F435465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 403 | 211 | 806 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0014956|Ga0466965_0014956_1653_2249 |
| Length | 198 |
| Sequence | VGEEETIRMPKHYTLAELDDAAEALRNGGVIAYPTEAVFGLGCDPHDRVAFERIFALKQRPATQGVLLIAADFAQITRYVDMTKVPQGVLAQVRASWPGPFTWVFPRSNDVPDWVAGAHEGIALRVTGHGPAAALCRAFGGALVSTSANPHGQPPARDVATVTAYFGDALDGVVDAPLGGAAQPTTIRDALTGAIIRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 80 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 148 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 149 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 150 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 151 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 182 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 183 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 203 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 204 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 205 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 206 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 207 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 208 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 209 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 210 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 211 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.27 |
| Metatranscriptomes | 0.5 |
| Isolates | 2.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.38 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 74.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0014956 | 3300044683 | Bacteria | 3679 |
| 2 | JGI25162J39368_1000705 | 3300002737 | Bacteria | 23246 |
| 3 | JGI25162J39368_1001445 | 3300002737 | Bacteria | 12645 |
| 4 | JGI25157J39369_1001046 | 3300002741 | Bacteria | 12637 |
| 5 | JGI25157J39369_1001662 | 3300002741 | Bacteria | 7585 |
| 6 | JGI25164J39214_1000347 | 3300002772 | Bacteria | 29028 |
| 7 | JGI25164J39214_1000714 | 3300002772 | Bacteria | 12645 |
| 8 | JGI25164J39214_1000718 | 3300002772 | Bacteria | 12581 |
| 9 | JGI25164J39214_1000761 | 3300002772 | Bacteria | 11822 |
| 10 | JGI25165J46597_1000640 | 3300003214 | Bacteria | 29018 |
| 11 | JGI25165J46597_1001443 | 3300003214 | Bacteria | 12645 |
| 12 | JGI25165J46597_1003068 | 3300003214 | Bacteria | 4520 |
| 13 | rootL2_10038685 | 3300003322 | Bacteria | 1418 |
| 14 | rootH1_10292646 | 3300003323 | Bacteria | 1203 |
| 15 | Ga0055538_1003613 | 3300003751 | Bacteria | 1925 |
| 16 | Ga0055539_1002420 | 3300003752 | Bacteria | 2868 |
| 17 | Ga0055533_1002475 | 3300003756 | Bacteria | 4179 |
| 18 | Ga0055533_1003063 | 3300003756 | Bacteria | 3536 |
| 19 | Ga0055533_1017870 | 3300003756 | Bacteria | 669 |
| 20 | Ga0055525_1000082 | 3300003759 | Bacteria | 159396 |
| 21 | Ga0055527_1000176 | 3300003760 | Bacteria | 43621 |
| 22 | Ga0055527_1000179 | 3300003760 | Bacteria | 42841 |
| 23 | Ga0055535_1000373 | 3300003761 | Bacteria | 42794 |
| 24 | Ga0055535_1000405 | 3300003761 | Bacteria | 40615 |
| 25 | Ga0055535_1001379 | 3300003761 | Bacteria | 12645 |
| 26 | Ga0055535_1001457 | 3300003761 | Bacteria | 11944 |
| 27 | Ga0055542_1000394 | 3300003762 | Bacteria | 43618 |
| 28 | Ga0055542_1000431 | 3300003762 | Bacteria | 40271 |
| 29 | Ga0055542_1000734 | 3300003762 | Bacteria | 25435 |
| 30 | Ga0055542_1001349 | 3300003762 | Bacteria | 12645 |
| 31 | Ga0055529_1000420 | 3300003763 | Bacteria | 43618 |
| 32 | Ga0055529_1000428 | 3300003763 | Bacteria | 42837 |
| 33 | Ga0055529_1001072 | 3300003763 | Bacteria | 12645 |
| 34 | Ga0070690_100236913 | 3300005330 | Bacteria | 1285 |
| 35 | Ga0070682_100003420 | 3300005337 | Bacteria | 8801 |
| 36 | Ga0070682_100005911 | 3300005337 | Bacteria | 6841 |
| 37 | Ga0070682_100144425 | 3300005337 | Bacteria | 1626 |
| 38 | Ga0070682_100145605 | 3300005337 | Bacteria | 1620 |
| 39 | Ga0070660_100098216 | 3300005339 | Bacteria | 2317 |
| 40 | Ga0070661_100043073 | 3300005344 | Bacteria | 3297 |
| 41 | Ga0070675_100124335 | 3300005354 | Bacteria | 2194 |
| 42 | Ga0070674_100976625 | 3300005356 | Bacteria | 742 |
| 43 | Ga0070673_100668224 | 3300005364 | Bacteria | 952 |
| 44 | Ga0070688_100503788 | 3300005365 | Bacteria | 914 |
| 45 | Ga0070659_100060238 | 3300005366 | Bacteria | 2998 |
| 46 | Ga0070659_100064017 | 3300005366 | Bacteria | 2910 |
| 47 | Ga0070659_100078899 | 3300005366 | Bacteria | 2627 |
| 48 | Ga0070714_100000136 | 3300005435 | Bacteria | 58402 |
| 49 | Ga0070714_100009681 | 3300005435 | Bacteria | 7589 |
| 50 | Ga0070713_100000663 | 3300005436 | Bacteria | 22010 |
| 51 | Ga0070711_100176577 | 3300005439 | Bacteria | 1632 |
| 52 | Ga0070694_101231724 | 3300005444 | Bacteria | 628 |
| 53 | Ga0070663_100029737 | 3300005455 | Bacteria | 3736 |
| 54 | Ga0070678_100111094 | 3300005456 | Bacteria | 2144 |
| 55 | Ga0070678_100158743 | 3300005456 | Bacteria | 1830 |
| 56 | Ga0070662_100157119 | 3300005457 | Bacteria | 1776 |
| 57 | Ga0070681_10013810 | 3300005458 | Bacteria | 8037 |
| 58 | Ga0070681_10184664 | 3300005458 | Bacteria | 2006 |
| 59 | Ga0070681_10298921 | 3300005458 | Bacteria | 1520 |
| 60 | Ga0068867_100036463 | 3300005459 | Bacteria | 3570 |
| 61 | Ga0070679_100030348 | 3300005530 | Bacteria | 5338 |
| 62 | Ga0070684_100042993 | 3300005535 | Bacteria | 3902 |
| 63 | Ga0070684_100276450 | 3300005535 | Bacteria | 1538 |
| 64 | Ga0068853_100002290 | 3300005539 | Bacteria | 14303 |
| 65 | Ga0068853_100083800 | 3300005539 | Bacteria | 2793 |
| 66 | Ga0068853_100272192 | 3300005539 | Bacteria | 1560 |
| 67 | Ga0068853_100346166 | 3300005539 | Bacteria | 1382 |
| 68 | Ga0070696_100016454 | 3300005546 | Bacteria | 4981 |
| 69 | Ga0070696_100420450 | 3300005546 | Bacteria | 1049 |
| 70 | Ga0070693_100013608 | 3300005547 | Bacteria | 4149 |
| 71 | Ga0070693_100255620 | 3300005547 | Bacteria | 1163 |
| 72 | Ga0068855_100276854 | 3300005563 | Bacteria | 1865 |
| 73 | Ga0070664_100543555 | 3300005564 | Bacteria | 1074 |
| 74 | Ga0068857_100149478 | 3300005577 | Bacteria | 2115 |
| 75 | Ga0068854_100274841 | 3300005578 | Bacteria | 1354 |
| 76 | Ga0068856_100000138 | 3300005614 | Bacteria | 73748 |
| 77 | Ga0068856_100000938 | 3300005614 | Bacteria | 31227 |
| 78 | Ga0068856_100084270 | 3300005614 | Bacteria | 3157 |
| 79 | Ga0068856_100125526 | 3300005614 | Bacteria | 2569 |
| 80 | Ga0068852_100000993 | 3300005616 | Bacteria | 18725 |
| 81 | Ga0068852_100087699 | 3300005616 | Bacteria | 2777 |
| 82 | Ga0068852_100798083 | 3300005616 | Unclassified | 958 |
| 83 | Ga0068859_100695974 | 3300005617 | Bacteria | 1107 |
| 84 | Ga0068864_100832311 | 3300005618 | Bacteria | 909 |
| 85 | Ga0068851_10060724 | 3300005834 | Bacteria | 1936 |
| 86 | Ga0068851_10222379 | 3300005834 | Bacteria | 1061 |
| 87 | Ga0068863_100064829 | 3300005841 | Bacteria | 3455 |
| 88 | Ga0068863_100306591 | 3300005841 | Bacteria | 1541 |
| 89 | Ga0068860_100064748 | 3300005843 | Bacteria | 3472 |
| 90 | Ga0068862_100262438 | 3300005844 | Bacteria | 1577 |
| 91 | Ga0070712_100062304 | 3300006175 | Bacteria | 2637 |
| 92 | Ga0070712_100156822 | 3300006175 | Bacteria | 1754 |
| 93 | Ga0097621_100030828 | 3300006237 | Bacteria | 4249 |
| 94 | Ga0068871_100039270 | 3300006358 | Bacteria | 3786 |
| 95 | Ga0068865_100051306 | 3300006881 | Bacteria | 2855 |
| 96 | Ga0068865_100616334 | 3300006881 | Bacteria | 919 |
| 97 | Ga0097620_100695885 | 3300006931 | Bacteria | 1107 |
| 98 | Ga0105240_10020394 | 3300009093 | Bacteria | 8843 |
| 99 | Ga0105240_10092425 | 3300009093 | Bacteria | 3694 |
| 100 | Ga0105240_10498135 | 3300009093 | Bacteria | 1355 |
| 101 | Ga0105245_11414819 | 3300009098 | Bacteria | 746 |
| 102 | Ga0105241_10113604 | 3300009174 | Bacteria | 2171 |
| 103 | Ga0105241_10143875 | 3300009174 | Bacteria | 1944 |
| 104 | Ga0105242_10623300 | 3300009176 | Bacteria | 1045 |
| 105 | Ga0105237_10000108 | 3300009545 | Bacteria | 116481 |
| 106 | Ga0105237_10178205 | 3300009545 | Bacteria | 2126 |
| 107 | Ga0105237_10475288 | 3300009545 | Bacteria | 1256 |
| 108 | Ga0105238_10077321 | 3300009551 | Bacteria | 3319 |
| 109 | Ga0105238_10094582 | 3300009551 | Bacteria | 2976 |
| 110 | Ga0105238_10284964 | 3300009551 | Bacteria | 1634 |
| 111 | Ga0105238_11059889 | 3300009551 | Bacteria | 833 |
| 112 | Ga0105249_10086206 | 3300009553 | Bacteria | 2928 |
| 113 | Ga0105239_10097327 | 3300010375 | Bacteria | 3252 |
| 114 | Ga0105239_10346308 | 3300010375 | Bacteria | 1677 |
| 115 | Ga0105239_10500660 | 3300010375 | Bacteria | 1381 |
| 116 | Ga0105239_10934979 | 3300010375 | Bacteria | 995 |
| 117 | Ga0157373_10124036 | 3300013100 | Bacteria | 1816 |
| 118 | Ga0157373_10376397 | 3300013100 | Bacteria | 1015 |
| 119 | Ga0157371_10078098 | 3300013102 | Bacteria | 2344 |
| 120 | Ga0157370_10028195 | 3300013104 | Bacteria | 5526 |
| 121 | Ga0157370_10092086 | 3300013104 | Bacteria | 2846 |
| 122 | Ga0157370_10422738 | 3300013104 | Bacteria | 1226 |
| 123 | Ga0157369_10001250 | 3300013105 | Bacteria | 31665 |
| 124 | Ga0157369_10023424 | 3300013105 | Bacteria | 6876 |
| 125 | Ga0157369_10780261 | 3300013105 | Bacteria | 982 |
| 126 | Ga0157369_11052126 | 3300013105 | Bacteria | 833 |
| 127 | Ga0157369_11280052 | 3300013105 | Unclassified | 748 |
| 128 | Ga0157378_10000005 | 3300013297 | Bacteria | 197893 |
| 129 | Ga0157378_10441581 | 3300013297 | Bacteria | 1290 |
| 130 | Ga0163162_10004503 | 3300013306 | Bacteria | 13418 |
| 131 | Ga0163162_10061251 | 3300013306 | Bacteria | 3800 |
| 132 | Ga0163162_10398786 | 3300013306 | Bacteria | 1508 |
| 133 | Ga0157372_10042167 | 3300013307 | Bacteria | 5046 |
| 134 | Ga0157372_10059684 | 3300013307 | Bacteria | 4267 |
| 135 | Ga0157375_10015674 | 3300013308 | Bacteria | 6789 |
| 136 | Ga0163163_10141379 | 3300014325 | Bacteria | 2449 |
| 137 | Ga0182008_10003298 | 3300014497 | Bacteria | 9825 |
| 138 | Ga0182008_10020743 | 3300014497 | Bacteria | 3380 |
| 139 | Ga0182008_10204300 | 3300014497 | Bacteria | 1006 |
| 140 | Ga0157379_10032747 | 3300014968 | Bacteria | 4635 |
| 141 | Ga0157376_10004652 | 3300014969 | Bacteria | 9563 |
| 142 | Ga0157376_10089216 | 3300014969 | Bacteria | 2665 |
| 143 | Ga0182006_1000133 | 3300015261 | Bacteria | 80418 |
| 144 | Ga0182006_1016232 | 3300015261 | Bacteria | 3177 |
| 145 | Ga0182007_10002824 | 3300015262 | Bacteria | 8456 |
| 146 | Ga0182007_10040462 | 3300015262 | Bacteria | 1556 |
| 147 | Ga0182007_10057850 | 3300015262 | Bacteria | 1272 |
| 148 | Ga0182007_10069031 | 3300015262 | Bacteria | 1158 |
| 149 | Ga0182005_1000257 | 3300015265 | Bacteria | 33567 |
| 150 | Ga0182005_1000685 | 3300015265 | Bacteria | 15850 |
| 151 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 152 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 153 | Ga0163161_10072469 | 3300017792 | Bacteria | 2522 |
| 154 | Ga0163161_10092419 | 3300017792 | Bacteria | 2240 |
| 155 | Ga0206354_10274793 | 3300020081 | Bacteria | 1358 |
| 156 | Ga0206353_11873004 | 3300020082 | Bacteria | 4290 |
| 157 | Ga0209784_100053 | 3300025224 | Bacteria | 182075 |
| 158 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 159 | Ga0209674_100197 | 3300025226 | Bacteria | 62877 |
| 160 | Ga0209674_100550 | 3300025226 | Bacteria | 14925 |
| 161 | Ga0209674_100621 | 3300025226 | Bacteria | 13278 |
| 162 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 163 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 164 | Ga0209672_100826 | 3300025228 | Bacteria | 14489 |
| 165 | Ga0209672_101804 | 3300025228 | Bacteria | 6565 |
| 166 | Ga0209563_100097 | 3300025230 | Bacteria | 159453 |
| 167 | Ga0207427_100044 | 3300025231 | Bacteria | 242623 |
| 168 | Ga0207427_100061 | 3300025231 | Bacteria | 182815 |
| 169 | Ga0207427_100129 | 3300025231 | Bacteria | 94644 |
| 170 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 171 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 172 | Ga0209437_100118 | 3300025233 | Bacteria | 207534 |
| 173 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 174 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 175 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 176 | Ga0209258_100090 | 3300025242 | Bacteria | 232619 |
| 177 | Ga0209258_100138 | 3300025242 | Bacteria | 167495 |
| 178 | Ga0209258_100479 | 3300025242 | Bacteria | 42065 |
| 179 | Ga0209258_108074 | 3300025242 | Bacteria | 1512 |
| 180 | Ga0209646_1001101 | 3300025246 | Bacteria | 8009 |
| 181 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 182 | Ga0209026_1000104 | 3300025250 | Bacteria | 152614 |
| 183 | Ga0209026_1000553 | 3300025250 | Bacteria | 25735 |
| 184 | Ga0209677_100976 | 3300025253 | Bacteria | 13869 |
| 185 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 186 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 187 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 188 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 189 | Ga0209759_1001467 | 3300025256 | Bacteria | 13162 |
| 190 | Ga0209759_1004437 | 3300025256 | Bacteria | 5244 |
| 191 | Ga0209759_1010286 | 3300025256 | Bacteria | 2751 |
| 192 | Ga0209129_1005329 | 3300025258 | Bacteria | 4598 |
| 193 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 194 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 195 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 196 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 197 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 198 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 199 | Ga0209455_1000189 | 3300025272 | Bacteria | 92877 |
| 200 | Ga0209758_1000840 | 3300025297 | Bacteria | 42856 |
| 201 | Ga0209257_1031751 | 3300025304 | Bacteria | 1685 |
| 202 | Ga0207656_10090093 | 3300025321 | Bacteria | 1391 |
| 203 | Ga0207642_10033079 | 3300025899 | Bacteria | 2184 |
| 204 | Ga0207680_10121510 | 3300025903 | Bacteria | 1708 |
| 205 | Ga0207647_10000002 | 3300025904 | Bacteria | 400771 |
| 206 | Ga0207647_10033709 | 3300025904 | Bacteria | 3275 |
| 207 | Ga0207647_10075168 | 3300025904 | Bacteria | 2034 |
| 208 | Ga0207699_10258963 | 3300025906 | Bacteria | 1202 |
| 209 | Ga0207654_10084355 | 3300025911 | Bacteria | 1920 |
| 210 | Ga0207654_10207613 | 3300025911 | Bacteria | 1293 |
| 211 | Ga0207654_10267282 | 3300025911 | Bacteria | 1152 |
| 212 | Ga0207707_10033334 | 3300025912 | Bacteria | 4508 |
| 213 | Ga0207707_10091964 | 3300025912 | Bacteria | 2651 |
| 214 | Ga0207695_10000751 | 3300025913 | Bacteria | 62399 |
| 215 | Ga0207695_10034658 | 3300025913 | Bacteria | 5486 |
| 216 | Ga0207695_10329637 | 3300025913 | Bacteria | 1415 |
| 217 | Ga0207695_10399275 | 3300025913 | Bacteria | 1259 |
| 218 | Ga0207671_10001039 | 3300025914 | Bacteria | 33742 |
| 219 | Ga0207671_10056712 | 3300025914 | Bacteria | 2903 |
| 220 | Ga0207671_10627492 | 3300025914 | Bacteria | 856 |
| 221 | Ga0207663_10302989 | 3300025916 | Bacteria | 1195 |
| 222 | Ga0207657_10005348 | 3300025919 | Bacteria | 13449 |
| 223 | Ga0207657_10034179 | 3300025919 | Bacteria | 4575 |
| 224 | Ga0207657_10361214 | 3300025919 | Bacteria | 1145 |
| 225 | Ga0207650_10303997 | 3300025925 | Bacteria | 1303 |
| 226 | Ga0207659_10081448 | 3300025926 | Bacteria | 2394 |
| 227 | Ga0207700_10002250 | 3300025928 | Bacteria | 11080 |
| 228 | Ga0207664_10000150 | 3300025929 | Bacteria | 56559 |
| 229 | Ga0207664_10024414 | 3300025929 | Bacteria | 4543 |
| 230 | Ga0207690_10018888 | 3300025932 | Bacteria | 4233 |
| 231 | Ga0207690_10019423 | 3300025932 | Bacteria | 4184 |
| 232 | Ga0207690_10075080 | 3300025932 | Bacteria | 2343 |
| 233 | Ga0207706_10041079 | 3300025933 | Bacteria | 4101 |
| 234 | Ga0207706_10137663 | 3300025933 | Bacteria | 2148 |
| 235 | Ga0207670_10280065 | 3300025936 | Bacteria | 1299 |
| 236 | Ga0207704_10107734 | 3300025938 | Bacteria | 1875 |
| 237 | Ga0207704_10480075 | 3300025938 | Bacteria | 998 |
| 238 | Ga0207711_10059577 | 3300025941 | Bacteria | 3287 |
| 239 | Ga0207689_10036959 | 3300025942 | Bacteria | 4053 |
| 240 | Ga0207661_10137268 | 3300025944 | Bacteria | 2101 |
| 241 | Ga0207679_10202668 | 3300025945 | Bacteria | 1658 |
| 242 | Ga0207679_10241269 | 3300025945 | Bacteria | 1531 |
| 243 | Ga0207667_10129666 | 3300025949 | Bacteria | 2597 |
| 244 | Ga0207712_10022130 | 3300025961 | Bacteria | 4183 |
| 245 | Ga0207668_10888757 | 3300025972 | Bacteria | 792 |
| 246 | Ga0207640_10026409 | 3300025981 | Bacteria | 3525 |
| 247 | Ga0207640_10109031 | 3300025981 | Bacteria | 1958 |
| 248 | Ga0207640_10304145 | 3300025981 | Bacteria | 1263 |
| 249 | Ga0207658_10209023 | 3300025986 | Bacteria | 1634 |
| 250 | Ga0207658_10992158 | 3300025986 | Bacteria | 766 |
| 251 | Ga0207677_10331958 | 3300026023 | Bacteria | 1267 |
| 252 | Ga0207703_11320740 | 3300026035 | Unclassified | 694 |
| 253 | Ga0207639_10010626 | 3300026041 | Bacteria | 6374 |
| 254 | Ga0207639_10056135 | 3300026041 | Bacteria | 3017 |
| 255 | Ga0207639_10118365 | 3300026041 | Bacteria | 2172 |
| 256 | Ga0207639_10148570 | 3300026041 | Bacteria | 1961 |
| 257 | Ga0207678_10001852 | 3300026067 | Bacteria | 19350 |
| 258 | Ga0207678_10389688 | 3300026067 | Bacteria | 1205 |
| 259 | Ga0207678_10441282 | 3300026067 | Bacteria | 1131 |
| 260 | Ga0207702_10000068 | 3300026078 | Bacteria | 116478 |
| 261 | Ga0207702_10000740 | 3300026078 | Bacteria | 34919 |
| 262 | Ga0207702_10148432 | 3300026078 | Bacteria | 2130 |
| 263 | Ga0207702_10271930 | 3300026078 | Bacteria | 1598 |
| 264 | Ga0207641_10012439 | 3300026088 | Bacteria | 6977 |
| 265 | Ga0207641_10127051 | 3300026088 | Bacteria | 2284 |
| 266 | Ga0207648_10007804 | 3300026089 | Bacteria | 10450 |
| 267 | Ga0207676_10056071 | 3300026095 | Bacteria | 3096 |
| 268 | Ga0207674_10002555 | 3300026116 | Bacteria | 22911 |
| 269 | Ga0207674_10034748 | 3300026116 | Bacteria | 5266 |
| 270 | Ga0207683_10006726 | 3300026121 | Bacteria | 9840 |
| 271 | Ga0207683_10028384 | 3300026121 | Bacteria | 4838 |
| 272 | Ga0207698_10027438 | 3300026142 | Bacteria | 4042 |
| 273 | Ga0207698_10410866 | 3300026142 | Bacteria | 1296 |
| 274 | Ga0268264_10087868 | 3300028381 | Bacteria | 2674 |
| 275 | Ga0265332_10012137 | 3300031238 | Bacteria | 3823 |
| 276 | Ga0307412_10006380 | 3300031911 | Bacteria | 6666 |
| 277 | Ga0395899_0003165 | 3300037312 | Bacteria | 13064 |
| 278 | Ga0395899_0286920 | 3300037312 | Bacteria | 1118 |
| 279 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 280 | Ga0395900_0003994 | 3300037418 | Bacteria | 15756 |
| 281 | Ga0395900_0121624 | 3300037418 | Bacteria | 2678 |
| 282 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 283 | Ga0395898_0004893 | 3300037466 | Bacteria | 14544 |
| 284 | Ga0395898_0079418 | 3300037466 | Bacteria | 3165 |
| 285 | Ga0395901_0002392 | 3300038443 | Bacteria | 19071 |
| 286 | Ga0395901_0014108 | 3300038443 | Bacteria | 8134 |
| 287 | Ga0395901_0056535 | 3300038443 | Bacteria | 4082 |
| 288 | Ga0395901_0250725 | 3300038443 | Bacteria | 1844 |
| 289 | Ga0395901_0357506 | 3300038443 | Bacteria | 1506 |
| 290 | Ga0395901_1028463 | 3300038443 | Bacteria | 798 |
| 291 | Ga0439436_0000004 | 3300041404 | Bacteria | 175137 |
| 292 | Ga0439465_0014771 | 3300041413 | Bacteria | 2435 |
| 293 | Ga0439454_007983 | 3300042011 | Bacteria | 1340 |
| 294 | Ga0439455_0082845 | 3300042012 | Bacteria | 873 |
| 295 | Ga0466969_0003745 | 3300044656 | Bacteria | 8079 |
| 296 | Ga0466969_0084026 | 3300044656 | Bacteria | 1515 |
| 297 | Ga0466969_0130639 | 3300044656 | Bacteria | 1164 |
| 298 | Ga0466972_0172305 | 3300044658 | Bacteria | 1015 |
| 299 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 300 | Ga0466965_0277991 | 3300044683 | Bacteria | 903 |
| 301 | Ga0466966_0003955 | 3300044684 | Bacteria | 9793 |
| 302 | Ga0466966_0051974 | 3300044684 | Bacteria | 2604 |
| 303 | Ga0466961_0000535 | 3300044693 | Bacteria | 24166 |
| 304 | Ga0466961_0001111 | 3300044693 | Bacteria | 16550 |
| 305 | Ga0466961_0021886 | 3300044693 | Bacteria | 4113 |
| 306 | Ga0466961_0285463 | 3300044693 | Bacteria | 1009 |
| 307 | Ga0466971_0001794 | 3300044719 | Bacteria | 9109 |
| 308 | Ga0466971_0078682 | 3300044719 | Bacteria | 1502 |
| 309 | Ga0466971_0151614 | 3300044719 | Unclassified | 1082 |
| 310 | Ga0466968_0048565 | 3300044735 | Bacteria | 1806 |
| 311 | Ga0466970_0068434 | 3300044765 | Bacteria | 1907 |
| 312 | Ga0466970_0139951 | 3300044765 | Bacteria | 1332 |
| 313 | Ga0466970_0269699 | 3300044765 | Bacteria | 956 |
| 314 | Ga0466957_0001515 | 3300044842 | Bacteria | 12203 |
| 315 | Ga0466957_0011846 | 3300044842 | Bacteria | 5039 |
| 316 | Ga0466957_0084013 | 3300044842 | Bacteria | 1987 |
| 317 | Ga0466960_0137340 | 3300044901 | Bacteria | 1295 |
| 318 | Ga0466959_0022722 | 3300045049 | Bacteria | 4636 |
| 319 | Ga0466959_0035404 | 3300045049 | Bacteria | 3692 |
| 320 | Ga0466959_0226298 | 3300045049 | Bacteria | 1296 |
| 321 | Ga0466959_0259815 | 3300045049 | Bacteria | 1195 |
| 322 | Ga0466958_0007247 | 3300045836 | Bacteria | 6084 |
| 323 | Ga0466958_0017645 | 3300045836 | Bacteria | 4131 |
| 324 | Ga0466958_0053028 | 3300045836 | Bacteria | 2459 |
| 325 | Ga0466967_0176391 | 3300045976 | Bacteria | 2013 |
| 326 | Ga0495638_0001087 | 3300046460 | Bacteria | 26471 |
| 327 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 328 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 329 | Ga0495610_0060292 | 3300046512 | Bacteria | 1807 |
| 330 | Ga0495622_0006861 | 3300046557 | Bacteria | 5286 |
| 331 | Ga0495625_0054251 | 3300046660 | Bacteria | 2863 |
| 332 | Ga0495670_0000599 | 3300046691 | Bacteria | 17194 |
| 333 | Ga0495649_0000450 | 3300046694 | Bacteria | 35527 |
| 334 | Ga0495649_0002369 | 3300046694 | Bacteria | 13331 |
| 335 | Ga0495686_0000426 | 3300047472 | Bacteria | 66285 |
| 336 | Ga0496115_0000729 | 3300048918 | Bacteria | 24348 |
| 337 | Ga0496115_0051557 | 3300048918 | Bacteria | 3299 |
| 338 | Ga0496116_0031157 | 3300048919 | Bacteria | 3823 |
| 339 | Ga0496117_0222564 | 3300048920 | Bacteria | 1049 |
| 340 | Ga0496118_0002160 | 3300048921 | Bacteria | 27394 |
| 341 | Ga0496118_0153116 | 3300048921 | Bacteria | 1440 |
| 342 | Ga0496119_0007834 | 3300048922 | Bacteria | 9520 |
| 343 | Ga0496121_0000116 | 3300048924 | Bacteria | 177260 |
| 344 | Ga0496122_0046307 | 3300048925 | Bacteria | 3370 |
| 345 | Ga0496122_0175508 | 3300048925 | Bacteria | 1285 |
| 346 | Ga0496123_0039574 | 3300048926 | Bacteria | 3296 |
| 347 | Ga0496123_0261540 | 3300048926 | Bacteria | 847 |
| 348 | Ga0496125_0008843 | 3300048928 | Bacteria | 10469 |
| 349 | Ga0496126_0023326 | 3300048929 | Bacteria | 5997 |
| 350 | Ga0496126_0095556 | 3300048929 | Bacteria | 2606 |
| 351 | Ga0495682_0021561 | 3300049460 | Bacteria | 2413 |
| 352 | Ga0501031_0087028 | 3300049568 | Bacteria | 2037 |
| 353 | Ga0501031_0403887 | 3300049568 | Bacteria | 883 |
| 354 | Ga0501031_0440006 | 3300049568 | Bacteria | 842 |
| 355 | Ga0501032_0079442 | 3300049569 | Bacteria | 2184 |
| 356 | Ga0501032_0608184 | 3300049569 | Bacteria | 695 |
| 357 | Ga0501033_0001009 | 3300049570 | Bacteria | 25578 |
| 358 | Ga0501033_0004747 | 3300049570 | Bacteria | 10874 |
| 359 | Ga0501033_0015590 | 3300049570 | Bacteria | 5763 |
| 360 | Ga0501033_0415036 | 3300049570 | Bacteria | 938 |
| 361 | Ga0501034_0039007 | 3300049571 | Bacteria | 4811 |
| 362 | Ga0501034_0319022 | 3300049571 | Bacteria | 1487 |
| 363 | Ga0501034_0630050 | 3300049571 | Bacteria | 976 |
| 364 | Ga0501036_0034826 | 3300049572 | Bacteria | 4260 |
| 365 | Ga0501036_0039004 | 3300049572 | Bacteria | 4022 |
| 366 | Ga0501037_0074941 | 3300049573 | Bacteria | 2458 |
| 367 | Ga0501037_0125242 | 3300049573 | Bacteria | 1845 |
| 368 | Ga0501039_0174414 | 3300049575 | Bacteria | 1691 |
| 369 | Ga0501043_0007069 | 3300049579 | Bacteria | 8935 |
| 370 | Ga0501043_0099758 | 3300049579 | Bacteria | 2282 |
| 371 | Ga0501043_0590609 | 3300049579 | Bacteria | 821 |
| 372 | Ga0501043_0711089 | 3300049579 | Bacteria | 733 |
| 373 | Ga0501046_0032221 | 3300049580 | Bacteria | 4244 |
| 374 | Ga0501047_0013195 | 3300049581 | Bacteria | 7825 |
| 375 | Ga0501047_0210788 | 3300049581 | Bacteria | 1801 |
| 376 | Ga0501047_0399459 | 3300049581 | Bacteria | 1207 |
| 377 | Ga0501048_0187109 | 3300049582 | Bacteria | 1467 |
| 378 | Ga0501048_0466084 | 3300049582 | Bacteria | 905 |
| 379 | Ga0501070_0161249 | 3300049586 | Bacteria | 1849 |
| 380 | Ga0501070_0601708 | 3300049586 | Bacteria | 876 |
| 381 | Ga0501073_0128828 | 3300049589 | Bacteria | 1754 |
| 382 | Ga0501079_0035259 | 3300049741 | Bacteria | 3851 |
| 383 | Ga0501080_0022411 | 3300049742 | Bacteria | 5851 |
| 384 | Ga0501080_0163766 | 3300049742 | Bacteria | 2053 |
| 385 | Ga0501035_0027485 | 3300049822 | Bacteria | 5199 |
| 386 | Ga0501035_0181392 | 3300049822 | Bacteria | 1814 |
| 387 | Ga0501035_0196643 | 3300049822 | Bacteria | 1731 |
| 388 | Ga0501035_0246243 | 3300049822 | Bacteria | 1519 |
| 389 | Ga0501044_0021893 | 3300049823 | Bacteria | 6816 |
| 390 | Ga0501044_0642780 | 3300049823 | Bacteria | 950 |
| 391 | nmdc:mga0n895_763246_c1 | 3300050512 | Bacteria | 959 |
| 392 | Ga0466962_0001335 | 3300061719 | Bacteria | 11398 |
| 393 | Ga0466962_0044629 | 3300061719 | Bacteria | 2120 |
| 394 | Ga0466962_0049688 | 3300061719 | Bacteria | 2005 |
| 395 | 2538834380 | 2537561836 | Bacteria | 3910579 |
| 396 | 2643828769 | 2643221562 | Bacteria | 4048635 |
| 397 | 2738881063 | 2738541307 | Bacteria | 8606193 |
| 398 | 2842920959 | 2842918807 | Bacteria | 4289178 |
| 399 | 2895398087 | 2895395659 | Bacteria | 3983269 |
| 400 | 2919086477 | 2919085039 | Bacteria | 4532964 |
| 401 | 2939613470 | 2939611941 | Bacteria | 3892017 |
| 402 | 2941472037 | 2941471342 | Bacteria | 5018624 |
| 403 | 2953996229 | 2953994433 | Bacteria | 4303959 |
| 404 | Ga0466965_0014956 | |||
| 405 | JGI25162J39368_1000705 | |||
| 406 | JGI25162J39368_1001445 | |||
| 407 | JGI25157J39369_1001046 | |||
| 408 | JGI25157J39369_1001662 | |||
| 409 | JGI25164J39214_1000347 | |||
| 410 | JGI25164J39214_1000714 | |||
| 411 | JGI25164J39214_1000718 | |||
| 412 | JGI25164J39214_1000761 | |||
| 413 | JGI25165J46597_1000640 | |||
| 414 | JGI25165J46597_1001443 | |||
| 415 | JGI25165J46597_1003068 | |||
| 416 | rootL2_10038685 | |||
| 417 | rootH1_10292646 | |||
| 418 | Ga0055538_1003613 | |||
| 419 | Ga0055539_1002420 | |||
| 420 | Ga0055533_1002475 | |||
| 421 | Ga0055533_1003063 | |||
| 422 | Ga0055533_1017870 | |||
| 423 | Ga0055525_1000082 | |||
| 424 | Ga0055527_1000176 | |||
| 425 | Ga0055527_1000179 | |||
| 426 | Ga0055535_1000373 | |||
| 427 | Ga0055535_1000405 | |||
| 428 | Ga0055535_1001379 | |||
| 429 | Ga0055535_1001457 | |||
| 430 | Ga0055542_1000394 | |||
| 431 | Ga0055542_1000431 | |||
| 432 | Ga0055542_1000734 | |||
| 433 | Ga0055542_1001349 | |||
| 434 | Ga0055529_1000420 | |||
| 435 | Ga0055529_1000428 | |||
| 436 | Ga0055529_1001072 | |||
| 437 | Ga0070690_100236913 | |||
| 438 | Ga0070682_100003420 | |||
| 439 | Ga0070682_100005911 | |||
| 440 | Ga0070682_100144425 | |||
| 441 | Ga0070682_100145605 | |||
| 442 | Ga0070660_100098216 | |||
| 443 | Ga0070661_100043073 | |||
| 444 | Ga0070675_100124335 | |||
| 445 | Ga0070674_100976625 | |||
| 446 | Ga0070673_100668224 | |||
| 447 | Ga0070688_100503788 | |||
| 448 | Ga0070659_100060238 | |||
| 449 | Ga0070659_100064017 | |||
| 450 | Ga0070659_100078899 | |||
| 451 | Ga0070714_100000136 | |||
| 452 | Ga0070714_100009681 | |||
| 453 | Ga0070713_100000663 | |||
| 454 | Ga0070711_100176577 | |||
| 455 | Ga0070694_101231724 | |||
| 456 | Ga0070663_100029737 | |||
| 457 | Ga0070678_100111094 | |||
| 458 | Ga0070678_100158743 | |||
| 459 | Ga0070662_100157119 | |||
| 460 | Ga0070681_10013810 | |||
| 461 | Ga0070681_10184664 | |||
| 462 | Ga0070681_10298921 | |||
| 463 | Ga0068867_100036463 | |||
| 464 | Ga0070679_100030348 | |||
| 465 | Ga0070684_100042993 | |||
| 466 | Ga0070684_100276450 | |||
| 467 | Ga0068853_100002290 | |||
| 468 | Ga0068853_100083800 | |||
| 469 | Ga0068853_100272192 | |||
| 470 | Ga0068853_100346166 | |||
| 471 | Ga0070696_100016454 | |||
| 472 | Ga0070696_100420450 | |||
| 473 | Ga0070693_100013608 | |||
| 474 | Ga0070693_100255620 | |||
| 475 | Ga0068855_100276854 | |||
| 476 | Ga0070664_100543555 | |||
| 477 | Ga0068857_100149478 | |||
| 478 | Ga0068854_100274841 | |||
| 479 | Ga0068856_100000138 | |||
| 480 | Ga0068856_100000938 | |||
| 481 | Ga0068856_100084270 | |||
| 482 | Ga0068856_100125526 | |||
| 483 | Ga0068852_100000993 | |||
| 484 | Ga0068852_100087699 | |||
| 485 | Ga0068852_100798083 | |||
| 486 | Ga0068859_100695974 | |||
| 487 | Ga0068864_100832311 | |||
| 488 | Ga0068851_10060724 | |||
| 489 | Ga0068851_10222379 | |||
| 490 | Ga0068863_100064829 | |||
| 491 | Ga0068863_100306591 | |||
| 492 | Ga0068860_100064748 | |||
| 493 | Ga0068862_100262438 | |||
| 494 | Ga0070712_100062304 | |||
| 495 | Ga0070712_100156822 | |||
| 496 | Ga0097621_100030828 | |||
| 497 | Ga0068871_100039270 | |||
| 498 | Ga0068865_100051306 | |||
| 499 | Ga0068865_100616334 | |||
| 500 | Ga0097620_100695885 | |||
| 501 | Ga0105240_10020394 | |||
| 502 | Ga0105240_10092425 | |||
| 503 | Ga0105240_10498135 | |||
| 504 | Ga0105245_11414819 | |||
| 505 | Ga0105241_10113604 | |||
| 506 | Ga0105241_10143875 | |||
| 507 | Ga0105242_10623300 | |||
| 508 | Ga0105237_10000108 | |||
| 509 | Ga0105237_10178205 | |||
| 510 | Ga0105237_10475288 | |||
| 511 | Ga0105238_10077321 | |||
| 512 | Ga0105238_10094582 | |||
| 513 | Ga0105238_10284964 | |||
| 514 | Ga0105238_11059889 | |||
| 515 | Ga0105249_10086206 | |||
| 516 | Ga0105239_10097327 | |||
| 517 | Ga0105239_10346308 | |||
| 518 | Ga0105239_10500660 | |||
| 519 | Ga0105239_10934979 | |||
| 520 | Ga0157373_10124036 | |||
| 521 | Ga0157373_10376397 | |||
| 522 | Ga0157371_10078098 | |||
| 523 | Ga0157370_10028195 | |||
| 524 | Ga0157370_10092086 | |||
| 525 | Ga0157370_10422738 | |||
| 526 | Ga0157369_10001250 | |||
| 527 | Ga0157369_10023424 | |||
| 528 | Ga0157369_10780261 | |||
| 529 | Ga0157369_11052126 | |||
| 530 | Ga0157369_11280052 | |||
| 531 | Ga0157378_10000005 | |||
| 532 | Ga0157378_10441581 | |||
| 533 | Ga0163162_10004503 | |||
| 534 | Ga0163162_10061251 | |||
| 535 | Ga0163162_10398786 | |||
| 536 | Ga0157372_10042167 | |||
| 537 | Ga0157372_10059684 | |||
| 538 | Ga0157375_10015674 | |||
| 539 | Ga0163163_10141379 | |||
| 540 | Ga0182008_10003298 | |||
| 541 | Ga0182008_10020743 | |||
| 542 | Ga0182008_10204300 | |||
| 543 | Ga0157379_10032747 | |||
| 544 | Ga0157376_10004652 | |||
| 545 | Ga0157376_10089216 | |||
| 546 | Ga0182006_1000133 | |||
| 547 | Ga0182006_1016232 | |||
| 548 | Ga0182007_10002824 | |||
| 549 | Ga0182007_10040462 | |||
| 550 | Ga0182007_10057850 | |||
| 551 | Ga0182007_10069031 | |||
| 552 | Ga0182005_1000257 | |||
| 553 | Ga0182005_1000685 | |||
| 554 | Ga0183369_1004 | |||
| 555 | Ga0183368_1002 | |||
| 556 | Ga0163161_10072469 | |||
| 557 | Ga0163161_10092419 | |||
| 558 | Ga0206354_10274793 | |||
| 559 | Ga0206353_11873004 | |||
| 560 | Ga0209784_100053 | |||
| 561 | Ga0209674_100014 | |||
| 562 | Ga0209674_100197 | |||
| 563 | Ga0209674_100550 | |||
| 564 | Ga0209674_100621 | |||
| 565 | Ga0209672_100004 | |||
| 566 | Ga0209672_100008 | |||
| 567 | Ga0209672_100826 | |||
| 568 | Ga0209672_101804 | |||
| 569 | Ga0209563_100097 | |||
| 570 | Ga0207427_100044 | |||
| 571 | Ga0207427_100061 | |||
| 572 | Ga0207427_100129 | |||
| 573 | Ga0209437_100005 | |||
| 574 | Ga0209437_100037 | |||
| 575 | Ga0209437_100118 | |||
| 576 | Ga0209258_100003 | |||
| 577 | Ga0209258_100004 | |||
| 578 | Ga0209258_100008 | |||
| 579 | Ga0209258_100090 | |||
| 580 | Ga0209258_100138 | |||
| 581 | Ga0209258_100479 | |||
| 582 | Ga0209258_108074 | |||
| 583 | Ga0209646_1001101 | |||
| 584 | Ga0209026_1000010 | |||
| 585 | Ga0209026_1000104 | |||
| 586 | Ga0209026_1000553 | |||
| 587 | Ga0209677_100976 | |||
| 588 | Ga0209148_1000001 | |||
| 589 | Ga0209148_1000016 | |||
| 590 | Ga0209148_1000041 | |||
| 591 | Ga0209148_1000065 | |||
| 592 | Ga0209759_1001467 | |||
| 593 | Ga0209759_1004437 | |||
| 594 | Ga0209759_1010286 | |||
| 595 | Ga0209129_1005329 | |||
| 596 | Ga0209233_1000002 | |||
| 597 | Ga0209233_1000011 | |||
| 598 | Ga0209233_1000046 | |||
| 599 | Ga0209455_1000004 | |||
| 600 | Ga0209455_1000007 | |||
| 601 | Ga0209455_1000079 | |||
| 602 | Ga0209455_1000189 | |||
| 603 | Ga0209758_1000840 | |||
| 604 | Ga0209257_1031751 | |||
| 605 | Ga0207656_10090093 | |||
| 606 | Ga0207642_10033079 | |||
| 607 | Ga0207680_10121510 | |||
| 608 | Ga0207647_10000002 | |||
| 609 | Ga0207647_10033709 | |||
| 610 | Ga0207647_10075168 | |||
| 611 | Ga0207699_10258963 | |||
| 612 | Ga0207654_10084355 | |||
| 613 | Ga0207654_10207613 | |||
| 614 | Ga0207654_10267282 | |||
| 615 | Ga0207707_10033334 | |||
| 616 | Ga0207707_10091964 | |||
| 617 | Ga0207695_10000751 | |||
| 618 | Ga0207695_10034658 | |||
| 619 | Ga0207695_10329637 | |||
| 620 | Ga0207695_10399275 | |||
| 621 | Ga0207671_10001039 | |||
| 622 | Ga0207671_10056712 | |||
| 623 | Ga0207671_10627492 | |||
| 624 | Ga0207663_10302989 | |||
| 625 | Ga0207657_10005348 | |||
| 626 | Ga0207657_10034179 | |||
| 627 | Ga0207657_10361214 | |||
| 628 | Ga0207650_10303997 | |||
| 629 | Ga0207659_10081448 | |||
| 630 | Ga0207700_10002250 | |||
| 631 | Ga0207664_10000150 | |||
| 632 | Ga0207664_10024414 | |||
| 633 | Ga0207690_10018888 | |||
| 634 | Ga0207690_10019423 | |||
| 635 | Ga0207690_10075080 | |||
| 636 | Ga0207706_10041079 | |||
| 637 | Ga0207706_10137663 | |||
| 638 | Ga0207670_10280065 | |||
| 639 | Ga0207704_10107734 | |||
| 640 | Ga0207704_10480075 | |||
| 641 | Ga0207711_10059577 | |||
| 642 | Ga0207689_10036959 | |||
| 643 | Ga0207661_10137268 | |||
| 644 | Ga0207679_10202668 | |||
| 645 | Ga0207679_10241269 | |||
| 646 | Ga0207667_10129666 | |||
| 647 | Ga0207712_10022130 | |||
| 648 | Ga0207668_10888757 | |||
| 649 | Ga0207640_10026409 | |||
| 650 | Ga0207640_10109031 | |||
| 651 | Ga0207640_10304145 | |||
| 652 | Ga0207658_10209023 | |||
| 653 | Ga0207658_10992158 | |||
| 654 | Ga0207677_10331958 | |||
| 655 | Ga0207703_11320740 | |||
| 656 | Ga0207639_10010626 | |||
| 657 | Ga0207639_10056135 | |||
| 658 | Ga0207639_10118365 | |||
| 659 | Ga0207639_10148570 | |||
| 660 | Ga0207678_10001852 | |||
| 661 | Ga0207678_10389688 | |||
| 662 | Ga0207678_10441282 | |||
| 663 | Ga0207702_10000068 | |||
| 664 | Ga0207702_10000740 | |||
| 665 | Ga0207702_10148432 | |||
| 666 | Ga0207702_10271930 | |||
| 667 | Ga0207641_10012439 | |||
| 668 | Ga0207641_10127051 | |||
| 669 | Ga0207648_10007804 | |||
| 670 | Ga0207676_10056071 | |||
| 671 | Ga0207674_10002555 | |||
| 672 | Ga0207674_10034748 | |||
| 673 | Ga0207683_10006726 | |||
| 674 | Ga0207683_10028384 | |||
| 675 | Ga0207698_10027438 | |||
| 676 | Ga0207698_10410866 | |||
| 677 | Ga0268264_10087868 | |||
| 678 | Ga0265332_10012137 | |||
| 679 | Ga0307412_10006380 | |||
| 680 | Ga0395899_0003165 | |||
| 681 | Ga0395899_0286920 | |||
| 682 | Ga0395900_0000011 | |||
| 683 | Ga0395900_0003994 | |||
| 684 | Ga0395900_0121624 | |||
| 685 | Ga0395898_0000013 | |||
| 686 | Ga0395898_0004893 | |||
| 687 | Ga0395898_0079418 | |||
| 688 | Ga0395901_0002392 | |||
| 689 | Ga0395901_0014108 | |||
| 690 | Ga0395901_0056535 | |||
| 691 | Ga0395901_0250725 | |||
| 692 | Ga0395901_0357506 | |||
| 693 | Ga0395901_1028463 | |||
| 694 | Ga0439436_0000004 | |||
| 695 | Ga0439465_0014771 | |||
| 696 | Ga0439454_007983 | |||
| 697 | Ga0439455_0082845 | |||
| 698 | Ga0466969_0003745 | |||
| 699 | Ga0466969_0084026 | |||
| 700 | Ga0466969_0130639 | |||
| 701 | Ga0466972_0172305 | |||
| 702 | Ga0466982_0000001 | |||
| 703 | Ga0466965_0277991 | |||
| 704 | Ga0466966_0003955 | |||
| 705 | Ga0466966_0051974 | |||
| 706 | Ga0466961_0000535 | |||
| 707 | Ga0466961_0001111 | |||
| 708 | Ga0466961_0021886 | |||
| 709 | Ga0466961_0285463 | |||
| 710 | Ga0466971_0001794 | |||
| 711 | Ga0466971_0078682 | |||
| 712 | Ga0466971_0151614 | |||
| 713 | Ga0466968_0048565 | |||
| 714 | Ga0466970_0068434 | |||
| 715 | Ga0466970_0139951 | |||
| 716 | Ga0466970_0269699 | |||
| 717 | Ga0466957_0001515 | |||
| 718 | Ga0466957_0011846 | |||
| 719 | Ga0466957_0084013 | |||
| 720 | Ga0466960_0137340 | |||
| 721 | Ga0466959_0022722 | |||
| 722 | Ga0466959_0035404 | |||
| 723 | Ga0466959_0226298 | |||
| 724 | Ga0466959_0259815 | |||
| 725 | Ga0466958_0007247 | |||
| 726 | Ga0466958_0017645 | |||
| 727 | Ga0466958_0053028 | |||
| 728 | Ga0466967_0176391 | |||
| 729 | Ga0495638_0001087 | |||
| 730 | Ga0495607_0000006 | |||
| 731 | Ga0495606_0000016 | |||
| 732 | Ga0495610_0060292 | |||
| 733 | Ga0495622_0006861 | |||
| 734 | Ga0495625_0054251 | |||
| 735 | Ga0495670_0000599 | |||
| 736 | Ga0495649_0000450 | |||
| 737 | Ga0495649_0002369 | |||
| 738 | Ga0495686_0000426 | |||
| 739 | Ga0496115_0000729 | |||
| 740 | Ga0496115_0051557 | |||
| 741 | Ga0496116_0031157 | |||
| 742 | Ga0496117_0222564 | |||
| 743 | Ga0496118_0002160 | |||
| 744 | Ga0496118_0153116 | |||
| 745 | Ga0496119_0007834 | |||
| 746 | Ga0496121_0000116 | |||
| 747 | Ga0496122_0046307 | |||
| 748 | Ga0496122_0175508 | |||
| 749 | Ga0496123_0039574 | |||
| 750 | Ga0496123_0261540 | |||
| 751 | Ga0496125_0008843 | |||
| 752 | Ga0496126_0023326 | |||
| 753 | Ga0496126_0095556 | |||
| 754 | Ga0495682_0021561 | |||
| 755 | Ga0501031_0087028 | |||
| 756 | Ga0501031_0403887 | |||
| 757 | Ga0501031_0440006 | |||
| 758 | Ga0501032_0079442 | |||
| 759 | Ga0501032_0608184 | |||
| 760 | Ga0501033_0001009 | |||
| 761 | Ga0501033_0004747 | |||
| 762 | Ga0501033_0015590 | |||
| 763 | Ga0501033_0415036 | |||
| 764 | Ga0501034_0039007 | |||
| 765 | Ga0501034_0319022 | |||
| 766 | Ga0501034_0630050 | |||
| 767 | Ga0501036_0034826 | |||
| 768 | Ga0501036_0039004 | |||
| 769 | Ga0501037_0074941 | |||
| 770 | Ga0501037_0125242 | |||
| 771 | Ga0501039_0174414 | |||
| 772 | Ga0501043_0007069 | |||
| 773 | Ga0501043_0099758 | |||
| 774 | Ga0501043_0590609 | |||
| 775 | Ga0501043_0711089 | |||
| 776 | Ga0501046_0032221 | |||
| 777 | Ga0501047_0013195 | |||
| 778 | Ga0501047_0210788 | |||
| 779 | Ga0501047_0399459 | |||
| 780 | Ga0501048_0187109 | |||
| 781 | Ga0501048_0466084 | |||
| 782 | Ga0501070_0161249 | |||
| 783 | Ga0501070_0601708 | |||
| 784 | Ga0501073_0128828 | |||
| 785 | Ga0501079_0035259 | |||
| 786 | Ga0501080_0022411 | |||
| 787 | Ga0501080_0163766 | |||
| 788 | Ga0501035_0027485 | |||
| 789 | Ga0501035_0181392 | |||
| 790 | Ga0501035_0196643 | |||
| 791 | Ga0501035_0246243 | |||
| 792 | Ga0501044_0021893 | |||
| 793 | Ga0501044_0642780 | |||
| 794 | nmdc:mga0n895_763246_c1 | |||
| 795 | Ga0466962_0001335 | |||
| 796 | Ga0466962_0044629 | |||
| 797 | Ga0466962_0049688 | |||
| 798 | 2538834380 | |||
| 799 | 2643828769 | |||
| 800 | 2738881063 | |||
| 801 | 2842920959 | |||
| 802 | 2895398087 | |||
| 803 | 2919086477 | |||
| 804 | 2939613470 | |||
| 805 | 2941472037 | |||
| 806 | 2953996229 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hru-assembly1.cif.gz_B | the structure of the yrdc gene product from e.coli | 0.9444 | 7 | 186 |
| 3aje-assembly1.cif.gz_A | crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp | 0.9342 | 3 | 179 |
| 2eqa-assembly1.cif.gz_A | crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii | 0.9341 | 3 | 179 |
| 1hru-assembly1.cif.gz_B | the structure of the yrdc gene product from e.coli | 0.9198 | 7 | 186 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.919 | 1 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hruB00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9341 | 7 | 186 | 3.90.870.10 |
| 4e1bA01 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9304 | 3 | 179 | 3.90.870.10 |
| 1hruB00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9194 | 7 | 186 | 3.90.870.10 |
| af_Q4DBQ8_3_214_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9166 | 3 | 188 | 3.90.870.10 |
| af_Q2FWE2_20_236_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9108 | 3 | 188 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522RS45-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9759 | 2 | 188 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |
| AF-A0A1G5BNB7-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9715 | 10 | 187 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |
| AF-A0A522RS45-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9708 | 2 | 188 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |
| AF-A0A421K549-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9702 | 9 | 188 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |
| AF-A0A2T6NKQ2-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9691 | 17 | 188 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |