F435465

General Info

Members Datasets Scaffolds Average Seq Length
403 211 806 188

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0014956|Ga0466965_0014956_1653_2249
Length 198
Sequence VGEEETIRMPKHYTLAELDDAAEALRNGGVIAYPTEAVFGLGCDPHDRVAFERIFALKQRPATQGVLLIAADFAQITRYVDMTKVPQGVLAQVRASWPGPFTWVFPRSNDVPDWVAGAHEGIALRVTGHGPAAALCRAFGGALVSTSANPHGQPPARDVATVTAYFGDALDGVVDAPLGGAAQPTTIRDALTGAIIRS

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
80 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
204 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
205 2738541307 Variovorax sp. GV008 Isolate Unclassified
206 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
207 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
208 2919085039 Luteibacter sp. 1214 Isolate Unclassified
209 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
210 2941471342 Luteibacter sp. 621 Isolate Unclassified
211 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.5
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0
Rhizoplane 0.5
Rhizosphere 74.94
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0014956 3300044683 Bacteria 3679
2 JGI25162J39368_1000705 3300002737 Bacteria 23246
3 JGI25162J39368_1001445 3300002737 Bacteria 12645
4 JGI25157J39369_1001046 3300002741 Bacteria 12637
5 JGI25157J39369_1001662 3300002741 Bacteria 7585
6 JGI25164J39214_1000347 3300002772 Bacteria 29028
7 JGI25164J39214_1000714 3300002772 Bacteria 12645
8 JGI25164J39214_1000718 3300002772 Bacteria 12581
9 JGI25164J39214_1000761 3300002772 Bacteria 11822
10 JGI25165J46597_1000640 3300003214 Bacteria 29018
11 JGI25165J46597_1001443 3300003214 Bacteria 12645
12 JGI25165J46597_1003068 3300003214 Bacteria 4520
13 rootL2_10038685 3300003322 Bacteria 1418
14 rootH1_10292646 3300003323 Bacteria 1203
15 Ga0055538_1003613 3300003751 Bacteria 1925
16 Ga0055539_1002420 3300003752 Bacteria 2868
17 Ga0055533_1002475 3300003756 Bacteria 4179
18 Ga0055533_1003063 3300003756 Bacteria 3536
19 Ga0055533_1017870 3300003756 Bacteria 669
20 Ga0055525_1000082 3300003759 Bacteria 159396
21 Ga0055527_1000176 3300003760 Bacteria 43621
22 Ga0055527_1000179 3300003760 Bacteria 42841
23 Ga0055535_1000373 3300003761 Bacteria 42794
24 Ga0055535_1000405 3300003761 Bacteria 40615
25 Ga0055535_1001379 3300003761 Bacteria 12645
26 Ga0055535_1001457 3300003761 Bacteria 11944
27 Ga0055542_1000394 3300003762 Bacteria 43618
28 Ga0055542_1000431 3300003762 Bacteria 40271
29 Ga0055542_1000734 3300003762 Bacteria 25435
30 Ga0055542_1001349 3300003762 Bacteria 12645
31 Ga0055529_1000420 3300003763 Bacteria 43618
32 Ga0055529_1000428 3300003763 Bacteria 42837
33 Ga0055529_1001072 3300003763 Bacteria 12645
34 Ga0070690_100236913 3300005330 Bacteria 1285
35 Ga0070682_100003420 3300005337 Bacteria 8801
36 Ga0070682_100005911 3300005337 Bacteria 6841
37 Ga0070682_100144425 3300005337 Bacteria 1626
38 Ga0070682_100145605 3300005337 Bacteria 1620
39 Ga0070660_100098216 3300005339 Bacteria 2317
40 Ga0070661_100043073 3300005344 Bacteria 3297
41 Ga0070675_100124335 3300005354 Bacteria 2194
42 Ga0070674_100976625 3300005356 Bacteria 742
43 Ga0070673_100668224 3300005364 Bacteria 952
44 Ga0070688_100503788 3300005365 Bacteria 914
45 Ga0070659_100060238 3300005366 Bacteria 2998
46 Ga0070659_100064017 3300005366 Bacteria 2910
47 Ga0070659_100078899 3300005366 Bacteria 2627
48 Ga0070714_100000136 3300005435 Bacteria 58402
49 Ga0070714_100009681 3300005435 Bacteria 7589
50 Ga0070713_100000663 3300005436 Bacteria 22010
51 Ga0070711_100176577 3300005439 Bacteria 1632
52 Ga0070694_101231724 3300005444 Bacteria 628
53 Ga0070663_100029737 3300005455 Bacteria 3736
54 Ga0070678_100111094 3300005456 Bacteria 2144
55 Ga0070678_100158743 3300005456 Bacteria 1830
56 Ga0070662_100157119 3300005457 Bacteria 1776
57 Ga0070681_10013810 3300005458 Bacteria 8037
58 Ga0070681_10184664 3300005458 Bacteria 2006
59 Ga0070681_10298921 3300005458 Bacteria 1520
60 Ga0068867_100036463 3300005459 Bacteria 3570
61 Ga0070679_100030348 3300005530 Bacteria 5338
62 Ga0070684_100042993 3300005535 Bacteria 3902
63 Ga0070684_100276450 3300005535 Bacteria 1538
64 Ga0068853_100002290 3300005539 Bacteria 14303
65 Ga0068853_100083800 3300005539 Bacteria 2793
66 Ga0068853_100272192 3300005539 Bacteria 1560
67 Ga0068853_100346166 3300005539 Bacteria 1382
68 Ga0070696_100016454 3300005546 Bacteria 4981
69 Ga0070696_100420450 3300005546 Bacteria 1049
70 Ga0070693_100013608 3300005547 Bacteria 4149
71 Ga0070693_100255620 3300005547 Bacteria 1163
72 Ga0068855_100276854 3300005563 Bacteria 1865
73 Ga0070664_100543555 3300005564 Bacteria 1074
74 Ga0068857_100149478 3300005577 Bacteria 2115
75 Ga0068854_100274841 3300005578 Bacteria 1354
76 Ga0068856_100000138 3300005614 Bacteria 73748
77 Ga0068856_100000938 3300005614 Bacteria 31227
78 Ga0068856_100084270 3300005614 Bacteria 3157
79 Ga0068856_100125526 3300005614 Bacteria 2569
80 Ga0068852_100000993 3300005616 Bacteria 18725
81 Ga0068852_100087699 3300005616 Bacteria 2777
82 Ga0068852_100798083 3300005616 Unclassified 958
83 Ga0068859_100695974 3300005617 Bacteria 1107
84 Ga0068864_100832311 3300005618 Bacteria 909
85 Ga0068851_10060724 3300005834 Bacteria 1936
86 Ga0068851_10222379 3300005834 Bacteria 1061
87 Ga0068863_100064829 3300005841 Bacteria 3455
88 Ga0068863_100306591 3300005841 Bacteria 1541
89 Ga0068860_100064748 3300005843 Bacteria 3472
90 Ga0068862_100262438 3300005844 Bacteria 1577
91 Ga0070712_100062304 3300006175 Bacteria 2637
92 Ga0070712_100156822 3300006175 Bacteria 1754
93 Ga0097621_100030828 3300006237 Bacteria 4249
94 Ga0068871_100039270 3300006358 Bacteria 3786
95 Ga0068865_100051306 3300006881 Bacteria 2855
96 Ga0068865_100616334 3300006881 Bacteria 919
97 Ga0097620_100695885 3300006931 Bacteria 1107
98 Ga0105240_10020394 3300009093 Bacteria 8843
99 Ga0105240_10092425 3300009093 Bacteria 3694
100 Ga0105240_10498135 3300009093 Bacteria 1355
101 Ga0105245_11414819 3300009098 Bacteria 746
102 Ga0105241_10113604 3300009174 Bacteria 2171
103 Ga0105241_10143875 3300009174 Bacteria 1944
104 Ga0105242_10623300 3300009176 Bacteria 1045
105 Ga0105237_10000108 3300009545 Bacteria 116481
106 Ga0105237_10178205 3300009545 Bacteria 2126
107 Ga0105237_10475288 3300009545 Bacteria 1256
108 Ga0105238_10077321 3300009551 Bacteria 3319
109 Ga0105238_10094582 3300009551 Bacteria 2976
110 Ga0105238_10284964 3300009551 Bacteria 1634
111 Ga0105238_11059889 3300009551 Bacteria 833
112 Ga0105249_10086206 3300009553 Bacteria 2928
113 Ga0105239_10097327 3300010375 Bacteria 3252
114 Ga0105239_10346308 3300010375 Bacteria 1677
115 Ga0105239_10500660 3300010375 Bacteria 1381
116 Ga0105239_10934979 3300010375 Bacteria 995
117 Ga0157373_10124036 3300013100 Bacteria 1816
118 Ga0157373_10376397 3300013100 Bacteria 1015
119 Ga0157371_10078098 3300013102 Bacteria 2344
120 Ga0157370_10028195 3300013104 Bacteria 5526
121 Ga0157370_10092086 3300013104 Bacteria 2846
122 Ga0157370_10422738 3300013104 Bacteria 1226
123 Ga0157369_10001250 3300013105 Bacteria 31665
124 Ga0157369_10023424 3300013105 Bacteria 6876
125 Ga0157369_10780261 3300013105 Bacteria 982
126 Ga0157369_11052126 3300013105 Bacteria 833
127 Ga0157369_11280052 3300013105 Unclassified 748
128 Ga0157378_10000005 3300013297 Bacteria 197893
129 Ga0157378_10441581 3300013297 Bacteria 1290
130 Ga0163162_10004503 3300013306 Bacteria 13418
131 Ga0163162_10061251 3300013306 Bacteria 3800
132 Ga0163162_10398786 3300013306 Bacteria 1508
133 Ga0157372_10042167 3300013307 Bacteria 5046
134 Ga0157372_10059684 3300013307 Bacteria 4267
135 Ga0157375_10015674 3300013308 Bacteria 6789
136 Ga0163163_10141379 3300014325 Bacteria 2449
137 Ga0182008_10003298 3300014497 Bacteria 9825
138 Ga0182008_10020743 3300014497 Bacteria 3380
139 Ga0182008_10204300 3300014497 Bacteria 1006
140 Ga0157379_10032747 3300014968 Bacteria 4635
141 Ga0157376_10004652 3300014969 Bacteria 9563
142 Ga0157376_10089216 3300014969 Bacteria 2665
143 Ga0182006_1000133 3300015261 Bacteria 80418
144 Ga0182006_1016232 3300015261 Bacteria 3177
145 Ga0182007_10002824 3300015262 Bacteria 8456
146 Ga0182007_10040462 3300015262 Bacteria 1556
147 Ga0182007_10057850 3300015262 Bacteria 1272
148 Ga0182007_10069031 3300015262 Bacteria 1158
149 Ga0182005_1000257 3300015265 Bacteria 33567
150 Ga0182005_1000685 3300015265 Bacteria 15850
151 Ga0183369_1004 3300015685 Bacteria 539301
152 Ga0183368_1002 3300015687 Bacteria 1865598
153 Ga0163161_10072469 3300017792 Bacteria 2522
154 Ga0163161_10092419 3300017792 Bacteria 2240
155 Ga0206354_10274793 3300020081 Bacteria 1358
156 Ga0206353_11873004 3300020082 Bacteria 4290
157 Ga0209784_100053 3300025224 Bacteria 182075
158 Ga0209674_100014 3300025226 Bacteria 704989
159 Ga0209674_100197 3300025226 Bacteria 62877
160 Ga0209674_100550 3300025226 Bacteria 14925
161 Ga0209674_100621 3300025226 Bacteria 13278
162 Ga0209672_100004 3300025228 Bacteria 1467504
163 Ga0209672_100008 3300025228 Bacteria 946876
164 Ga0209672_100826 3300025228 Bacteria 14489
165 Ga0209672_101804 3300025228 Bacteria 6565
166 Ga0209563_100097 3300025230 Bacteria 159453
167 Ga0207427_100044 3300025231 Bacteria 242623
168 Ga0207427_100061 3300025231 Bacteria 182815
169 Ga0207427_100129 3300025231 Bacteria 94644
170 Ga0209437_100005 3300025233 Bacteria 1071596
171 Ga0209437_100037 3300025233 Bacteria 459730
172 Ga0209437_100118 3300025233 Bacteria 207534
173 Ga0209258_100003 3300025242 Bacteria 1467504
174 Ga0209258_100004 3300025242 Bacteria 1376422
175 Ga0209258_100008 3300025242 Bacteria 1009355
176 Ga0209258_100090 3300025242 Bacteria 232619
177 Ga0209258_100138 3300025242 Bacteria 167495
178 Ga0209258_100479 3300025242 Bacteria 42065
179 Ga0209258_108074 3300025242 Bacteria 1512
180 Ga0209646_1001101 3300025246 Bacteria 8009
181 Ga0209026_1000010 3300025250 Bacteria 511986
182 Ga0209026_1000104 3300025250 Bacteria 152614
183 Ga0209026_1000553 3300025250 Bacteria 25735
184 Ga0209677_100976 3300025253 Bacteria 13869
185 Ga0209148_1000001 3300025254 Bacteria 2545271
186 Ga0209148_1000016 3300025254 Bacteria 804369
187 Ga0209148_1000041 3300025254 Bacteria 469323
188 Ga0209148_1000065 3300025254 Bacteria 344489
189 Ga0209759_1001467 3300025256 Bacteria 13162
190 Ga0209759_1004437 3300025256 Bacteria 5244
191 Ga0209759_1010286 3300025256 Bacteria 2751
192 Ga0209129_1005329 3300025258 Bacteria 4598
193 Ga0209233_1000002 3300025261 Bacteria 2501366
194 Ga0209233_1000011 3300025261 Bacteria 1071611
195 Ga0209233_1000046 3300025261 Bacteria 470971
196 Ga0209455_1000004 3300025272 Bacteria 1467504
197 Ga0209455_1000007 3300025272 Bacteria 1157983
198 Ga0209455_1000079 3300025272 Bacteria 268778
199 Ga0209455_1000189 3300025272 Bacteria 92877
200 Ga0209758_1000840 3300025297 Bacteria 42856
201 Ga0209257_1031751 3300025304 Bacteria 1685
202 Ga0207656_10090093 3300025321 Bacteria 1391
203 Ga0207642_10033079 3300025899 Bacteria 2184
204 Ga0207680_10121510 3300025903 Bacteria 1708
205 Ga0207647_10000002 3300025904 Bacteria 400771
206 Ga0207647_10033709 3300025904 Bacteria 3275
207 Ga0207647_10075168 3300025904 Bacteria 2034
208 Ga0207699_10258963 3300025906 Bacteria 1202
209 Ga0207654_10084355 3300025911 Bacteria 1920
210 Ga0207654_10207613 3300025911 Bacteria 1293
211 Ga0207654_10267282 3300025911 Bacteria 1152
212 Ga0207707_10033334 3300025912 Bacteria 4508
213 Ga0207707_10091964 3300025912 Bacteria 2651
214 Ga0207695_10000751 3300025913 Bacteria 62399
215 Ga0207695_10034658 3300025913 Bacteria 5486
216 Ga0207695_10329637 3300025913 Bacteria 1415
217 Ga0207695_10399275 3300025913 Bacteria 1259
218 Ga0207671_10001039 3300025914 Bacteria 33742
219 Ga0207671_10056712 3300025914 Bacteria 2903
220 Ga0207671_10627492 3300025914 Bacteria 856
221 Ga0207663_10302989 3300025916 Bacteria 1195
222 Ga0207657_10005348 3300025919 Bacteria 13449
223 Ga0207657_10034179 3300025919 Bacteria 4575
224 Ga0207657_10361214 3300025919 Bacteria 1145
225 Ga0207650_10303997 3300025925 Bacteria 1303
226 Ga0207659_10081448 3300025926 Bacteria 2394
227 Ga0207700_10002250 3300025928 Bacteria 11080
228 Ga0207664_10000150 3300025929 Bacteria 56559
229 Ga0207664_10024414 3300025929 Bacteria 4543
230 Ga0207690_10018888 3300025932 Bacteria 4233
231 Ga0207690_10019423 3300025932 Bacteria 4184
232 Ga0207690_10075080 3300025932 Bacteria 2343
233 Ga0207706_10041079 3300025933 Bacteria 4101
234 Ga0207706_10137663 3300025933 Bacteria 2148
235 Ga0207670_10280065 3300025936 Bacteria 1299
236 Ga0207704_10107734 3300025938 Bacteria 1875
237 Ga0207704_10480075 3300025938 Bacteria 998
238 Ga0207711_10059577 3300025941 Bacteria 3287
239 Ga0207689_10036959 3300025942 Bacteria 4053
240 Ga0207661_10137268 3300025944 Bacteria 2101
241 Ga0207679_10202668 3300025945 Bacteria 1658
242 Ga0207679_10241269 3300025945 Bacteria 1531
243 Ga0207667_10129666 3300025949 Bacteria 2597
244 Ga0207712_10022130 3300025961 Bacteria 4183
245 Ga0207668_10888757 3300025972 Bacteria 792
246 Ga0207640_10026409 3300025981 Bacteria 3525
247 Ga0207640_10109031 3300025981 Bacteria 1958
248 Ga0207640_10304145 3300025981 Bacteria 1263
249 Ga0207658_10209023 3300025986 Bacteria 1634
250 Ga0207658_10992158 3300025986 Bacteria 766
251 Ga0207677_10331958 3300026023 Bacteria 1267
252 Ga0207703_11320740 3300026035 Unclassified 694
253 Ga0207639_10010626 3300026041 Bacteria 6374
254 Ga0207639_10056135 3300026041 Bacteria 3017
255 Ga0207639_10118365 3300026041 Bacteria 2172
256 Ga0207639_10148570 3300026041 Bacteria 1961
257 Ga0207678_10001852 3300026067 Bacteria 19350
258 Ga0207678_10389688 3300026067 Bacteria 1205
259 Ga0207678_10441282 3300026067 Bacteria 1131
260 Ga0207702_10000068 3300026078 Bacteria 116478
261 Ga0207702_10000740 3300026078 Bacteria 34919
262 Ga0207702_10148432 3300026078 Bacteria 2130
263 Ga0207702_10271930 3300026078 Bacteria 1598
264 Ga0207641_10012439 3300026088 Bacteria 6977
265 Ga0207641_10127051 3300026088 Bacteria 2284
266 Ga0207648_10007804 3300026089 Bacteria 10450
267 Ga0207676_10056071 3300026095 Bacteria 3096
268 Ga0207674_10002555 3300026116 Bacteria 22911
269 Ga0207674_10034748 3300026116 Bacteria 5266
270 Ga0207683_10006726 3300026121 Bacteria 9840
271 Ga0207683_10028384 3300026121 Bacteria 4838
272 Ga0207698_10027438 3300026142 Bacteria 4042
273 Ga0207698_10410866 3300026142 Bacteria 1296
274 Ga0268264_10087868 3300028381 Bacteria 2674
275 Ga0265332_10012137 3300031238 Bacteria 3823
276 Ga0307412_10006380 3300031911 Bacteria 6666
277 Ga0395899_0003165 3300037312 Bacteria 13064
278 Ga0395899_0286920 3300037312 Bacteria 1118
279 Ga0395900_0000011 3300037418 Bacteria 421926
280 Ga0395900_0003994 3300037418 Bacteria 15756
281 Ga0395900_0121624 3300037418 Bacteria 2678
282 Ga0395898_0000013 3300037466 Bacteria 458788
283 Ga0395898_0004893 3300037466 Bacteria 14544
284 Ga0395898_0079418 3300037466 Bacteria 3165
285 Ga0395901_0002392 3300038443 Bacteria 19071
286 Ga0395901_0014108 3300038443 Bacteria 8134
287 Ga0395901_0056535 3300038443 Bacteria 4082
288 Ga0395901_0250725 3300038443 Bacteria 1844
289 Ga0395901_0357506 3300038443 Bacteria 1506
290 Ga0395901_1028463 3300038443 Bacteria 798
291 Ga0439436_0000004 3300041404 Bacteria 175137
292 Ga0439465_0014771 3300041413 Bacteria 2435
293 Ga0439454_007983 3300042011 Bacteria 1340
294 Ga0439455_0082845 3300042012 Bacteria 873
295 Ga0466969_0003745 3300044656 Bacteria 8079
296 Ga0466969_0084026 3300044656 Bacteria 1515
297 Ga0466969_0130639 3300044656 Bacteria 1164
298 Ga0466972_0172305 3300044658 Bacteria 1015
299 Ga0466982_0000001 3300044672 Bacteria 514662
300 Ga0466965_0277991 3300044683 Bacteria 903
301 Ga0466966_0003955 3300044684 Bacteria 9793
302 Ga0466966_0051974 3300044684 Bacteria 2604
303 Ga0466961_0000535 3300044693 Bacteria 24166
304 Ga0466961_0001111 3300044693 Bacteria 16550
305 Ga0466961_0021886 3300044693 Bacteria 4113
306 Ga0466961_0285463 3300044693 Bacteria 1009
307 Ga0466971_0001794 3300044719 Bacteria 9109
308 Ga0466971_0078682 3300044719 Bacteria 1502
309 Ga0466971_0151614 3300044719 Unclassified 1082
310 Ga0466968_0048565 3300044735 Bacteria 1806
311 Ga0466970_0068434 3300044765 Bacteria 1907
312 Ga0466970_0139951 3300044765 Bacteria 1332
313 Ga0466970_0269699 3300044765 Bacteria 956
314 Ga0466957_0001515 3300044842 Bacteria 12203
315 Ga0466957_0011846 3300044842 Bacteria 5039
316 Ga0466957_0084013 3300044842 Bacteria 1987
317 Ga0466960_0137340 3300044901 Bacteria 1295
318 Ga0466959_0022722 3300045049 Bacteria 4636
319 Ga0466959_0035404 3300045049 Bacteria 3692
320 Ga0466959_0226298 3300045049 Bacteria 1296
321 Ga0466959_0259815 3300045049 Bacteria 1195
322 Ga0466958_0007247 3300045836 Bacteria 6084
323 Ga0466958_0017645 3300045836 Bacteria 4131
324 Ga0466958_0053028 3300045836 Bacteria 2459
325 Ga0466967_0176391 3300045976 Bacteria 2013
326 Ga0495638_0001087 3300046460 Bacteria 26471
327 Ga0495607_0000006 3300046501 Bacteria 281664
328 Ga0495606_0000016 3300046507 Bacteria 284865
329 Ga0495610_0060292 3300046512 Bacteria 1807
330 Ga0495622_0006861 3300046557 Bacteria 5286
331 Ga0495625_0054251 3300046660 Bacteria 2863
332 Ga0495670_0000599 3300046691 Bacteria 17194
333 Ga0495649_0000450 3300046694 Bacteria 35527
334 Ga0495649_0002369 3300046694 Bacteria 13331
335 Ga0495686_0000426 3300047472 Bacteria 66285
336 Ga0496115_0000729 3300048918 Bacteria 24348
337 Ga0496115_0051557 3300048918 Bacteria 3299
338 Ga0496116_0031157 3300048919 Bacteria 3823
339 Ga0496117_0222564 3300048920 Bacteria 1049
340 Ga0496118_0002160 3300048921 Bacteria 27394
341 Ga0496118_0153116 3300048921 Bacteria 1440
342 Ga0496119_0007834 3300048922 Bacteria 9520
343 Ga0496121_0000116 3300048924 Bacteria 177260
344 Ga0496122_0046307 3300048925 Bacteria 3370
345 Ga0496122_0175508 3300048925 Bacteria 1285
346 Ga0496123_0039574 3300048926 Bacteria 3296
347 Ga0496123_0261540 3300048926 Bacteria 847
348 Ga0496125_0008843 3300048928 Bacteria 10469
349 Ga0496126_0023326 3300048929 Bacteria 5997
350 Ga0496126_0095556 3300048929 Bacteria 2606
351 Ga0495682_0021561 3300049460 Bacteria 2413
352 Ga0501031_0087028 3300049568 Bacteria 2037
353 Ga0501031_0403887 3300049568 Bacteria 883
354 Ga0501031_0440006 3300049568 Bacteria 842
355 Ga0501032_0079442 3300049569 Bacteria 2184
356 Ga0501032_0608184 3300049569 Bacteria 695
357 Ga0501033_0001009 3300049570 Bacteria 25578
358 Ga0501033_0004747 3300049570 Bacteria 10874
359 Ga0501033_0015590 3300049570 Bacteria 5763
360 Ga0501033_0415036 3300049570 Bacteria 938
361 Ga0501034_0039007 3300049571 Bacteria 4811
362 Ga0501034_0319022 3300049571 Bacteria 1487
363 Ga0501034_0630050 3300049571 Bacteria 976
364 Ga0501036_0034826 3300049572 Bacteria 4260
365 Ga0501036_0039004 3300049572 Bacteria 4022
366 Ga0501037_0074941 3300049573 Bacteria 2458
367 Ga0501037_0125242 3300049573 Bacteria 1845
368 Ga0501039_0174414 3300049575 Bacteria 1691
369 Ga0501043_0007069 3300049579 Bacteria 8935
370 Ga0501043_0099758 3300049579 Bacteria 2282
371 Ga0501043_0590609 3300049579 Bacteria 821
372 Ga0501043_0711089 3300049579 Bacteria 733
373 Ga0501046_0032221 3300049580 Bacteria 4244
374 Ga0501047_0013195 3300049581 Bacteria 7825
375 Ga0501047_0210788 3300049581 Bacteria 1801
376 Ga0501047_0399459 3300049581 Bacteria 1207
377 Ga0501048_0187109 3300049582 Bacteria 1467
378 Ga0501048_0466084 3300049582 Bacteria 905
379 Ga0501070_0161249 3300049586 Bacteria 1849
380 Ga0501070_0601708 3300049586 Bacteria 876
381 Ga0501073_0128828 3300049589 Bacteria 1754
382 Ga0501079_0035259 3300049741 Bacteria 3851
383 Ga0501080_0022411 3300049742 Bacteria 5851
384 Ga0501080_0163766 3300049742 Bacteria 2053
385 Ga0501035_0027485 3300049822 Bacteria 5199
386 Ga0501035_0181392 3300049822 Bacteria 1814
387 Ga0501035_0196643 3300049822 Bacteria 1731
388 Ga0501035_0246243 3300049822 Bacteria 1519
389 Ga0501044_0021893 3300049823 Bacteria 6816
390 Ga0501044_0642780 3300049823 Bacteria 950
391 nmdc:mga0n895_763246_c1 3300050512 Bacteria 959
392 Ga0466962_0001335 3300061719 Bacteria 11398
393 Ga0466962_0044629 3300061719 Bacteria 2120
394 Ga0466962_0049688 3300061719 Bacteria 2005
395 2538834380 2537561836 Bacteria 3910579
396 2643828769 2643221562 Bacteria 4048635
397 2738881063 2738541307 Bacteria 8606193
398 2842920959 2842918807 Bacteria 4289178
399 2895398087 2895395659 Bacteria 3983269
400 2919086477 2919085039 Bacteria 4532964
401 2939613470 2939611941 Bacteria 3892017
402 2941472037 2941471342 Bacteria 5018624
403 2953996229 2953994433 Bacteria 4303959
404 Ga0466965_0014956
405 JGI25162J39368_1000705
406 JGI25162J39368_1001445
407 JGI25157J39369_1001046
408 JGI25157J39369_1001662
409 JGI25164J39214_1000347
410 JGI25164J39214_1000714
411 JGI25164J39214_1000718
412 JGI25164J39214_1000761
413 JGI25165J46597_1000640
414 JGI25165J46597_1001443
415 JGI25165J46597_1003068
416 rootL2_10038685
417 rootH1_10292646
418 Ga0055538_1003613
419 Ga0055539_1002420
420 Ga0055533_1002475
421 Ga0055533_1003063
422 Ga0055533_1017870
423 Ga0055525_1000082
424 Ga0055527_1000176
425 Ga0055527_1000179
426 Ga0055535_1000373
427 Ga0055535_1000405
428 Ga0055535_1001379
429 Ga0055535_1001457
430 Ga0055542_1000394
431 Ga0055542_1000431
432 Ga0055542_1000734
433 Ga0055542_1001349
434 Ga0055529_1000420
435 Ga0055529_1000428
436 Ga0055529_1001072
437 Ga0070690_100236913
438 Ga0070682_100003420
439 Ga0070682_100005911
440 Ga0070682_100144425
441 Ga0070682_100145605
442 Ga0070660_100098216
443 Ga0070661_100043073
444 Ga0070675_100124335
445 Ga0070674_100976625
446 Ga0070673_100668224
447 Ga0070688_100503788
448 Ga0070659_100060238
449 Ga0070659_100064017
450 Ga0070659_100078899
451 Ga0070714_100000136
452 Ga0070714_100009681
453 Ga0070713_100000663
454 Ga0070711_100176577
455 Ga0070694_101231724
456 Ga0070663_100029737
457 Ga0070678_100111094
458 Ga0070678_100158743
459 Ga0070662_100157119
460 Ga0070681_10013810
461 Ga0070681_10184664
462 Ga0070681_10298921
463 Ga0068867_100036463
464 Ga0070679_100030348
465 Ga0070684_100042993
466 Ga0070684_100276450
467 Ga0068853_100002290
468 Ga0068853_100083800
469 Ga0068853_100272192
470 Ga0068853_100346166
471 Ga0070696_100016454
472 Ga0070696_100420450
473 Ga0070693_100013608
474 Ga0070693_100255620
475 Ga0068855_100276854
476 Ga0070664_100543555
477 Ga0068857_100149478
478 Ga0068854_100274841
479 Ga0068856_100000138
480 Ga0068856_100000938
481 Ga0068856_100084270
482 Ga0068856_100125526
483 Ga0068852_100000993
484 Ga0068852_100087699
485 Ga0068852_100798083
486 Ga0068859_100695974
487 Ga0068864_100832311
488 Ga0068851_10060724
489 Ga0068851_10222379
490 Ga0068863_100064829
491 Ga0068863_100306591
492 Ga0068860_100064748
493 Ga0068862_100262438
494 Ga0070712_100062304
495 Ga0070712_100156822
496 Ga0097621_100030828
497 Ga0068871_100039270
498 Ga0068865_100051306
499 Ga0068865_100616334
500 Ga0097620_100695885
501 Ga0105240_10020394
502 Ga0105240_10092425
503 Ga0105240_10498135
504 Ga0105245_11414819
505 Ga0105241_10113604
506 Ga0105241_10143875
507 Ga0105242_10623300
508 Ga0105237_10000108
509 Ga0105237_10178205
510 Ga0105237_10475288
511 Ga0105238_10077321
512 Ga0105238_10094582
513 Ga0105238_10284964
514 Ga0105238_11059889
515 Ga0105249_10086206
516 Ga0105239_10097327
517 Ga0105239_10346308
518 Ga0105239_10500660
519 Ga0105239_10934979
520 Ga0157373_10124036
521 Ga0157373_10376397
522 Ga0157371_10078098
523 Ga0157370_10028195
524 Ga0157370_10092086
525 Ga0157370_10422738
526 Ga0157369_10001250
527 Ga0157369_10023424
528 Ga0157369_10780261
529 Ga0157369_11052126
530 Ga0157369_11280052
531 Ga0157378_10000005
532 Ga0157378_10441581
533 Ga0163162_10004503
534 Ga0163162_10061251
535 Ga0163162_10398786
536 Ga0157372_10042167
537 Ga0157372_10059684
538 Ga0157375_10015674
539 Ga0163163_10141379
540 Ga0182008_10003298
541 Ga0182008_10020743
542 Ga0182008_10204300
543 Ga0157379_10032747
544 Ga0157376_10004652
545 Ga0157376_10089216
546 Ga0182006_1000133
547 Ga0182006_1016232
548 Ga0182007_10002824
549 Ga0182007_10040462
550 Ga0182007_10057850
551 Ga0182007_10069031
552 Ga0182005_1000257
553 Ga0182005_1000685
554 Ga0183369_1004
555 Ga0183368_1002
556 Ga0163161_10072469
557 Ga0163161_10092419
558 Ga0206354_10274793
559 Ga0206353_11873004
560 Ga0209784_100053
561 Ga0209674_100014
562 Ga0209674_100197
563 Ga0209674_100550
564 Ga0209674_100621
565 Ga0209672_100004
566 Ga0209672_100008
567 Ga0209672_100826
568 Ga0209672_101804
569 Ga0209563_100097
570 Ga0207427_100044
571 Ga0207427_100061
572 Ga0207427_100129
573 Ga0209437_100005
574 Ga0209437_100037
575 Ga0209437_100118
576 Ga0209258_100003
577 Ga0209258_100004
578 Ga0209258_100008
579 Ga0209258_100090
580 Ga0209258_100138
581 Ga0209258_100479
582 Ga0209258_108074
583 Ga0209646_1001101
584 Ga0209026_1000010
585 Ga0209026_1000104
586 Ga0209026_1000553
587 Ga0209677_100976
588 Ga0209148_1000001
589 Ga0209148_1000016
590 Ga0209148_1000041
591 Ga0209148_1000065
592 Ga0209759_1001467
593 Ga0209759_1004437
594 Ga0209759_1010286
595 Ga0209129_1005329
596 Ga0209233_1000002
597 Ga0209233_1000011
598 Ga0209233_1000046
599 Ga0209455_1000004
600 Ga0209455_1000007
601 Ga0209455_1000079
602 Ga0209455_1000189
603 Ga0209758_1000840
604 Ga0209257_1031751
605 Ga0207656_10090093
606 Ga0207642_10033079
607 Ga0207680_10121510
608 Ga0207647_10000002
609 Ga0207647_10033709
610 Ga0207647_10075168
611 Ga0207699_10258963
612 Ga0207654_10084355
613 Ga0207654_10207613
614 Ga0207654_10267282
615 Ga0207707_10033334
616 Ga0207707_10091964
617 Ga0207695_10000751
618 Ga0207695_10034658
619 Ga0207695_10329637
620 Ga0207695_10399275
621 Ga0207671_10001039
622 Ga0207671_10056712
623 Ga0207671_10627492
624 Ga0207663_10302989
625 Ga0207657_10005348
626 Ga0207657_10034179
627 Ga0207657_10361214
628 Ga0207650_10303997
629 Ga0207659_10081448
630 Ga0207700_10002250
631 Ga0207664_10000150
632 Ga0207664_10024414
633 Ga0207690_10018888
634 Ga0207690_10019423
635 Ga0207690_10075080
636 Ga0207706_10041079
637 Ga0207706_10137663
638 Ga0207670_10280065
639 Ga0207704_10107734
640 Ga0207704_10480075
641 Ga0207711_10059577
642 Ga0207689_10036959
643 Ga0207661_10137268
644 Ga0207679_10202668
645 Ga0207679_10241269
646 Ga0207667_10129666
647 Ga0207712_10022130
648 Ga0207668_10888757
649 Ga0207640_10026409
650 Ga0207640_10109031
651 Ga0207640_10304145
652 Ga0207658_10209023
653 Ga0207658_10992158
654 Ga0207677_10331958
655 Ga0207703_11320740
656 Ga0207639_10010626
657 Ga0207639_10056135
658 Ga0207639_10118365
659 Ga0207639_10148570
660 Ga0207678_10001852
661 Ga0207678_10389688
662 Ga0207678_10441282
663 Ga0207702_10000068
664 Ga0207702_10000740
665 Ga0207702_10148432
666 Ga0207702_10271930
667 Ga0207641_10012439
668 Ga0207641_10127051
669 Ga0207648_10007804
670 Ga0207676_10056071
671 Ga0207674_10002555
672 Ga0207674_10034748
673 Ga0207683_10006726
674 Ga0207683_10028384
675 Ga0207698_10027438
676 Ga0207698_10410866
677 Ga0268264_10087868
678 Ga0265332_10012137
679 Ga0307412_10006380
680 Ga0395899_0003165
681 Ga0395899_0286920
682 Ga0395900_0000011
683 Ga0395900_0003994
684 Ga0395900_0121624
685 Ga0395898_0000013
686 Ga0395898_0004893
687 Ga0395898_0079418
688 Ga0395901_0002392
689 Ga0395901_0014108
690 Ga0395901_0056535
691 Ga0395901_0250725
692 Ga0395901_0357506
693 Ga0395901_1028463
694 Ga0439436_0000004
695 Ga0439465_0014771
696 Ga0439454_007983
697 Ga0439455_0082845
698 Ga0466969_0003745
699 Ga0466969_0084026
700 Ga0466969_0130639
701 Ga0466972_0172305
702 Ga0466982_0000001
703 Ga0466965_0277991
704 Ga0466966_0003955
705 Ga0466966_0051974
706 Ga0466961_0000535
707 Ga0466961_0001111
708 Ga0466961_0021886
709 Ga0466961_0285463
710 Ga0466971_0001794
711 Ga0466971_0078682
712 Ga0466971_0151614
713 Ga0466968_0048565
714 Ga0466970_0068434
715 Ga0466970_0139951
716 Ga0466970_0269699
717 Ga0466957_0001515
718 Ga0466957_0011846
719 Ga0466957_0084013
720 Ga0466960_0137340
721 Ga0466959_0022722
722 Ga0466959_0035404
723 Ga0466959_0226298
724 Ga0466959_0259815
725 Ga0466958_0007247
726 Ga0466958_0017645
727 Ga0466958_0053028
728 Ga0466967_0176391
729 Ga0495638_0001087
730 Ga0495607_0000006
731 Ga0495606_0000016
732 Ga0495610_0060292
733 Ga0495622_0006861
734 Ga0495625_0054251
735 Ga0495670_0000599
736 Ga0495649_0000450
737 Ga0495649_0002369
738 Ga0495686_0000426
739 Ga0496115_0000729
740 Ga0496115_0051557
741 Ga0496116_0031157
742 Ga0496117_0222564
743 Ga0496118_0002160
744 Ga0496118_0153116
745 Ga0496119_0007834
746 Ga0496121_0000116
747 Ga0496122_0046307
748 Ga0496122_0175508
749 Ga0496123_0039574
750 Ga0496123_0261540
751 Ga0496125_0008843
752 Ga0496126_0023326
753 Ga0496126_0095556
754 Ga0495682_0021561
755 Ga0501031_0087028
756 Ga0501031_0403887
757 Ga0501031_0440006
758 Ga0501032_0079442
759 Ga0501032_0608184
760 Ga0501033_0001009
761 Ga0501033_0004747
762 Ga0501033_0015590
763 Ga0501033_0415036
764 Ga0501034_0039007
765 Ga0501034_0319022
766 Ga0501034_0630050
767 Ga0501036_0034826
768 Ga0501036_0039004
769 Ga0501037_0074941
770 Ga0501037_0125242
771 Ga0501039_0174414
772 Ga0501043_0007069
773 Ga0501043_0099758
774 Ga0501043_0590609
775 Ga0501043_0711089
776 Ga0501046_0032221
777 Ga0501047_0013195
778 Ga0501047_0210788
779 Ga0501047_0399459
780 Ga0501048_0187109
781 Ga0501048_0466084
782 Ga0501070_0161249
783 Ga0501070_0601708
784 Ga0501073_0128828
785 Ga0501079_0035259
786 Ga0501080_0022411
787 Ga0501080_0163766
788 Ga0501035_0027485
789 Ga0501035_0181392
790 Ga0501035_0196643
791 Ga0501035_0246243
792 Ga0501044_0021893
793 Ga0501044_0642780
794 nmdc:mga0n895_763246_c1
795 Ga0466962_0001335
796 Ga0466962_0044629
797 Ga0466962_0049688
798 2538834380
799 2643828769
800 2738881063
801 2842920959
802 2895398087
803 2919086477
804 2939613470
805 2941472037
806 2953996229

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

23

198

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.9444 7 186
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9342 3 179
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.9341 3 179
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.9198 7 186
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.919 1 185
ID Description Score Start End Superfamily
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9341 7 186 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9304 3 179 3.90.870.10
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9194 7 186 3.90.870.10
af_Q4DBQ8_3_214_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9166 3 188 3.90.870.10
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9108 3 188 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A522RS45-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9759 2 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A1G5BNB7-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9715 10 187 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A522RS45-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9708 2 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A421K549-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9702 9 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A2T6NKQ2-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9691 17 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710

Map