ga0114129_10184901 Ga0114129_101849012 161
225 3300009147 Ga0114129_10449832 Ga0114129_104498322 161
226 3300009174 Ga0105241_10014971 Ga0105241_100149716 161
227 3300009177 Ga0105248_10012503 Ga0105248_100125034 161
228 3300009177 Ga0105248_10185687 Ga0105248_101856872 161
229 3300009545 Ga0105237_10024043 Ga0105237_100240433 161
230 3300009545 Ga0105237_10180539 Ga0105237_101805392 161
231 3300009553 Ga0105249_10010756 Ga0105249_100107562 161
232 3300010375 Ga0105239_10000163 Ga0105239_100001639 161
233 3300010375 Ga0105239_10009346 Ga0105239_100093463 161
234 3300010375 Ga0105239_10009934 Ga0105239_100099345 161
235 3300010375 Ga0105239_10349960 Ga0105239_103499602 161
236 3300013100 Ga0157373_10002565 Ga0157373_100025656 161
237 3300013102 Ga0157371_10006099 Ga0157371_100060998 161
238 3300013102 Ga0157371_10490201 Ga0157371_104902012 161
239 3300013105 Ga0157369_10023573 Ga0157369_100235733 161
240 3300013105 Ga0157369_10304918 Ga0157369_103049182 161
241 3300013296 Ga0157374_10427702 Ga0157374_104277022 161
242 3300013297 Ga0157378_11656327 Ga0157378_116563271 161
243 3300013306 Ga0163162_10003639 Ga0163162_100036394 161
244 3300013307 Ga0157372_10049110 Ga0157372_100491102 161
245 3300013307 Ga0157372_10545613 Ga0157372_105456132 161
246 3300013308 Ga0157375_10006360 Ga0157375_100063609 161
247 3300014326 Ga0157380_10037701 Ga0157380_100377012 161
248 3300014745 Ga0157377_10003385 Ga0157377_100033858 161
249 3300014968 Ga0157379_10037714 Ga0157379_100377145 161
250 3300014969 Ga0157376_10612537 Ga0157376_106125372 161
251 3300017792 Ga0163161_10100663 Ga0163161_101006632 161
252 3300017792 Ga0163161_10147866 Ga0163161_101478661 161
253 3300025233 Ga0209437_100041 Ga0209437_100041258 161
254 3300025258 Ga0209129_1007786 Ga0209129_10077864 161
255 3300025315 Ga0207697_10001572 Ga0207697_100015723 161
256 3300025321 Ga0207656_10003225 Ga0207656_100032252 161
257 3300025321 Ga0207656_10035482 Ga0207656_100354822 161
258 3300025901 Ga0207688_10010717 Ga0207688_100107173 161
259 3300025903 Ga0207680_10190922 Ga0207680_101909222 161
260 3300025907 Ga0207645_10003798 Ga0207645_100037984 161
261 3300025911 Ga0207654_10017842 Ga0207654_100178423 161
262 3300025912 Ga0207707_10002480 Ga0207707_100024808 161
263 3300025914 Ga0207671_10012133 Ga0207671_100121334 161
264 3300025915 Ga0207693_10020867 Ga0207693_100208675 161
265 3300025917 Ga0207660_10027504 Ga0207660_100275042 161
266 3300025918 Ga0207662_10103538 Ga0207662_101035382 161
267 3300025919 Ga0207657_10018906 Ga0207657_100189064 161
268 3300025919 Ga0207657_10084294 Ga0207657_100842942 161
269 3300025920 Ga0207649_10004368 Ga0207649_100043682 161
270 3300025920 Ga0207649_10074841 Ga0207649_100748413 161
271 3300025921 Ga0207652_10042551 Ga0207652_100425514 161
272 3300025921 Ga0207652_10081538 Ga0207652_100815383 161
273 3300025923 Ga0207681_10003859 Ga0207681_100038594 161
274 3300025925 Ga0207650_10186249 Ga0207650_101862492 161
275 3300025925 Ga0207650_10266928 Ga0207650_102669282 161
276 3300025925 Ga0207650_10522702 Ga0207650_105227021 161
277 3300025932 Ga0207690_10035562 Ga0207690_100355622 161
278 3300025932 Ga0207690_10193884 Ga0207690_101938842 161
279 3300025933 Ga0207706_10020702 Ga0207706_100207027 161
280 3300025936 Ga0207670_10286918 Ga0207670_102869182 161
281 3300025938 Ga0207704_10007068 Ga0207704_100070686 161
282 3300025940 Ga0207691_10002133 Ga0207691_1000213316 161
283 3300025941 Ga0207711_10048648 Ga0207711_100486482 161
284 3300025942 Ga0207689_10002762 Ga0207689_1000276210 161
285 3300025944 Ga0207661_10117356 Ga0207661_101173562 161
286 3300025944 Ga0207661_10779222 Ga0207661_107792221 161
287 3300025944 Ga0207661_11511643 Ga0207661_115116431 161
288 3300025945 Ga0207679_10002293 Ga0207679_100022934 161
289 3300025945 Ga0207679_10044006 Ga0207679_100440064 161
290 3300025945 Ga0207679_10057309 Ga0207679_100573092 161
291 3300025949 Ga0207667_10027516 Ga0207667_100275163 161
292 3300025949 Ga0207667_10116724 Ga0207667_101167241 161
293 3300025960 Ga0207651_10118050 Ga0207651_101180502 161
294 3300025981 Ga0207640_10073754 Ga0207640_100737542 161
295 3300025981 Ga0207640_10246142 Ga0207640_102461423 161
296 3300025981 Ga0207640_11755495 Ga0207640_117554951 161
297 3300025986 Ga0207658_10019060 Ga0207658_100190604 161
298 3300026023 Ga0207677_10006246 Ga0207677_100062463 161
299 3300026041 Ga0207639_10037346 Ga0207639_100373464 161
300 3300026067 Ga0207678_10016672 Ga0207678_100166723 161
301 3300026075 Ga0207708_10013163 Ga0207708_100131632 161
302 3300026078 Ga0207702_10125157 Ga0207702_101251573 161
303 3300026078 Ga0207702_10451631 Ga0207702_104516312 161
304 3300026088 Ga0207641_10072387 Ga0207641_100723872 161
305 3300026088 Ga0207641_10313318 Ga0207641_103133182 161
306 3300026089 Ga0207648_10146807 Ga0207648_101468072 161
307 3300026095 Ga0207676_10014944 Ga0207676_100149441 161
308 3300026095 Ga0207676_11180385 Ga0207676_111803851 161
309 3300026116 Ga0207674_10001427 Ga0207674_1000142721 161
310 3300026116 Ga0207674_10001988 Ga0207674_100019885 161
311 3300026118 Ga0207675_100007048 Ga0207675_1000070482 161
312 3300026142 Ga0207698_10213452 Ga0207698_102134522 161
313 3300027907 Ga0207428_10160314 Ga0207428_101603143 161
314 3300028379 Ga0268266_10558143 Ga0268266_105581431 161
315 3300028381 Ga0268264_10100844 Ga0268264_101008442 161
316 3300028794 Ga0307515_10001823 Ga0307515_100018233 161
317 3300031548 Ga0307408_100015476 Ga0307408_1000154763 161
318 3300031901 Ga0307406_10004846 Ga0307406_100048467 161
319 3300035171 Ga0373946_0149173 Ga0373946_0149173_144_680 161
320 3300042012 Ga0439455_0072554 Ga0439455_0072554_199_735 161
321 3300046459 Ga0495629_0094869 Ga0495629_0094869_807_1325 161
322 3300046492 Ga0495585_0001088 Ga0495585_0001088_8301_8819 161
323 3300046513 Ga0495616_0012194 Ga0495616_0012194_3246_3767 161
324 3300046519 Ga0495632_0317199 Ga0495632_0317199_126_644 161
325 3300046524 Ga0495648_0181242 Ga0495648_0181242_205_723 161
326 3300046524 Ga0495648_0250370 Ga0495648_0250370_205_723 161
327 3300046538 Ga0495609_0008800 Ga0495609_0008800_629_1147 161
328 3300046557 Ga0495622_0088060 Ga0495622_0088060_76_594 161
329 3300046616 Ga0495668_0000044 Ga0495668_0000044_173914_174432 161
330 3300046660 Ga0495625_0001346 Ga0495625_0001346_6881_7399 161
331 3300046660 Ga0495625_0002354 Ga0495625_0002354_3526_4038 161
332 3300046683 Ga0495658_0061151 Ga0495658_0061151_261_779 161
333 3300047472 Ga0495686_0000150 Ga0495686_0000150_125934_126455 161
334 3300048911 Ga0496108_0512700 Ga0496108_0512700_398_934 161
335 3300049459 Ga0495678_073844 Ga0495678_073844_530_1051 161
336 3300049460 Ga0495682_0073829 Ga0495682_0073829_693_1211 161
337 3300049652 Ga0501202_136863 Ga0501202_136863_38_550 161
338 3300050507 nmdc:mga05p37_495293_c1 nmdc:mga05p37_495293_c1_652_1188 161
339 3300050507 nmdc:mga05p37_52053_c1 nmdc:mga05p37_52053_c1_1830_2348 161
340 3300050510 nmdc:mga06r32_138772_c1 nmdc:mga06r32_138772_c1_1457_1975 161
341 3300050511 nmdc:mga08y16_227787_c1 nmdc:mga08y16_227787_c1_723_1241 161
342 3300050512 nmdc:mga0n895_42078_c1 nmdc:mga0n895_42078_c1_1183_1701 161
343 3300050513 nmdc:mga0rr50_149680_c1 nmdc:mga0rr50_149680_c1_445_981 161
344 3300050515 nmdc:mga0a205_59616_c1 nmdc:mga0a205_59616_c1_1455_1991 161
345 3300050515 nmdc:mga0a205_8082_c1 nmdc:mga0a205_8082_c1_8255_8773 161
346 3300053123 Ga0500614_129455 Ga0500614_129455_23_541 161
347 3300053157 Ga0500624_000474 Ga0500624_000474_9221_9742 161
348 3300001991 JGI24743J22301_10075496 JGI24743J22301_100754962 162
349 3300002077 JGI24744J21845_10006759 JGI24744J21845_100067592 162
350 3300005289 Ga0065704_10192035 Ga0065704_101920352 162
351 3300005329 Ga0070683_100971695 Ga0070683_1009716951 162
352 3300005334 Ga0068869_100117994 Ga0068869_1001179942 162
353 3300005347 Ga0070668_100300865 Ga0070668_1003008652 162
354 3300005366 Ga0070659_100363695 Ga0070659_1003636952 162
355 3300005471 Ga0070698_100084240 Ga0070698_1000842402 162
356 3300005535 Ga0070684_100165351 Ga0070684_1001653512 162
357 3300005535 Ga0070684_100448506 Ga0070684_1004485062 162
358 3300005535 Ga0070684_100688113 Ga0070684_1006881132 162
359 3300005543 Ga0070672_100048769 Ga0070672_1000487692 162
360 3300005564 Ga0070664_100026602 Ga0070664_1000266022 162
361 3300005564 Ga0070664_100444821 Ga0070664_1004448211 162
362 3300009093 Ga0105240_10256349 Ga0105240_102563492 162
363 3300009174 Ga0105241_10040728 Ga0105241_100407282 162
364 3300009174 Ga0105241_10062061 Ga0105241_100620613 162
365 3300009174 Ga0105241_10341785 Ga0105241_103417851 162
366 3300009176 Ga0105242_10034818 Ga0105242_100348183 162
367 3300009176 Ga0105242_10116354 Ga0105242_101163542 162
368 3300009545 Ga0105237_10001979 Ga0105237_1000197917 162
369 3300009545 Ga0105237_10004376 Ga0105237_100043762 162
370 3300010375 Ga0105239_10007238 Ga0105239_100072386 162
371 3300013104 Ga0157370_11706117 Ga0157370_117061171 162
372 3300013296 Ga0157374_10004451 Ga0157374_100044518 162
373 3300013296 Ga0157374_10023531 Ga0157374_100235313 162
374 3300013297 Ga0157378_10017949 Ga0157378_100179492 162
375 3300013297 Ga0157378_10087057 Ga0157378_100870572 162
376 3300013308 Ga0157375_10148756 Ga0157375_101487563 162
377 3300014745 Ga0157377_10938404 Ga0157377_109384041 162
378 3300014969 Ga0157376_10199362 Ga0157376_101993622 162
379 3300025911 Ga0207654_10091984 Ga0207654_100919843 162
380 3300025913 Ga0207695_10204389 Ga0207695_102043892 162
381 3300025914 Ga0207671_10000807 Ga0207671_100008077 162
382 3300025920 Ga0207649_10487766 Ga0207649_104877662 162
383 3300025925 Ga0207650_10381224 Ga0207650_103812242 162
384 3300025934 Ga0207686_10081138 Ga0207686_100811382 162
385 3300025940 Ga0207691_10004010 Ga0207691_100040103 162
386 3300025941 Ga0207711_10119896 Ga0207711_101198963 162
387 3300025945 Ga0207679_10024858 Ga0207679_100248582 162
388 3300025945 Ga0207679_10128907 Ga0207679_101289072 162
389 3300025960 Ga0207651_10090254 Ga0207651_100902542 162
390 3300026095 Ga0207676_10648521 Ga0207676_106485212 162
391 3300026121 Ga0207683_10282322 Ga0207683_102823222 162
392 3300026121 Ga0207683_10428398 Ga0207683_104283982 162
393 3300026142 Ga0207698_10560622 Ga0207698_105606222 162
394 3300028794 Ga0307515_10002904 Ga0307515_1000290417 162
395 3300032004 Ga0307414_10274288 Ga0307414_102742882 162
396 3300046507 Ga0495606_0000010 Ga0495606_0000010_17119_17631 162
397 3300046660 Ga0495625_0000100 Ga0495625_0000100_128110_128628 162
398 3300049571 Ga0501034_0022151 Ga0501034_0022151_4317_4850 162
399 3300049579 Ga0501043_0060301 Ga0501043_0060301_1137_1670 162
400 3300049579 Ga0501043_0098022 Ga0501043_0098022_1049_1567 162
401 3300049581 Ga0501047_0018925 Ga0501047_0018925_1531_2064 162
402 3300049581 Ga0501047_0744767 Ga0501047_0744767_99_617 162
403 3300050510 nmdc:mga06r32_1673147_c1 nmdc:mga06r32_1673147_c1_22_537 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

52

185

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.8499 14 160
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.8223 21 158
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8194 23 159
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8183 18 156
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8127 18 156
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8214 19 160 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8161 18 162 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8057 18 162 1.20.120.450
2p1aA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7887 19 156 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7867 23 158 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1N6FVR1-F1-model_v4 DinB family protein 0.9816 6 160
AF-A0A1M3HQR3-F1-model_v4 Metal-dependent hydrolase 0.9769 6 160 GO:0016787
AF-A0A1I0NK32-F1-model_v4 Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle) 0.9761 7 161
AF-A0A6B9ZIJ5-F1-model_v4 DinB family protein 0.9723 6 162
AF-A0A316E916-F1-model_v4 DinB family protein 0.9721 3 162

Feature Viewer

pLDDT pTM Quality
94.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map