F435403

General Info

Members Datasets Scaffolds Average Seq Length
403 192 806 460

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10165579|Ga0207700_101655791
Length 447
Sequence VSHILSDALVFFGATGDLAHKKIFPALQKLASRGRLDMPVIGVAKSGWTLEQLQARAKDSVQTYGGLDPEGFPKLLARLQYIDGDYSDPATFHQLREKLGPSKHPLHYLAIPPTVFAEVLEKLQSSGCAVGGRVVIEKPFGHDLASAQQLNEVVHRVFAEENVFRIDHFLGKNAVQNLLFFRFANSFLEPIWNRRFVECIQITMAEAFGVQGRGAFYDQTGAIRDVVQNHLLQLLSNLAMEPPPGIATEMLRDERVKVLKGIKALRPQDVVRGQFKGYCSEPGVKKDSQVETYVALHLYINSWRWKDVPVYIRAGKSLPVTATEVTVKLRQAPAIFTSEPMPENYFRFRVTPDLQIGLGAMVKVAGDAMKGNETELIFSCPSDPHEMQAYEELSVRFARQDYVEEAWRIVDPVLDNKTAVYPYDCGTWGPMQAEELIAGYGGWIDPK

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 3.47
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10165579 3300025928 Bacteria 1840
2 JGI25407J50210_10022354 3300003373 Bacteria 1644
3 Ga0065712_10069989 3300005290 Bacteria 6436
4 Ga0065715_10001325 3300005293 Bacteria 7764
5 Ga0065715_10005070 3300005293 Bacteria 5650
6 Ga0065707_10018236 3300005295 Bacteria 1944
7 Ga0065707_10090367 3300005295 Bacteria 4146
8 Ga0070690_100000966 3300005330 Bacteria 14618
9 Ga0070690_100022368 3300005330 Bacteria 3868
10 Ga0068869_100001137 3300005334 Bacteria 15535
11 Ga0068869_100004253 3300005334 Bacteria 8880
12 Ga0070666_10007795 3300005335 Bacteria 6613
13 Ga0070666_10012504 3300005335 Bacteria 5358
14 Ga0070680_100016503 3300005336 Bacteria 5811
15 Ga0070682_100031378 3300005337 Bacteria 3214
16 Ga0068868_100005651 3300005338 Bacteria 8802
17 Ga0068868_100013976 3300005338 Bacteria 5906
18 Ga0068868_100097356 3300005338 Bacteria 2378
19 Ga0068868_100133930 3300005338 Bacteria 2030
20 Ga0070660_100026378 3300005339 Bacteria 4325
21 Ga0070689_100013798 3300005340 Bacteria 5853
22 Ga0070691_10073749 3300005341 Bacteria 1659
23 Ga0070687_100002819 3300005343 Bacteria 6630
24 Ga0070661_100018205 3300005344 Bacteria 4991
25 Ga0070661_100036024 3300005344 Bacteria 3596
26 Ga0070692_10058399 3300005345 Bacteria 2026
27 Ga0070692_10064821 3300005345 Bacteria 1933
28 Ga0070668_100011844 3300005347 Bacteria 6497
29 Ga0070668_100027486 3300005347 Bacteria 4320
30 Ga0070668_100129271 3300005347 Bacteria 2026
31 Ga0070669_100015264 3300005353 Bacteria 5472
32 Ga0070669_100062373 3300005353 Bacteria 2740
33 Ga0070675_100024709 3300005354 Bacteria 4812
34 Ga0070674_100000413 3300005356 Bacteria 21566
35 Ga0070674_100156546 3300005356 Bacteria 1725
36 Ga0070673_100004893 3300005364 Bacteria 8528
37 Ga0070673_100009532 3300005364 Bacteria 6520
38 Ga0070688_100014498 3300005365 Bacteria 4467
39 Ga0070659_100027434 3300005366 Bacteria 4388
40 Ga0070659_100034908 3300005366 Bacteria 3914
41 Ga0070667_100011391 3300005367 Bacteria 7354
42 Ga0070667_100050575 3300005367 Bacteria 3503
43 Ga0070714_100266345 3300005435 Bacteria 1588
44 Ga0070701_10029909 3300005438 Bacteria 2690
45 Ga0070711_100039263 3300005439 Bacteria 3187
46 Ga0070705_100010256 3300005440 Bacteria 4683
47 Ga0070705_100027847 3300005440 Bacteria 3089
48 Ga0070708_100112403 3300005445 Bacteria 2505
49 Ga0070663_100040027 3300005455 Bacteria 3279
50 Ga0070663_100040591 3300005455 Bacteria 3259
51 Ga0070663_100074337 3300005455 Bacteria 2481
52 Ga0070662_100001624 3300005457 Bacteria 13866
53 Ga0070662_100020870 3300005457 Bacteria 4467
54 Ga0070662_100047518 3300005457 Bacteria 3087
55 Ga0070662_100055716 3300005457 Bacteria 2869
56 Ga0070681_10015704 3300005458 Bacteria 7546
57 Ga0070681_10022253 3300005458 Bacteria 6363
58 Ga0070681_10080909 3300005458 Bacteria 3204
59 Ga0068867_100015520 3300005459 Bacteria 5403
60 Ga0068867_100072244 3300005459 Bacteria 2582
61 Ga0068867_100096182 3300005459 Bacteria 2254
62 Ga0070685_10002881 3300005466 Bacteria 8796
63 Ga0070679_100155408 3300005530 Bacteria 2262
64 Ga0070672_100051904 3300005543 Bacteria 3200
65 Ga0070686_100001831 3300005544 Bacteria 11859
66 Ga0070686_100062662 3300005544 Bacteria 2407
67 Ga0070686_100105112 3300005544 Bacteria 1914
68 Ga0070695_100055613 3300005545 Bacteria 2551
69 Ga0070696_100011415 3300005546 Bacteria 5951
70 Ga0070696_100057470 3300005546 Bacteria 2715
71 Ga0070693_100019953 3300005547 Bacteria 3526
72 Ga0070693_100035972 3300005547 Unclassified 2749
73 Ga0070665_100011432 3300005548 Bacteria 8975
74 Ga0070665_100048959 3300005548 Bacteria 4242
75 Ga0070664_100003176 3300005564 Bacteria 13276
76 Ga0070664_100065266 3300005564 Bacteria 3105
77 Ga0068854_100030344 3300005578 Bacteria 3750
78 Ga0068856_100054028 3300005614 Bacteria 3961
79 Ga0068852_100009853 3300005616 Bacteria 7108
80 Ga0068852_100198931 3300005616 Bacteria 1895
81 Ga0068859_100017802 3300005617 Bacteria 7142
82 Ga0068859_100025608 3300005617 Bacteria 5917
83 Ga0068859_100073781 3300005617 Bacteria 3450
84 Ga0068859_100222492 3300005617 Bacteria 1975
85 Ga0068859_100263762 3300005617 Bacteria 1814
86 Ga0068864_100059875 3300005618 Bacteria 3296
87 Ga0068864_100074989 3300005618 Bacteria 2953
88 Ga0068864_100130412 3300005618 Bacteria 2257
89 Ga0068866_10068786 3300005718 Bacteria 1863
90 Ga0068861_100012155 3300005719 Bacteria 6000
91 Ga0068861_100193537 3300005719 Bacteria 1702
92 Ga0068861_100235698 3300005719 Bacteria 1554
93 Ga0068870_10000489 3300005840 Bacteria 15008
94 Ga0068870_10028219 3300005840 Bacteria 2816
95 Ga0068863_100003167 3300005841 Bacteria 16265
96 Ga0068858_100000401 3300005842 Bacteria 45107
97 Ga0068858_100064300 3300005842 Bacteria 3395
98 Ga0068858_100076818 3300005842 Bacteria 3102
99 Ga0068860_100006835 3300005843 Bacteria 11434
100 Ga0068860_100037920 3300005843 Bacteria 4612
101 Ga0068862_100012128 3300005844 Bacteria 7124
102 Ga0068862_100044860 3300005844 Bacteria 3771
103 Ga0068862_100263476 3300005844 Bacteria 1574
104 Ga0081455_10002762 3300005937 Bacteria 20717
105 Ga0081455_10147019 3300005937 Unclassified 1822
106 Ga0081538_10002015 3300005981 Bacteria 20314
107 Ga0081538_10011158 3300005981 Bacteria 7299
108 Ga0075367_10029529 3300006178 Bacteria 3137
109 Ga0097621_100000396 3300006237 Bacteria 30373
110 Ga0097621_100093721 3300006237 Bacteria 2517
111 Ga0068871_100000260 3300006358 Bacteria 36409
112 Ga0068871_100025046 3300006358 Bacteria 4637
113 Ga0075428_100001902 3300006844 Bacteria 22397
114 Ga0075428_100071335 3300006844 Bacteria 3796
115 Ga0075428_100117082 3300006844 Bacteria 2902
116 Ga0075428_100138397 3300006844 Bacteria 2647
117 Ga0075428_100183140 3300006844 Bacteria 2267
118 Ga0075430_100000309 3300006846 Bacteria 34631
119 Ga0075431_100000595 3300006847 Bacteria 30575
120 Ga0075431_100025473 3300006847 Bacteria 6063
121 Ga0075431_100064785 3300006847 Bacteria 3774
122 Ga0075433_10001126 3300006852 Bacteria 19353
123 Ga0075433_10001227 3300006852 Bacteria 18708
124 Ga0075433_10007520 3300006852 Bacteria 8649
125 Ga0075433_10014681 3300006852 Bacteria 6407
126 Ga0075433_10016316 3300006852 Bacteria 6116
127 Ga0075433_10029295 3300006852 Bacteria 4688
128 Ga0075433_10030866 3300006852 Bacteria 4575
129 Ga0075433_10091918 3300006852 Bacteria 2683
130 Ga0075434_100002187 3300006871 Bacteria 17041
131 Ga0075434_100004706 3300006871 Bacteria 12333
132 Ga0075434_100007303 3300006871 Bacteria 10225
133 Ga0075434_100008598 3300006871 Bacteria 9504
134 Ga0075434_100009474 3300006871 Bacteria 9081
135 Ga0075434_100029302 3300006871 Bacteria 5414
136 Ga0075434_100087478 3300006871 Bacteria 3117
137 Ga0075429_100011698 3300006880 Bacteria 7610
138 Ga0075429_100084986 3300006880 Bacteria 2758
139 Ga0075429_100147997 3300006880 Bacteria 2056
140 Ga0075429_100212997 3300006880 Bacteria 1692
141 Ga0075436_100049192 3300006914 Bacteria 2909
142 Ga0097620_100017802 3300006931 Bacteria 7142
143 Ga0097620_100025607 3300006931 Bacteria 5917
144 Ga0097620_100073783 3300006931 Bacteria 3450
145 Ga0097620_100222497 3300006931 Bacteria 1975
146 Ga0097620_100263780 3300006931 Bacteria 1814
147 Ga0075435_100011662 3300007076 Bacteria 6478
148 Ga0075435_100019821 3300007076 Bacteria 5145
149 Ga0075435_100043329 3300007076 Bacteria 3602
150 Ga0075435_100056249 3300007076 Bacteria 3180
151 Ga0075435_100103024 3300007076 Bacteria 2367
152 Ga0105240_10051026 3300009093 Bacteria 5209
153 Ga0111539_10000618 3300009094 Bacteria 46089
154 Ga0111539_10012364 3300009094 Bacteria 10699
155 Ga0111539_10035367 3300009094 Bacteria 6049
156 Ga0111539_10057849 3300009094 Bacteria 4602
157 Ga0111539_10075334 3300009094 Bacteria 3975
158 Ga0111539_10085475 3300009094 Bacteria 3707
159 Ga0105245_10016483 3300009098 Bacteria 6447
160 Ga0105245_10035059 3300009098 Bacteria 4452
161 Ga0105245_10047785 3300009098 Bacteria 3826
162 Ga0105245_10067137 3300009098 Bacteria 3248
163 Ga0105247_10055342 3300009101 Bacteria 2448
164 Ga0105247_10096137 3300009101 Bacteria 1887
165 Ga0114129_10000095 3300009147 Bacteria 85485
166 Ga0114129_10022320 3300009147 Bacteria 8984
167 Ga0114129_10064539 3300009147 Bacteria 5111
168 Ga0114129_10085562 3300009147 Bacteria 4374
169 Ga0114129_10111416 3300009147 Bacteria 3776
170 Ga0114129_10116199 3300009147 Bacteria 3687
171 Ga0114129_10154183 3300009147 Bacteria 3143
172 Ga0114129_10299378 3300009147 Bacteria 2144
173 Ga0114129_10421336 3300009147 Bacteria 1756
174 Ga0105242_10111131 3300009176 Bacteria 2336
175 Ga0105248_10017022 3300009177 Bacteria 8005
176 Ga0105248_10046299 3300009177 Bacteria 4875
177 Ga0105237_10213693 3300009545 Bacteria 1928
178 Ga0105237_10246032 3300009545 Bacteria 1790
179 Ga0105249_10003882 3300009553 Bacteria 12909
180 Ga0105249_10004057 3300009553 Bacteria 12626
181 Ga0105249_10015003 3300009553 Bacteria 6852
182 Ga0105239_10280044 3300010375 Bacteria 1877
183 Ga0105246_10017933 3300011119 Bacteria 4505
184 Ga0105246_10089789 3300011119 Bacteria 2211
185 Ga0157373_10085680 3300013100 Bacteria 2221
186 Ga0157369_10043483 3300013105 Bacteria 4896
187 Ga0157369_10048566 3300013105 Bacteria 4605
188 Ga0157374_10017860 3300013296 Bacteria 6251
189 Ga0157374_10028740 3300013296 Bacteria 5026
190 Ga0157374_10079292 3300013296 Bacteria 3112
191 Ga0157374_10179769 3300013296 Bacteria 2066
192 Ga0157378_10000350 3300013297 Bacteria 45204
193 Ga0157378_10015218 3300013297 Bacteria 6737
194 Ga0163162_10002057 3300013306 Bacteria 18904
195 Ga0163162_10002776 3300013306 Bacteria 16631
196 Ga0163162_10003582 3300013306 Bacteria 14860
197 Ga0163162_10059653 3300013306 Bacteria 3848
198 Ga0163162_10133197 3300013306 Bacteria 2595
199 Ga0163162_10254675 3300013306 Unclassified 1887
200 Ga0157372_10010694 3300013307 Bacteria 9765
201 Ga0157372_10024163 3300013307 Bacteria 6596
202 Ga0157375_10004730 3300013308 Bacteria 11828
203 Ga0157375_10048527 3300013308 Bacteria 4154
204 Ga0157375_10067142 3300013308 Bacteria 3583
205 Ga0157380_10001705 3300014326 Bacteria 14514
206 Ga0157380_10004204 3300014326 Bacteria 9960
207 Ga0157380_10009027 3300014326 Bacteria 7122
208 Ga0157380_10085783 3300014326 Bacteria 2585
209 Ga0157377_10004351 3300014745 Bacteria 6507
210 Ga0157379_10001590 3300014968 Bacteria 18732
211 Ga0157379_10032197 3300014968 Unclassified 4673
212 Ga0157379_10047877 3300014968 Bacteria 3815
213 Ga0157376_10028957 3300014969 Bacteria 4409
214 Ga0163161_10070767 3300017792 Bacteria 2551
215 Ga0207697_10000645 3300025315 Bacteria 19814
216 Ga0207682_10001228 3300025893 Bacteria 11848
217 Ga0207688_10000248 3300025901 Bacteria 24353
218 Ga0207688_10005866 3300025901 Bacteria 6683
219 Ga0207688_10018748 3300025901 Bacteria 3763
220 Ga0207680_10000807 3300025903 Bacteria 14745
221 Ga0207680_10078897 3300025903 Bacteria 2063
222 Ga0207680_10102401 3300025903 Bacteria 1842
223 Ga0207647_10021714 3300025904 Bacteria 4280
224 Ga0207647_10034092 3300025904 Bacteria 3253
225 Ga0207645_10001650 3300025907 Bacteria 18158
226 Ga0207643_10000084 3300025908 Bacteria 61474
227 Ga0207643_10017259 3300025908 Bacteria 3945
228 Ga0207643_10032666 3300025908 Bacteria 2908
229 Ga0207654_10010769 3300025911 Bacteria 4657
230 Ga0207707_10008876 3300025912 Bacteria 8728
231 Ga0207707_10157443 3300025912 Bacteria 1986
232 Ga0207695_10010759 3300025913 Bacteria 11158
233 Ga0207660_10083024 3300025917 Bacteria 2358
234 Ga0207662_10000870 3300025918 Bacteria 13933
235 Ga0207657_10006753 3300025919 Bacteria 11855
236 Ga0207657_10050710 3300025919 Bacteria 3610
237 Ga0207652_10029784 3300025921 Bacteria 4568
238 Ga0207652_10292761 3300025921 Unclassified 1469
239 Ga0207681_10019726 3300025923 Bacteria 4265
240 Ga0207681_10151092 3300025923 Bacteria 1740
241 Ga0207694_10028647 3300025924 Bacteria 4246
242 Ga0207659_10004813 3300025926 Bacteria 8190
243 Ga0207659_10076676 3300025926 Bacteria 2458
244 Ga0207687_10009567 3300025927 Bacteria 6338
245 Ga0207687_10011044 3300025927 Bacteria 5904
246 Ga0207687_10047130 3300025927 Bacteria 2987
247 Ga0207664_10221467 3300025929 Bacteria 1641
248 Ga0207690_10038839 3300025932 Unclassified 3101
249 Ga0207706_10002527 3300025933 Bacteria 17843
250 Ga0207706_10003359 3300025933 Bacteria 15311
251 Ga0207706_10022430 3300025933 Bacteria 5666
252 Ga0207706_10071305 3300025933 Bacteria 3056
253 Ga0207670_10034124 3300025936 Bacteria 3285
254 Ga0207669_10000260 3300025937 Bacteria 24012
255 Ga0207669_10007424 3300025937 Bacteria 5068
256 Ga0207691_10000524 3300025940 Bacteria 38234
257 Ga0207691_10037017 3300025940 Bacteria 4520
258 Ga0207691_10120425 3300025940 Bacteria 2327
259 Ga0207711_10004800 3300025941 Bacteria 11475
260 Ga0207689_10001631 3300025942 Bacteria 21254
261 Ga0207689_10002064 3300025942 Bacteria 18956
262 Ga0207689_10005618 3300025942 Bacteria 11172
263 Ga0207689_10062844 3300025942 Bacteria 3054
264 Ga0207679_10060809 3300025945 Bacteria 2809
265 Ga0207679_10089073 3300025945 Bacteria 2381
266 Ga0207667_10036600 3300025949 Bacteria 5258
267 Ga0207712_10008666 3300025961 Bacteria 6433
268 Ga0207712_10024623 3300025961 Bacteria 3989
269 Ga0207668_10012293 3300025972 Bacteria 5235
270 Ga0207640_10200833 3300025981 Bacteria 1511
271 Ga0207658_10064992 3300025986 Bacteria 2738
272 Ga0207677_10027046 3300026023 Bacteria 3607
273 Ga0207677_10077817 3300026023 Bacteria 2366
274 Ga0207677_10126580 3300026023 Bacteria 1932
275 Ga0207703_10012060 3300026035 Bacteria 6734
276 Ga0207678_10000666 3300026067 Bacteria 31531
277 Ga0207708_10030657 3300026075 Bacteria 4078
278 Ga0207641_10012624 3300026088 Bacteria 6928
279 Ga0207641_10036994 3300026088 Bacteria 4075
280 Ga0207648_10008607 3300026089 Bacteria 9868
281 Ga0207648_10015232 3300026089 Bacteria 7073
282 Ga0207648_10027427 3300026089 Bacteria 5055
283 Ga0207648_10098076 3300026089 Bacteria 2565
284 Ga0207676_10018537 3300026095 Bacteria 5061
285 Ga0207674_10089079 3300026116 Bacteria 3079
286 Ga0207675_100004380 3300026118 Bacteria 13649
287 Ga0207675_100094304 3300026118 Bacteria 2815
288 Ga0207683_10004659 3300026121 Bacteria 11820
289 Ga0207683_10019253 3300026121 Bacteria 5828
290 Ga0207428_10000118 3300027907 Bacteria 107695
291 Ga0207428_10015996 3300027907 Bacteria 6466
292 Ga0207428_10091230 3300027907 Bacteria 2365
293 Ga0268266_10040661 3300028379 Bacteria 3964
294 Ga0268266_10070380 3300028379 Bacteria 3031
295 Ga0268265_10042761 3300028380 Bacteria 3364
296 Ga0268265_10194702 3300028380 Bacteria 1753
297 Ga0268264_10009887 3300028381 Bacteria 7897
298 Ga0307407_10071428 3300031903 Unclassified 2067
299 Ga0307411_10128789 3300032005 Bacteria 1846
300 Ga0373926_0009411 3300035083 Bacteria 3267
301 Ga0373962_0018113 3300035242 Bacteria 1830
302 Ga0373925_0009846 3300037068 Bacteria 6942
303 Ga0451577_0000047 3300042876 Bacteria 312768
304 Ga0453684_0000382 3300044712 Bacteria 181519
305 Ga0453684_0109522 3300044712 Bacteria 3359
306 Ga0451576_0198676 3300045051 Bacteria 2094
307 Ga0495580_0001152 3300046472 Bacteria 23261
308 Ga0495580_0002735 3300046472 Bacteria 15211
309 Ga0495580_0036858 3300046472 Bacteria 3511
310 Ga0495594_0032746 3300046499 Bacteria 2823
311 Ga0495665_0120259 3300046531 Bacteria 1376
312 Ga0495656_0050608 3300046615 Bacteria 1775
313 Ga0495669_0021483 3300046684 Bacteria 2802
314 Ga0495624_0109405 3300046690 Bacteria 1700
315 Ga0496102_0089798 3300048905 Bacteria 2843
316 Ga0496102_0097263 3300048905 Bacteria 2730
317 Ga0496103_0022360 3300048906 Bacteria 3808
318 Ga0496103_0072389 3300048906 Bacteria 2159
319 Ga0496103_0112044 3300048906 Bacteria 1734
320 Ga0496105_0028466 3300048908 Bacteria 4569
321 Ga0496106_0066643 3300048909 Unclassified 2743
322 Ga0496106_0111250 3300048909 Bacteria 2133
323 Ga0496106_0280178 3300048909 Bacteria 1336
324 Ga0496108_0027441 3300048911 Bacteria 4702
325 Ga0496109_0155997 3300048912 Bacteria 2138
326 Ga0496112_0041181 3300048915 Bacteria 4518
327 Ga0496112_0119336 3300048915 Bacteria 2607
328 Ga0496112_0128932 3300048915 Bacteria 2500
329 Ga0501036_0001384 3300049572 Bacteria 18633
330 Ga0501038_0000724 3300049574 Bacteria 29502
331 Ga0501039_0009645 3300049575 Bacteria 7361
332 Ga0501040_0014147 3300049576 Bacteria 5252
333 Ga0501040_0091593 3300049576 Bacteria 2113
334 Ga0501041_0018130 3300049577 Bacteria 4192
335 Ga0501041_0018547 3300049577 Bacteria 4145
336 Ga0501042_0078518 3300049578 Bacteria 2364
337 Ga0501043_0128083 3300049579 Bacteria 1990
338 Ga0501046_0027773 3300049580 Bacteria 4614
339 Ga0501048_0029986 3300049582 Bacteria 3940
340 Ga0501048_0080540 3300049582 Bacteria 2297
341 Ga0501068_0033466 3300049584 Bacteria 3061
342 Ga0501071_0009915 3300049587 Bacteria 6361
343 Ga0501071_0018877 3300049587 Bacteria 4781
344 Ga0501071_0112093 3300049587 Bacteria 2017
345 Ga0501072_0000651 3300049588 Bacteria 24962
346 Ga0501075_0000042 3300049591 Bacteria 51447
347 Ga0501075_0010761 3300049591 Bacteria 6444
348 Ga0501076_0000019 3300049592 Bacteria 87222
349 Ga0501076_0151118 3300049592 Bacteria 1889
350 Ga0501077_0052975 3300049593 Bacteria 2576
351 Ga0501079_0005996 3300049741 Bacteria 9100
352 Ga0501080_0071991 3300049742 Bacteria 3216
353 Ga0501081_0006453 3300049743 Bacteria 7613
354 Ga0501081_0014506 3300049743 Bacteria 5197
355 Ga0501045_0051101 3300049824 Bacteria 3016
356 nmdc:mga0k408_24033_c1 3300050493 Bacteria 3441
357 nmdc:mga06z11_49620_c1 3300050494 Bacteria 2142
358 nmdc:mga05p37_109671_c1 3300050507 Bacteria 3395
359 nmdc:mga05p37_113229_c1 3300050507 Bacteria 3336
360 nmdc:mga05p37_12107_c1 3300050507 Bacteria 10298
361 nmdc:mga05p37_1892_c1 3300050507 Bacteria 24386
362 nmdc:mga05p37_31748_c1 3300050507 Bacteria 6455
363 nmdc:mga05p37_67842_c1 3300050507 Bacteria 4388
364 nmdc:mga09592_17610_c1 3300050508 Bacteria 5854
365 nmdc:mga09592_236762_c1 3300050508 Bacteria 1582
366 nmdc:mga09592_46747_c1 3300050508 Bacteria 3646
367 nmdc:mga09592_66309_c1 3300050508 Bacteria 3060
368 nmdc:mga0qj67_112333_c1 3300050509 Bacteria 2200
369 nmdc:mga0qj67_35645_c1 3300050509 Bacteria 3891
370 nmdc:mga0qj67_70_c1 3300050509 Bacteria 73245
371 nmdc:mga06r32_121572_c1 3300050510 Unclassified 2576
372 nmdc:mga06r32_130899_c1 3300050510 Bacteria 2481
373 nmdc:mga06r32_1591_c1 3300050510 Bacteria 20444
374 nmdc:mga06r32_48824_c1 3300050510 Bacteria 4047
375 nmdc:mga06r32_56299_c1 3300050510 Bacteria 3774
376 nmdc:mga08y16_287782_c1 3300050511 Bacteria 1694
377 nmdc:mga08y16_6339_c1 3300050511 Bacteria 12410
378 nmdc:mga08y16_6485_c1 3300050511 Bacteria 12278
379 nmdc:mga08y16_7653_c1 3300050511 Bacteria 11306
380 nmdc:mga0n895_10921_c1 3300050512 Bacteria 8068
381 nmdc:mga0n895_175370_c1 3300050512 Bacteria 2174
382 nmdc:mga0n895_19719_c1 3300050512 Bacteria 6272
383 nmdc:mga0n895_29513_c1 3300050512 Bacteria 5233
384 nmdc:mga0n895_30356_c1 3300050512 Bacteria 5165
385 nmdc:mga0n895_44115_c1 3300050512 Bacteria 4349
386 nmdc:mga0n895_4882_c1 3300050512 Bacteria 11109
387 nmdc:mga0rr50_244519_c1 3300050513 Bacteria 1488
388 nmdc:mga0rr50_94058_c1 3300050513 Bacteria 2340
389 nmdc:mga0rr50_98675_c1 3300050513 Bacteria 2290
390 nmdc:mga0a205_105837_c1 3300050515 Bacteria 2712
391 nmdc:mga0a205_117273_c1 3300050515 Bacteria 2560
392 nmdc:mga0a205_12022_c2 3300050515 Bacteria 5262
393 nmdc:mga0a205_18642_c1 3300050515 Bacteria 6529
394 nmdc:mga0a205_4171_c1 3300050515 Bacteria 12949
395 nmdc:mga0a205_5612_c1 3300050515 Bacteria 11305
396 nmdc:mga0a205_62781_c1 3300050515 Bacteria 3589
397 Ga0495619_0071547 3300053085 Bacteria 2321
398 Ga0501084_0000950 3300054114 Bacteria 22415
399 Ga0501084_0015795 3300054114 Bacteria 6262
400 Ga0501082_0041540 3300060353 Bacteria 3965
401 Ga0501082_0272904 3300060353 Bacteria 1472
402 Ga0530510_0000004 3300061734 Bacteria 256134
403 Ga0530510_0009356 3300061734 Bacteria 6870
404 Ga0207700_10165579
405 JGI25407J50210_10022354
406 Ga0065712_10069989
407 Ga0065715_10001325
408 Ga0065715_10005070
409 Ga0065707_10018236
410 Ga0065707_10090367
411 Ga0070690_100000966
412 Ga0070690_100022368
413 Ga0068869_100001137
414 Ga0068869_100004253
415 Ga0070666_10007795
416 Ga0070666_10012504
417 Ga0070680_100016503
418 Ga0070682_100031378
419 Ga0068868_100005651
420 Ga0068868_100013976
421 Ga0068868_100097356
422 Ga0068868_100133930
423 Ga0070660_100026378
424 Ga0070689_100013798
425 Ga0070691_10073749
426 Ga0070687_100002819
427 Ga0070661_100018205
428 Ga0070661_100036024
429 Ga0070692_10058399
430 Ga0070692_10064821
431 Ga0070668_100011844
432 Ga0070668_100027486
433 Ga0070668_100129271
434 Ga0070669_100015264
435 Ga0070669_100062373
436 Ga0070675_100024709
437 Ga0070674_100000413
438 Ga0070674_100156546
439 Ga0070673_100004893
440 Ga0070673_100009532
441 Ga0070688_100014498
442 Ga0070659_100027434
443 Ga0070659_100034908
444 Ga0070667_100011391
445 Ga0070667_100050575
446 Ga0070714_100266345
447 Ga0070701_10029909
448 Ga0070711_100039263
449 Ga0070705_100010256
450 Ga0070705_100027847
451 Ga0070708_100112403
452 Ga0070663_100040027
453 Ga0070663_100040591
454 Ga0070663_100074337
455 Ga0070662_100001624
456 Ga0070662_100020870
457 Ga0070662_100047518
458 Ga0070662_100055716
459 Ga0070681_10015704
460 Ga0070681_10022253
461 Ga0070681_10080909
462 Ga0068867_100015520
463 Ga0068867_100072244
464 Ga0068867_100096182
465 Ga0070685_10002881
466 Ga0070679_100155408
467 Ga0070672_100051904
468 Ga0070686_100001831
469 Ga0070686_100062662
470 Ga0070686_100105112
471 Ga0070695_100055613
472 Ga0070696_100011415
473 Ga0070696_100057470
474 Ga0070693_100019953
475 Ga0070693_100035972
476 Ga0070665_100011432
477 Ga0070665_100048959
478 Ga0070664_100003176
479 Ga0070664_100065266
480 Ga0068854_100030344
481 Ga0068856_100054028
482 Ga0068852_100009853
483 Ga0068852_100198931
484 Ga0068859_100017802
485 Ga0068859_100025608
486 Ga0068859_100073781
487 Ga0068859_100222492
488 Ga0068859_100263762
489 Ga0068864_100059875
490 Ga0068864_100074989
491 Ga0068864_100130412
492 Ga0068866_10068786
493 Ga0068861_100012155
494 Ga0068861_100193537
495 Ga0068861_100235698
496 Ga0068870_10000489
497 Ga0068870_10028219
498 Ga0068863_100003167
499 Ga0068858_100000401
500 Ga0068858_100064300
501 Ga0068858_100076818
502 Ga0068860_100006835
503 Ga0068860_100037920
504 Ga0068862_100012128
505 Ga0068862_100044860
506 Ga0068862_100263476
507 Ga0081455_10002762
508 Ga0081455_10147019
509 Ga0081538_10002015
510 Ga0081538_10011158
511 Ga0075367_10029529
512 Ga0097621_100000396
513 Ga0097621_100093721
514 Ga0068871_100000260
515 Ga0068871_100025046
516 Ga0075428_100001902
517 Ga0075428_100071335
518 Ga0075428_100117082
519 Ga0075428_100138397
520 Ga0075428_100183140
521 Ga0075430_100000309
522 Ga0075431_100000595
523 Ga0075431_100025473
524 Ga0075431_100064785
525 Ga0075433_10001126
526 Ga0075433_10001227
527 Ga0075433_10007520
528 Ga0075433_10014681
529 Ga0075433_10016316
530 Ga0075433_10029295
531 Ga0075433_10030866
532 Ga0075433_10091918
533 Ga0075434_100002187
534 Ga0075434_100004706
535 Ga0075434_100007303
536 Ga0075434_100008598
537 Ga0075434_100009474
538 Ga0075434_100029302
539 Ga0075434_100087478
540 Ga0075429_100011698
541 Ga0075429_100084986
542 Ga0075429_100147997
543 Ga0075429_100212997
544 Ga0075436_100049192
545 Ga0097620_100017802
546 Ga0097620_100025607
547 Ga0097620_100073783
548 Ga0097620_100222497
549 Ga0097620_100263780
550 Ga0075435_100011662
551 Ga0075435_100019821
552 Ga0075435_100043329
553 Ga0075435_100056249
554 Ga0075435_100103024
555 Ga0105240_10051026
556 Ga0111539_10000618
557 Ga0111539_10012364
558 Ga0111539_10035367
559 Ga0111539_10057849
560 Ga0111539_10075334
561 Ga0111539_10085475
562 Ga0105245_10016483
563 Ga0105245_10035059
564 Ga0105245_10047785
565 Ga0105245_10067137
566 Ga0105247_10055342
567 Ga0105247_10096137
568 Ga0114129_10000095
569 Ga0114129_10022320
570 Ga0114129_10064539
571 Ga0114129_10085562
572 Ga0114129_10111416
573 Ga0114129_10116199
574 Ga0114129_10154183
575 Ga0114129_10299378
576 Ga0114129_10421336
577 Ga0105242_10111131
578 Ga0105248_10017022
579 Ga0105248_10046299
580 Ga0105237_10213693
581 Ga0105237_10246032
582 Ga0105249_10003882
583 Ga0105249_10004057
584 Ga0105249_10015003
585 Ga0105239_10280044
586 Ga0105246_10017933
587 Ga0105246_10089789
588 Ga0157373_10085680
589 Ga0157369_10043483
590 Ga0157369_10048566
591 Ga0157374_10017860
592 Ga0157374_10028740
593 Ga0157374_10079292
594 Ga0157374_10179769
595 Ga0157378_10000350
596 Ga0157378_10015218
597 Ga0163162_10002057
598 Ga0163162_10002776
599 Ga0163162_10003582
600 Ga0163162_10059653
601 Ga0163162_10133197
602 Ga0163162_10254675
603 Ga0157372_10010694
604 Ga0157372_10024163
605 Ga0157375_10004730
606 Ga0157375_10048527
607 Ga0157375_10067142
608 Ga0157380_10001705
609 Ga0157380_10004204
610 Ga0157380_10009027
611 Ga0157380_10085783
612 Ga0157377_10004351
613 Ga0157379_10001590
614 Ga0157379_10032197
615 Ga0157379_10047877
616 Ga0157376_10028957
617 Ga0163161_10070767
618 Ga0207697_10000645
619 Ga0207682_10001228
620 Ga0207688_10000248
621 Ga0207688_10005866
622 Ga0207688_10018748
623 Ga0207680_10000807
624 Ga0207680_10078897
625 Ga0207680_10102401
626 Ga0207647_10021714
627 Ga0207647_10034092
628 Ga0207645_10001650
629 Ga0207643_10000084
630 Ga0207643_10017259
631 Ga0207643_10032666
632 Ga0207654_10010769
633 Ga0207707_10008876
634 Ga0207707_10157443
635 Ga0207695_10010759
636 Ga0207660_10083024
637 Ga0207662_10000870
638 Ga0207657_10006753
639 Ga0207657_10050710
640 Ga0207652_10029784
641 Ga0207652_10292761
642 Ga0207681_10019726
643 Ga0207681_10151092
644 Ga0207694_10028647
645 Ga0207659_10004813
646 Ga0207659_10076676
647 Ga0207687_10009567
648 Ga0207687_10011044
649 Ga0207687_10047130
650 Ga0207664_10221467
651 Ga0207690_10038839
652 Ga0207706_10002527
653 Ga0207706_10003359
654 Ga0207706_10022430
655 Ga0207706_10071305
656 Ga0207670_10034124
657 Ga0207669_10000260
658 Ga0207669_10007424
659 Ga0207691_10000524
660 Ga0207691_10037017
661 Ga0207691_10120425
662 Ga0207711_10004800
663 Ga0207689_10001631
664 Ga0207689_10002064
665 Ga0207689_10005618
666 Ga0207689_10062844
667 Ga0207679_10060809
668 Ga0207679_10089073
669 Ga0207667_10036600
670 Ga0207712_10008666
671 Ga0207712_10024623
672 Ga0207668_10012293
673 Ga0207640_10200833
674 Ga0207658_10064992
675 Ga0207677_10027046
676 Ga0207677_10077817
677 Ga0207677_10126580
678 Ga0207703_10012060
679 Ga0207678_10000666
680 Ga0207708_10030657
681 Ga0207641_10012624
682 Ga0207641_10036994
683 Ga0207648_10008607
684 Ga0207648_10015232
685 Ga0207648_10027427
686 Ga0207648_10098076
687 Ga0207676_10018537
688 Ga0207674_10089079
689 Ga0207675_100004380
690 Ga0207675_100094304
691 Ga0207683_10004659
692 Ga0207683_10019253
693 Ga0207428_10000118
694 Ga0207428_10015996
695 Ga0207428_10091230
696 Ga0268266_10040661
697 Ga0268266_10070380
698 Ga0268265_10042761
699 Ga0268265_10194702
700 Ga0268264_10009887
701 Ga0307407_10071428
702 Ga0307411_10128789
703 Ga0373926_0009411
704 Ga0373962_0018113
705 Ga0373925_0009846
706 Ga0451577_0000047
707 Ga0453684_0000382
708 Ga0453684_0109522
709 Ga0451576_0198676
710 Ga0495580_0001152
711 Ga0495580_0002735
712 Ga0495580_0036858
713 Ga0495594_0032746
714 Ga0495665_0120259
715 Ga0495656_0050608
716 Ga0495669_0021483
717 Ga0495624_0109405
718 Ga0496102_0089798
719 Ga0496102_0097263
720 Ga0496103_0022360
721 Ga0496103_0072389
722 Ga0496103_0112044
723 Ga0496105_0028466
724 Ga0496106_0066643
725 Ga0496106_0111250
726 Ga0496106_0280178
727 Ga0496108_0027441
728 Ga0496109_0155997
729 Ga0496112_0041181
730 Ga0496112_0119336
731 Ga0496112_0128932
732 Ga0501036_0001384
733 Ga0501038_0000724
734 Ga0501039_0009645
735 Ga0501040_0014147
736 Ga0501040_0091593
737 Ga0501041_0018130
738 Ga0501041_0018547
739 Ga0501042_0078518
740 Ga0501043_0128083
741 Ga0501046_0027773
742 Ga0501048_0029986
743 Ga0501048_0080540
744 Ga0501068_0033466
745 Ga0501071_0009915
746 Ga0501071_0018877
747 Ga0501071_0112093
748 Ga0501072_0000651
749 Ga0501075_0000042
750 Ga0501075_0010761
751 Ga0501076_0000019
752 Ga0501076_0151118
753 Ga0501077_0052975
754 Ga0501079_0005996
755 Ga0501080_0071991
756 Ga0501081_0006453
757 Ga0501081_0014506
758 Ga0501045_0051101
759 nmdc:mga0k408_24033_c1
760 nmdc:mga06z11_49620_c1
761 nmdc:mga05p37_109671_c1
762 nmdc:mga05p37_113229_c1
763 nmdc:mga05p37_12107_c1
764 nmdc:mga05p37_1892_c1
765 nmdc:mga05p37_31748_c1
766 nmdc:mga05p37_67842_c1
767 nmdc:mga09592_17610_c1
768 nmdc:mga09592_236762_c1
769 nmdc:mga09592_46747_c1
770 nmdc:mga09592_66309_c1
771 nmdc:mga0qj67_112333_c1
772 nmdc:mga0qj67_35645_c1
773 nmdc:mga0qj67_70_c1
774 nmdc:mga06r32_121572_c1
775 nmdc:mga06r32_130899_c1
776 nmdc:mga06r32_1591_c1
777 nmdc:mga06r32_48824_c1
778 nmdc:mga06r32_56299_c1
779 nmdc:mga08y16_287782_c1
780 nmdc:mga08y16_6339_c1
781 nmdc:mga08y16_6485_c1
782 nmdc:mga08y16_7653_c1
783 nmdc:mga0n895_10921_c1
784 nmdc:mga0n895_175370_c1
785 nmdc:mga0n895_19719_c1
786 nmdc:mga0n895_29513_c1
787 nmdc:mga0n895_30356_c1
788 nmdc:mga0n895_44115_c1
789 nmdc:mga0n895_4882_c1
790 nmdc:mga0rr50_244519_c1
791 nmdc:mga0rr50_94058_c1
792 nmdc:mga0rr50_98675_c1
793 nmdc:mga0a205_105837_c1
794 nmdc:mga0a205_117273_c1
795 nmdc:mga0a205_12022_c2
796 nmdc:mga0a205_18642_c1
797 nmdc:mga0a205_4171_c1
798 nmdc:mga0a205_5612_c1
799 nmdc:mga0a205_62781_c1
800 Ga0495619_0071547
801 Ga0501084_0000950
802 Ga0501084_0015795
803 Ga0501082_0041540
804 Ga0501082_0272904
805 Ga0530510_0000004
806 Ga0530510_0009356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

10

177

0.95

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

179

444

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h93-assembly1.cif.gz_A active mutant (s215->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9354 3 453
1e77-assembly1.cif.gz_A complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate 0.9344 3 453
2dpg-assembly1.cif.gz_A-2 complex of inactive mutant (h240->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with nadp+ 0.9292 5 453
7xhl-assembly1.cif.gz_D complex structure of a glucose 6-phosphate dehydrogenase from zymomonas mobilis 0.9286 4 453
1dpg-assembly1.cif.gz_B glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9276 3 452
ID Description Score Start End Superfamily
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9643 6 166 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9576 6 163 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 11 168 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 11 164 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 6 163 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5R2MZ40-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9908 72 162 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A3N5FSG2-F1-model_v4 Glucose-6-phosphate dehydrogenase NAD-binding domain-containing protein 0.9866 6 96 GO:0006006
GO:0016614
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9844 206 322 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A659UKS1-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9828 192 304 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A528LVB6-F1-model_v4 Glucose-6-phosphate dehydrogenase (NADP(+)) 0.982 1 333 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map