F435468

General Info

Members Datasets Scaffolds Average Seq Length
403 194 403 252

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0129854|Ga0453684_0129854_974_1855
Length 293
Sequence MRVLAPVQTEVKPISQTGCQPVANSEQERNAKDERTIMLYKAKTLKGYRLDSRDGEIGQVKEFYFDDHHWTIRYLVADTGNWLTGRQVLISPYALVAVSQEEQHIVINLTKKQIEDSPSLNSDRPVSRRFEEAYYGYYGWPMYWDGPNVWGVYPYLVRDPEGWDQATQGEKAWDPHLRSTHDVSGHHIQAADGEIGHVEDFIIDDETWTIRYLIIDTRNWWPGRKVLVSPQWIERVSWGERKVFVNLPRESIRQSPEYTDESLLTRDYEIGLHGHYNRQGYWVDEPAAKEHSR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
166 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.25
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10014713 3300003322 Bacteria 2437
2 rootH1_10113966 3300003323 Bacteria 2796
3 Ga0065707_10184678 3300005295 Bacteria 1396
4 Ga0070690_100220263 3300005330 Bacteria 1329
5 Ga0070670_100002385 3300005331 Bacteria 15476
6 Ga0070666_10045629 3300005335 Bacteria 2938
7 Ga0070666_10392850 3300005335 Bacteria 996
8 Ga0070680_100000809 3300005336 Bacteria 22038
9 Ga0070680_100388844 3300005336 Bacteria 1188
10 Ga0070682_100002806 3300005337 Bacteria 9649
11 Ga0070660_100000092 3300005339 Bacteria 54311
12 Ga0070691_10003350 3300005341 Bacteria 7195
13 Ga0070661_100000504 3300005344 Bacteria 29905
14 Ga0070692_10000191 3300005345 Bacteria 16275
15 Ga0070669_100047457 3300005353 Bacteria 3133
16 Ga0070669_100343100 3300005353 Bacteria 1211
17 Ga0070671_100548774 3300005355 Bacteria 996
18 Ga0070674_100499859 3300005356 Bacteria 1012
19 Ga0070673_100012119 3300005364 Bacteria 5910
20 Ga0070673_100513103 3300005364 Bacteria 1085
21 Ga0070659_100002620 3300005366 Bacteria 12789
22 Ga0070703_10015098 3300005406 Unclassified 2207
23 Ga0070705_100000097 3300005440 Bacteria 49136
24 Ga0070705_100405510 3300005440 Bacteria 1011
25 Ga0070700_100329043 3300005441 Bacteria 1125
26 Ga0070694_100001563 3300005444 Bacteria 13463
27 Ga0070694_100018074 3300005444 Unclassified 4468
28 Ga0070694_100510505 3300005444 Unclassified 958
29 Ga0070708_100011105 3300005445 Bacteria 7319
30 Ga0070708_100051994 3300005445 Bacteria 3631
31 Ga0070708_100074745 3300005445 Bacteria 3057
32 Ga0070663_100002707 3300005455 Bacteria 10030
33 Ga0070678_100105207 3300005456 Bacteria 2196
34 Ga0070662_100192499 3300005457 Bacteria 1614
35 Ga0070681_10010120 3300005458 Bacteria 9297
36 Ga0070681_10109431 3300005458 Bacteria 2703
37 Ga0068867_100000688 3300005459 Bacteria 22451
38 Ga0070706_100507013 3300005467 Bacteria 1122
39 Ga0070707_100147050 3300005468 Bacteria 2294
40 Ga0070707_100193350 3300005468 Unclassified 1984
41 Ga0070707_100426366 3300005468 Unclassified 1287
42 Ga0070699_100041701 3300005518 Bacteria 3972
43 Ga0070699_100064559 3300005518 Bacteria 3175
44 Ga0070679_100008626 3300005530 Bacteria 9608
45 Ga0070679_100103195 3300005530 Unclassified 2838
46 Ga0070679_100226091 3300005530 Bacteria 1831
47 Ga0070697_100033153 3300005536 Bacteria 4159
48 Ga0070672_100368912 3300005543 Bacteria 1226
49 Ga0070686_100119739 3300005544 Bacteria 1806
50 Ga0070695_100000993 3300005545 Bacteria 15434
51 Ga0070695_100455940 3300005545 Unclassified 981
52 Ga0070696_100005347 3300005546 Bacteria 8564
53 Ga0070696_100243002 3300005546 Bacteria 1359
54 Ga0070693_100001195 3300005547 Bacteria 11688
55 Ga0070665_100769581 3300005548 Unclassified 976
56 Ga0070704_100000208 3300005549 Bacteria 24431
57 Ga0070704_100385028 3300005549 Unclassified 1192
58 Ga0068855_100010964 3300005563 Bacteria 10937
59 Ga0070664_100004517 3300005564 Bacteria 11164
60 Ga0070664_100311470 3300005564 Unclassified 1425
61 Ga0068857_100256398 3300005577 Bacteria 1604
62 Ga0068854_100000476 3300005578 Bacteria 24591
63 Ga0068856_100001410 3300005614 Bacteria 25205
64 Ga0068859_100002814 3300005617 Bacteria 17633
65 Ga0068859_100264634 3300005617 Bacteria 1811
66 Ga0068859_100939492 3300005617 Unclassified 948
67 Ga0068864_100002975 3300005618 Bacteria 14010
68 Ga0068864_100097665 3300005618 Bacteria 2601
69 Ga0068864_100931910 3300005618 Unclassified 859
70 Ga0068861_100006127 3300005719 Bacteria 8184
71 Ga0068870_10000045 3300005840 Bacteria 37970
72 Ga0068863_100017688 3300005841 Bacteria 6823
73 Ga0068858_100197023 3300005842 Bacteria 1904
74 Ga0068860_100114815 3300005843 Bacteria 2575
75 Ga0068860_100144311 3300005843 Bacteria 2290
76 Ga0068860_100230282 3300005843 Unclassified 1801
77 Ga0068860_100244268 3300005843 Bacteria 1746
78 Ga0068860_100285245 3300005843 Bacteria 1614
79 Ga0068862_100003064 3300005844 Bacteria 14566
80 Ga0068862_100005357 3300005844 Bacteria 10747
81 Ga0081455_10000163 3300005937 Bacteria 82001
82 Ga0081455_10086681 3300005937 Bacteria 2550
83 Ga0081538_10086098 3300005981 Bacteria 1647
84 Ga0075432_10096870 3300006058 Unclassified 1086
85 Ga0070715_10053625 3300006163 Unclassified 1743
86 Ga0075427_10012833 3300006194 Unclassified 1276
87 Ga0075428_100089903 3300006844 Bacteria 3349
88 Ga0075428_100123196 3300006844 Unclassified 2822
89 Ga0075428_100412890 3300006844 Unclassified 1446
90 Ga0075428_100526073 3300006844 Unclassified 1265
91 Ga0075428_100562768 3300006844 Bacteria 1218
92 Ga0075431_100025754 3300006847 Bacteria 6029
93 Ga0075431_100696767 3300006847 Bacteria 994
94 Ga0075433_10006736 3300006852 Bacteria 9103
95 Ga0075433_10012168 3300006852 Bacteria 6938
96 Ga0075433_10087891 3300006852 Bacteria 2745
97 Ga0075433_10118644 3300006852 Bacteria 2348
98 Ga0075434_100014861 3300006871 Bacteria 7447
99 Ga0075434_100077755 3300006871 Unclassified 3313
100 Ga0075434_100082333 3300006871 Bacteria 3215
101 Ga0075434_100097413 3300006871 Bacteria 2946
102 Ga0075434_100275614 3300006871 Bacteria 1701
103 Ga0075434_100632596 3300006871 Bacteria 1089
104 Ga0075429_100277262 3300006880 Unclassified 1468
105 Ga0075429_100500793 3300006880 Bacteria 1064
106 Ga0068865_100090998 3300006881 Unclassified 2213
107 Ga0068865_100245781 3300006881 Unclassified 1410
108 Ga0075436_100001034 3300006914 Bacteria 18746
109 Ga0075436_100357986 3300006914 Unclassified 1052
110 Ga0075436_100586457 3300006914 Bacteria 820
111 Ga0097620_100002815 3300006931 Bacteria 17633
112 Ga0097620_100264654 3300006931 Bacteria 1811
113 Ga0097620_100939431 3300006931 Unclassified 948
114 Ga0075435_100012625 3300007076 Bacteria 6259
115 Ga0075435_100066334 3300007076 Unclassified 2936
116 Ga0075435_100128510 3300007076 Bacteria 2119
117 Ga0075435_100386001 3300007076 Bacteria 1203
118 Ga0105240_10027163 3300009093 Bacteria 7499
119 Ga0105240_10051445 3300009093 Bacteria 5182
120 Ga0105240_10147950 3300009093 Plasmid 2801
121 Ga0105240_10275480 3300009093 Unclassified 1936
122 Ga0105240_10526141 3300009093 Unclassified 1311
123 Ga0111539_10287651 3300009094 Bacteria 1913
124 Ga0111539_10570637 3300009094 Bacteria 1318
125 Ga0111539_10846027 3300009094 Bacteria 1064
126 Ga0105245_10054332 3300009098 Unclassified 3597
127 Ga0105245_10239126 3300009098 Unclassified 1759
128 Ga0114129_10184770 3300009147 Unclassified 2834
129 Ga0114129_10638187 3300009147 Bacteria 1376
130 Ga0105243_10043120 3300009148 Bacteria 3535
131 Ga0105243_10232706 3300009148 Bacteria 1635
132 Ga0105243_10838251 3300009148 Unclassified 909
133 Ga0105248_10042119 3300009177 Bacteria 5121
134 Ga0105248_10247986 3300009177 Unclassified 2005
135 Ga0105248_10291419 3300009177 Unclassified 1838
136 Ga0105237_10417056 3300009545 Bacteria 1348
137 Ga0105238_10244081 3300009551 Unclassified 1774
138 Ga0105249_10124965 3300009553 Unclassified 2449
139 Ga0105249_10344306 3300009553 Bacteria 1508
140 Ga0105239_10544320 3300010375 Unclassified 1322
141 Ga0105246_10069400 3300011119 Bacteria 2475
142 Ga0105246_10305267 3300011119 Bacteria 1287
143 Ga0157373_10000370 3300013100 Bacteria 36005
144 Ga0157370_10122682 3300013104 Bacteria 2426
145 Ga0157369_10349779 3300013105 Bacteria 1535
146 Ga0157374_10251001 3300013296 Unclassified 1741
147 Ga0157378_10039103 3300013297 Bacteria 4206
148 Ga0163162_10150017 3300013306 Bacteria 2448
149 Ga0157372_10000772 3300013307 Bacteria 34627
150 Ga0157375_10024905 3300013308 Bacteria 5548
151 Ga0157375_10229470 3300013308 Bacteria 2015
152 Ga0157375_10829822 3300013308 Unclassified 1072
153 Ga0163163_10081752 3300014325 Bacteria 3233
154 Ga0163163_10331142 3300014325 Bacteria 1577
155 Ga0157377_10111140 3300014745 Bacteria 1647
156 Ga0157379_10190545 3300014968 Unclassified 1853
157 Ga0206354_10441266 3300020081 Unclassified 925
158 Ga0206353_11952120 3300020082 Unclassified 2229
159 Ga0213875_10000361 3300021388 Bacteria 42326
160 Ga0207427_100241 3300025231 Bacteria 44013
161 Ga0207680_10051335 3300025903 Bacteria 2466
162 Ga0207680_10173129 3300025903 Bacteria 1455
163 Ga0207645_10000264 3300025907 Bacteria 43356
164 Ga0207643_10000077 3300025908 Bacteria 64121
165 Ga0207684_10007337 3300025910 Bacteria 9945
166 Ga0207654_10006329 3300025911 Bacteria 5951
167 Ga0207707_10000234 3300025912 Bacteria 59924
168 Ga0207707_10274719 3300025912 Bacteria 1460
169 Ga0207695_10071079 3300025913 Plasmid 3555
170 Ga0207695_10364587 3300025913 Unclassified 1331
171 Ga0207660_10000890 3300025917 Bacteria 19670
172 Ga0207660_10191080 3300025917 Bacteria 1594
173 Ga0207660_10354806 3300025917 Bacteria 1176
174 Ga0207660_10362370 3300025917 Unclassified 1163
175 Ga0207657_10000419 3300025919 Bacteria 45112
176 Ga0207649_10001621 3300025920 Bacteria 13060
177 Ga0207652_10000306 3300025921 Bacteria 50379
178 Ga0207652_10078377 3300025921 Bacteria 2885
179 Ga0207646_10075032 3300025922 Bacteria 3021
180 Ga0207646_10438045 3300025922 Bacteria 1179
181 Ga0207681_10061950 3300025923 Bacteria 2574
182 Ga0207681_10282680 3300025923 Bacteria 1307
183 Ga0207681_10310420 3300025923 Bacteria 1251
184 Ga0207694_10032464 3300025924 Plasmid 3996
185 Ga0207659_10112943 3300025926 Bacteria 2068
186 Ga0207687_10011467 3300025927 Bacteria 5794
187 Ga0207644_10133511 3300025931 Bacteria 1903
188 Ga0207690_10030316 3300025932 Bacteria 3448
189 Ga0207690_10469094 3300025932 Bacteria 1014
190 Ga0207706_10071756 3300025933 Bacteria 3046
191 Ga0207706_10260533 3300025933 Bacteria 1514
192 Ga0207709_10063526 3300025935 Bacteria 2314
193 Ga0207711_10049665 3300025941 Bacteria 3591
194 Ga0207689_10000138 3300025942 Bacteria 62632
195 Ga0207679_10282828 3300025945 Bacteria 1423
196 Ga0207667_10000287 3300025949 Bacteria 69607
197 Ga0207651_10081789 3300025960 Bacteria 2329
198 Ga0207651_10391269 3300025960 Bacteria 1180
199 Ga0207712_10107469 3300025961 Unclassified 2086
200 Ga0207712_10204967 3300025961 Unclassified 1567
201 Ga0207640_10084505 3300025981 Bacteria 2180
202 Ga0207703_10114979 3300026035 Bacteria 2302
203 Ga0207703_10358501 3300026035 Unclassified 1344
204 Ga0207639_10684492 3300026041 Bacteria 951
205 Ga0207678_10055685 3300026067 Bacteria 3406
206 Ga0207708_10308230 3300026075 Bacteria 1289
207 Ga0207702_10004757 3300026078 Bacteria 11983
208 Ga0207641_10127250 3300026088 Bacteria 2282
209 Ga0207648_10001989 3300026089 Bacteria 22320
210 Ga0207648_10042800 3300026089 Unclassified 3977
211 Ga0207648_10161569 3300026089 Bacteria 1978
212 Ga0207676_10188898 3300026095 Bacteria 1811
213 Ga0207674_10000315 3300026116 Bacteria 61743
214 Ga0207674_10095056 3300026116 Bacteria 2967
215 Ga0207675_100008653 3300026118 Bacteria 9570
216 Ga0207675_100495404 3300026118 Bacteria 1216
217 Ga0268265_10008458 3300028380 Bacteria 6951
218 Ga0268265_10081718 3300028380 Bacteria 2552
219 Ga0268264_10088729 3300028381 Bacteria 2662
220 Ga0268264_10181099 3300028381 Bacteria 1914
221 Ga0268264_10324176 3300028381 Bacteria 1458
222 Ga0265319_1000075 3300028563 Bacteria 77601
223 Ga0265319_1001461 3300028563 Bacteria 14138
224 Ga0265319_1004033 3300028563 Bacteria 7430
225 Ga0265319_1005826 3300028563 Bacteria 5817
226 Ga0265319_1006057 3300028563 Bacteria 5671
227 Ga0265319_1042419 3300028563 Bacteria 1530
228 Ga0265334_10026542 3300028573 Unclassified 2338
229 Ga0265334_10029783 3300028573 Bacteria 2187
230 Ga0265318_10000041 3300028577 Bacteria 131592
231 Ga0265318_10000099 3300028577 Bacteria 80487
232 Ga0265318_10001281 3300028577 Bacteria 15145
233 Ga0265318_10001439 3300028577 Bacteria 14018
234 Ga0265318_10009086 3300028577 Bacteria 4392
235 Ga0265318_10018455 3300028577 Bacteria 2846
236 Ga0265318_10046584 3300028577 Unclassified 1636
237 Ga0265323_10000006 3300028653 Bacteria 141508
238 Ga0265323_10001272 3300028653 Bacteria 12614
239 Ga0265323_10001525 3300028653 Bacteria 11255
240 Ga0265323_10006846 3300028653 Unclassified 4768
241 Ga0265323_10009143 3300028653 Bacteria 4063
242 Ga0265323_10011778 3300028653 Bacteria 3520
243 Ga0265323_10038126 3300028653 Bacteria 1758
244 Ga0265323_10047223 3300028653 Bacteria 1541
245 Ga0265323_10086864 3300028653 Bacteria 1050
246 Ga0265322_10000464 3300028654 Bacteria 16241
247 Ga0265322_10001687 3300028654 Bacteria 7020
248 Ga0265322_10002509 3300028654 Bacteria 5658
249 Ga0265322_10032056 3300028654 Bacteria 1499
250 Ga0265338_10023551 3300028800 Bacteria 6327
251 Ga0265338_10024134 3300028800 Bacteria 6223
252 Ga0265338_10057886 3300028800 Bacteria 3426
253 Ga0265338_10067171 3300028800 Bacteria 3098
254 Ga0265338_10126728 3300028800 Bacteria 2024
255 Ga0265338_10131007 3300028800 Unclassified 1980
256 Ga0265775_101401 3300030762 Unclassified 1140
257 Ga0265776_100450 3300030880 Bacteria 1453
258 Ga0265330_10000093 3300031235 Bacteria 74704
259 Ga0265330_10002008 3300031235 Bacteria 11286
260 Ga0265330_10020202 3300031235 Bacteria 3044
261 Ga0265330_10083604 3300031235 Bacteria 1374
262 Ga0265330_10139927 3300031235 Bacteria 1029
263 Ga0265332_10000099 3300031238 Bacteria 74799
264 Ga0265332_10011651 3300031238 Bacteria 3906
265 Ga0265328_10000018 3300031239 Bacteria 131600
266 Ga0265328_10067415 3300031239 Bacteria 1315
267 Ga0265320_10005809 3300031240 Bacteria 7862
268 Ga0265320_10007148 3300031240 Bacteria 6959
269 Ga0265320_10008162 3300031240 Bacteria 6428
270 Ga0265320_10060274 3300031240 Bacteria 1812
271 Ga0265325_10018776 3300031241 Bacteria 3833
272 Ga0265325_10032965 3300031241 Bacteria 2763
273 Ga0265325_10141201 3300031241 Bacteria 1145
274 Ga0265329_10000017 3300031242 Bacteria 67174
275 Ga0265329_10000467 3300031242 Bacteria 21122
276 Ga0265329_10003326 3300031242 Bacteria 7031
277 Ga0265329_10015697 3300031242 Bacteria 2641
278 Ga0265329_10024465 3300031242 Bacteria 2005
279 Ga0265339_10042743 3300031249 Bacteria 2509
280 Ga0265331_10000112 3300031250 Bacteria 107928
281 Ga0265331_10000274 3300031250 Bacteria 57212
282 Ga0265331_10000818 3300031250 Bacteria 25607
283 Ga0265327_10000374 3300031251 Bacteria 84337
284 Ga0265327_10048419 3300031251 Unclassified 2236
285 Ga0265327_10102481 3300031251 Bacteria 1379
286 Ga0265316_10000029 3300031344 Bacteria 164218
287 Ga0265316_10000051 3300031344 Bacteria 126739
288 Ga0265316_10000055 3300031344 Bacteria 122834
289 Ga0265316_10000079 3300031344 Bacteria 101016
290 Ga0265316_10000905 3300031344 Bacteria 32395
291 Ga0265316_10003822 3300031344 Bacteria 15122
292 Ga0265316_10004568 3300031344 Bacteria 13743
293 Ga0265316_10009616 3300031344 Bacteria 8884
294 Ga0265316_10010693 3300031344 Bacteria 8342
295 Ga0265316_10015691 3300031344 Bacteria 6609
296 Ga0265316_10023076 3300031344 Bacteria 5232
297 Ga0265316_10028272 3300031344 Bacteria 4628
298 Ga0265316_10050933 3300031344 Unclassified 3254
299 Ga0265316_10063685 3300031344 Unclassified 2858
300 Ga0265316_10089138 3300031344 Unclassified 2355
301 Ga0265316_10095047 3300031344 Bacteria 2270
302 Ga0265316_10123792 3300031344 Bacteria 1951
303 Ga0307513_10054297 3300031456 Bacteria 4297
304 Ga0307408_100171258 3300031548 Bacteria 1734
305 Ga0265313_10005672 3300031595 Bacteria 9114
306 Ga0265313_10013614 3300031595 Bacteria 4867
307 Ga0265313_10074878 3300031595 Unclassified 1551
308 Ga0307508_10000087 3300031616 Bacteria 108574
309 Ga0265314_10000868 3300031711 Bacteria 35916
310 Ga0265314_10002169 3300031711 Bacteria 20535
311 Ga0265314_10003120 3300031711 Bacteria 16291
312 Ga0265314_10005814 3300031711 Bacteria 11047
313 Ga0265314_10012661 3300031711 Bacteria 6863
314 Ga0265314_10012852 3300031711 Bacteria 6802
315 Ga0265314_10015100 3300031711 Bacteria 6142
316 Ga0265342_10000359 3300031712 Bacteria 50694
317 Ga0265342_10000370 3300031712 Bacteria 49434
318 Ga0265342_10007793 3300031712 Bacteria 7786
319 Ga0265342_10038983 3300031712 Bacteria 2890
320 Ga0265342_10060640 3300031712 Bacteria 2230
321 Ga0265342_10173838 3300031712 Unclassified 1183
322 Ga0307413_10321740 3300031824 Unclassified 1182
323 Ga0373951_0023536 3300035091 Bacteria 1423
324 Ga0316574_0098174 3300035398 Bacteria 1873
325 Ga0373937_0434034 3300036401 Unclassified 1247
326 Ga0265778_006926 3300036457 Unclassified 1232
327 Ga0436364_0717863 3300037853 Bacteria 145182
328 Ga0439437_025674 3300042000 Unclassified 726
329 Ga0439441_001369 3300042001 Bacteria 3155
330 Ga0439448_0000436 3300042005 Bacteria 9587
331 Ga0439450_052839 3300042008 Bacteria 969
332 Ga0439455_0015411 3300042012 Bacteria 1757
333 Ga0439458_0006098 3300042157 Unclassified 2692
334 Ga0439459_0000723 3300042438 Bacteria 4510
335 Ga0451577_0000183 3300042876 Bacteria 133304
336 Ga0451577_0012719 3300042876 Bacteria 7897
337 Ga0451577_0050250 3300042876 Unclassified 3723
338 Ga0451577_0178840 3300042876 Bacteria 1912
339 Ga0451577_0178997 3300042876 Bacteria 1911
340 Ga0453683_0135827 3300044673 Bacteria 1551
341 Ga0453684_0000120 3300044712 Bacteria 345098
342 Ga0453684_0000436 3300044712 Bacteria 170125
343 Ga0453684_0000697 3300044712 Bacteria 119515
344 Ga0453684_0001435 3300044712 Bacteria 68004
345 Ga0453684_0039527 3300044712 Bacteria 6426
346 Ga0453684_0051074 3300044712 Bacteria 5428
347 Ga0453684_0080348 3300044712 Bacteria 4072
348 Ga0453684_0115295 3300044712 Bacteria 3255
349 Ga0453684_0129854 3300044712 Bacteria 3025
350 Ga0453684_0244926 3300044712 Bacteria 2062
351 Ga0453684_0442572 3300044712 Bacteria 1448
352 Ga0453684_0471279 3300044712 Unclassified 1394
353 Ga0453684_0864811 3300044712 Bacteria 971
354 Ga0453684_1012116 3300044712 Unclassified 883
355 Ga0451576_0003288 3300045051 Bacteria 22439
356 Ga0451576_0015951 3300045051 Bacteria 8305
357 Ga0451576_0017518 3300045051 Bacteria 7874
358 Ga0451576_0021484 3300045051 Bacteria 7015
359 Ga0451576_0084256 3300045051 Bacteria 3307
360 Ga0451576_0127917 3300045051 Bacteria 2647
361 Ga0451576_0183421 3300045051 Bacteria 2185
362 Ga0451576_0984228 3300045051 Unclassified 884
363 Ga0495652_0154700 3300046529 Unclassified 1787
364 Ga0495599_0195921 3300046678 Unclassified 1242
365 Ga0496106_0015588 3300048909 Bacteria 5622
366 Ga0501039_0185567 3300049575 Bacteria 1636
367 Ga0501040_0016137 3300049576 Bacteria 4939
368 Ga0501040_0017330 3300049576 Bacteria 4779
369 Ga0501042_0076198 3300049578 Bacteria 2401
370 Ga0501067_0246948 3300049583 Unclassified 993
371 Ga0501069_0063103 3300049585 Bacteria 2069
372 Ga0501070_0089861 3300049586 Bacteria 2542
373 Ga0501075_0091342 3300049591 Bacteria 2311
374 Ga0501079_0595780 3300049741 Bacteria 870
375 Ga0501080_0417167 3300049742 Bacteria 1206
376 Ga0501083_0026933 3300049744 Bacteria 3970
377 nmdc:mga05p37_103470_c1 3300050507 Unclassified 3505
378 nmdc:mga05p37_369889_c2 3300050507 Unclassified 1333
379 nmdc:mga05p37_427904_c1 3300050507 Bacteria 1539
380 nmdc:mga05p37_469833_c1 3300050507 Bacteria 1451
381 nmdc:mga05p37_50236_c1 3300050507 Bacteria 5128
382 nmdc:mga09592_345159_c1 3300050508 Bacteria 1289
383 nmdc:mga09592_37308_c1 3300050508 Bacteria 4077
384 nmdc:mga09592_76432_c1 3300050508 Bacteria 2848
385 nmdc:mga0qj67_329537_c1 3300050509 Bacteria 1236
386 nmdc:mga0qj67_47355_c1 3300050509 Bacteria 3396
387 nmdc:mga0qj67_94358_c1 3300050509 Bacteria 2406
388 nmdc:mga06r32_371343_c1 3300050510 Bacteria 1414
389 nmdc:mga06r32_67037_c1 3300050510 Bacteria 3465
390 nmdc:mga08y16_229509_c1 3300050511 Unclassified 1920
391 nmdc:mga08y16_236681_c1 3300050511 Bacteria 1888
392 nmdc:mga08y16_411400_c1 3300050511 Unclassified 1383
393 nmdc:mga0n895_113549_c1 3300050512 Bacteria 2727
394 nmdc:mga0n895_17777_c1 3300050512 Bacteria 6564
395 nmdc:mga0n895_188583_c1 3300050512 Bacteria 2093
396 nmdc:mga0n895_458917_c1 3300050512 Bacteria 1286
397 nmdc:mga0n895_918380_c1 3300050512 Bacteria 860
398 nmdc:mga0rr50_24246_c1 3300050513 Bacteria 4200
399 nmdc:mga0rr50_279947_c1 3300050513 Bacteria 1392
400 nmdc:mga0a205_148071_c1 3300050515 Bacteria 1013
401 nmdc:mga0a205_375766_c1 3300050515 Bacteria 1287
402 nmdc:mga0a205_59708_c1 3300050515 Bacteria 3684
403 Ga0501082_0059543 3300060353 Bacteria 3291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042000 Ga0439437_025674 Ga0439437_025674_17_679 183
2 3300050508 nmdc:mga09592_345159_c1 nmdc:mga09592_345159_c1_11_700 185
3 3300050512 nmdc:mga0n895_458917_c1 nmdc:mga0n895_458917_c1_299_1096 195
4 3300006871 Ga0075434_100632596 Ga0075434_1006325961 199
5 3300005440 Ga0070705_100405510 Ga0070705_1004055102 201
6 3300005444 Ga0070694_100510505 Ga0070694_1005105051 201
7 3300005468 Ga0070707_100426366 Ga0070707_1004263662 201
8 3300005546 Ga0070696_100243002 Ga0070696_1002430021 201
9 3300005617 Ga0068859_100264634 Ga0068859_1002646341 201
10 3300005618 Ga0068864_100097665 Ga0068864_1000976653 201
11 3300005842 Ga0068858_100197023 Ga0068858_1001970232 201
12 3300005843 Ga0068860_100244268 Ga0068860_1002442682 201
13 3300005844 Ga0068862_100003064 Ga0068862_10000306419 201
14 3300006931 Ga0097620_100264654 Ga0097620_1002646542 201
15 3300009148 Ga0105243_10838251 Ga0105243_108382511 201
16 3300013306 Ga0163162_10150017 Ga0163162_101500171 201
17 3300013308 Ga0157375_10829822 Ga0157375_108298221 201
18 3300025917 Ga0207660_10354806 Ga0207660_103548061 201
19 3300025922 Ga0207646_10438045 Ga0207646_104380451 201
20 3300025923 Ga0207681_10310420 Ga0207681_103104202 201
21 3300026035 Ga0207703_10114979 Ga0207703_101149793 201
22 3300026089 Ga0207648_10161569 Ga0207648_101615692 201
23 3300026095 Ga0207676_10188898 Ga0207676_101888982 201
24 3300026118 Ga0207675_100495404 Ga0207675_1004954042 201
25 3300028380 Ga0268265_10081718 Ga0268265_100817181 201
26 3300028381 Ga0268264_10181099 Ga0268264_101810992 201
27 3300005549 Ga0070704_100385028 Ga0070704_1003850282 203
28 3300005843 Ga0068860_100144311 Ga0068860_1001443113 203
29 3300009553 Ga0105249_10344306 Ga0105249_103443062 203
30 3300025961 Ga0207712_10204967 Ga0207712_102049672 203
31 3300005545 Ga0070695_100455940 Ga0070695_1004559401 205
32 3300005937 Ga0081455_10000163 Ga0081455_100001631 205
33 3300006844 Ga0075428_100089903 Ga0075428_1000899034 207
34 3300006852 Ga0075433_10118644 Ga0075433_101186442 207
35 3300006871 Ga0075434_100275614 Ga0075434_1002756142 207
36 3300006914 Ga0075436_100001034 Ga0075436_10000103417 207
37 3300007076 Ga0075435_100128510 Ga0075435_1001285102 207
38 3300009094 Ga0111539_10570637 Ga0111539_105706372 207
39 3300050508 nmdc:mga09592_76432_c1 nmdc:mga09592_76432_c1_1287_2033 207
40 3300050509 nmdc:mga0qj67_47355_c1 nmdc:mga0qj67_47355_c1_1707_2453 207
41 3300050510 nmdc:mga06r32_67037_c1 nmdc:mga06r32_67037_c1_21_767 207
42 3300050512 nmdc:mga0n895_113549_c1 nmdc:mga0n895_113549_c1_470_1216 207
43 3300050513 nmdc:mga0rr50_24246_c1 nmdc:mga0rr50_24246_c1_2167_2913 207
44 3300005617 Ga0068859_100939492 Ga0068859_1009394921 208
45 3300006931 Ga0097620_100939431 Ga0097620_1009394311 208
46 3300009177 Ga0105248_10042119 Ga0105248_100421195 208
47 3300025941 Ga0207711_10049665 Ga0207711_100496653 208
48 3300005444 Ga0070694_100018074 Ga0070694_1000180744 209
49 3300030880 Ga0265776_100450 Ga0265776_1004502 209
50 3300009147 Ga0114129_10638187 Ga0114129_106381872 212
51 3300044712 Ga0453684_0244926 Ga0453684_0244926_479_1276 212
52 3300005330 Ga0070690_100220263 Ga0070690_1002202631 213
53 3300005335 Ga0070666_10392850 Ga0070666_103928501 213
54 3300005353 Ga0070669_100343100 Ga0070669_1003431001 213
55 3300005355 Ga0070671_100548774 Ga0070671_1005487741 213
56 3300005356 Ga0070674_100499859 Ga0070674_1004998591 213
57 3300005364 Ga0070673_100513103 Ga0070673_1005131031 213
58 3300005456 Ga0070678_100105207 Ga0070678_1001052072 213
59 3300005457 Ga0070662_100192499 Ga0070662_1001924992 213
60 3300005544 Ga0070686_100119739 Ga0070686_1001197392 213
61 3300006881 Ga0068865_100090998 Ga0068865_1000909982 213
62 3300013297 Ga0157378_10039103 Ga0157378_100391031 213
63 3300025903 Ga0207680_10173129 Ga0207680_101731291 213
64 3300025923 Ga0207681_10282680 Ga0207681_102826802 213
65 3300025931 Ga0207644_10133511 Ga0207644_101335112 213
66 3300025933 Ga0207706_10260533 Ga0207706_102605332 213
67 3300025960 Ga0207651_10391269 Ga0207651_103912691 213
68 3300006847 Ga0075431_100696767 Ga0075431_1006967671 214
69 3300006844 Ga0075428_100526073 Ga0075428_1005260732 215
70 3300031344 Ga0265316_10000905 Ga0265316_100009058 215
71 3300006871 Ga0075434_100097413 Ga0075434_1000974134 216
72 3300006844 Ga0075428_100562768 Ga0075428_1005627682 218
73 3300006880 Ga0075429_100500793 Ga0075429_1005007932 218
74 3300031250 Ga0265331_10000818 Ga0265331_100008183 218
75 3300031251 Ga0265327_10000374 Ga0265327_1000037478 218
76 3300031251 Ga0265327_10048419 Ga0265327_100484191 218
77 3300044712 Ga0453684_0000120 Ga0453684_0000120_258972_259715 218
78 3300050507 nmdc:mga05p37_427904_c1 nmdc:mga05p37_427904_c1_20_808 218
79 3300050509 nmdc:mga0qj67_329537_c1 nmdc:mga0qj67_329537_c1_247_1035 218
80 3300050511 nmdc:mga08y16_229509_c1 nmdc:mga08y16_229509_c1_195_983 218
81 3300005331 Ga0070670_100002385 Ga0070670_1000023853 219
82 3300005335 Ga0070666_10045629 Ga0070666_100456293 219
83 3300005336 Ga0070680_100000809 Ga0070680_10000080913 219
84 3300005337 Ga0070682_100002806 Ga0070682_1000028067 219
85 3300005339 Ga0070660_100000092 Ga0070660_10000009245 219
86 3300005341 Ga0070691_10003350 Ga0070691_100033502 219
87 3300005344 Ga0070661_100000504 Ga0070661_10000050427 219
88 3300005345 Ga0070692_10000191 Ga0070692_100001913 219
89 3300005353 Ga0070669_100047457 Ga0070669_1000474571 219
90 3300005364 Ga0070673_100012119 Ga0070673_1000121191 219
91 3300005366 Ga0070659_100002620 Ga0070659_1000026207 219
92 3300005406 Ga0070703_10015098 Ga0070703_100150981 219
93 3300005440 Ga0070705_100000097 Ga0070705_10000009726 219
94 3300005441 Ga0070700_100329043 Ga0070700_1003290431 219
95 3300005444 Ga0070694_100001563 Ga0070694_10000156312 219
96 3300005445 Ga0070708_100011105 Ga0070708_1000111051 219
97 3300005445 Ga0070708_100051994 Ga0070708_1000519943 219
98 3300005455 Ga0070663_100002707 Ga0070663_1000027079 219
99 3300005458 Ga0070681_10010120 Ga0070681_100101205 219
100 3300005459 Ga0068867_100000688 Ga0068867_1000006887 219
101 3300005518 Ga0070699_100041701 Ga0070699_1000417014 219
102 3300005518 Ga0070699_100064559 Ga0070699_1000645592 219
103 3300005530 Ga0070679_100008626 Ga0070679_1000086267 219
104 3300005536 Ga0070697_100033153 Ga0070697_1000331533 219
105 3300005543 Ga0070672_100368912 Ga0070672_1003689122 219
106 3300005545 Ga0070695_100000993 Ga0070695_10000099313 219
107 3300005546 Ga0070696_100005347 Ga0070696_1000053474 219
108 3300005547 Ga0070693_100001195 Ga0070693_1000011957 219
109 3300005549 Ga0070704_100000208 Ga0070704_1000002087 219
110 3300005563 Ga0068855_100010964 Ga0068855_1000109647 219
111 3300005564 Ga0070664_100004517 Ga0070664_1000045176 219
112 3300005578 Ga0068854_100000476 Ga0068854_1000004765 219
113 3300005614 Ga0068856_100001410 Ga0068856_1000014107 219
114 3300005617 Ga0068859_100002814 Ga0068859_1000028142 219
115 3300005618 Ga0068864_100002975 Ga0068864_1000029753 219
116 3300005719 Ga0068861_100006127 Ga0068861_1000061271 219
117 3300005840 Ga0068870_10000045 Ga0068870_1000004527 219
118 3300005841 Ga0068863_100017688 Ga0068863_1000176881 219
119 3300005843 Ga0068860_100114815 Ga0068860_1001148152 219
120 3300005844 Ga0068862_100005357 Ga0068862_1000053576 219
121 3300006163 Ga0070715_10053625 Ga0070715_100536251 219
122 3300006852 Ga0075433_10006736 Ga0075433_100067363 219
123 3300006852 Ga0075433_10012168 Ga0075433_100121683 219
124 3300006871 Ga0075434_100014861 Ga0075434_1000148615 219
125 3300006914 Ga0075436_100357986 Ga0075436_1003579861 219
126 3300006931 Ga0097620_100002815 Ga0097620_1000028152 219
127 3300007076 Ga0075435_100012625 Ga0075435_1000126253 219
128 3300009147 Ga0114129_10184770 Ga0114129_101847702 219
129 3300009148 Ga0105243_10043120 Ga0105243_100431202 219
130 3300009177 Ga0105248_10291419 Ga0105248_102914192 219
131 3300011119 Ga0105246_10069400 Ga0105246_100694002 219
132 3300013100 Ga0157373_10000370 Ga0157373_1000037015 219
133 3300013104 Ga0157370_10122682 Ga0157370_101226822 219
134 3300013105 Ga0157369_10349779 Ga0157369_103497791 219
135 3300013307 Ga0157372_10000772 Ga0157372_1000077230 219
136 3300013308 Ga0157375_10024905 Ga0157375_100249052 219
137 3300014325 Ga0163163_10331142 Ga0163163_103311422 219
138 3300014745 Ga0157377_10111140 Ga0157377_101111402 219
139 3300020081 Ga0206354_10441266 Ga0206354_104412661 219
140 3300020082 Ga0206353_11952120 Ga0206353_119521202 219
141 3300025903 Ga0207680_10051335 Ga0207680_100513353 219
142 3300025907 Ga0207645_10000264 Ga0207645_1000026437 219
143 3300025908 Ga0207643_10000077 Ga0207643_1000007727 219
144 3300025910 Ga0207684_10007337 Ga0207684_100073376 219
145 3300025911 Ga0207654_10006329 Ga0207654_100063295 219
146 3300025912 Ga0207707_10000234 Ga0207707_1000023450 219
147 3300025917 Ga0207660_10000890 Ga0207660_1000089017 219
148 3300025919 Ga0207657_10000419 Ga0207657_100004196 219
149 3300025920 Ga0207649_10001621 Ga0207649_100016215 219
150 3300025921 Ga0207652_10000306 Ga0207652_1000030626 219
151 3300025923 Ga0207681_10061950 Ga0207681_100619503 219
152 3300025926 Ga0207659_10112943 Ga0207659_101129431 219
153 3300025932 Ga0207690_10030316 Ga0207690_100303163 219
154 3300025933 Ga0207706_10071756 Ga0207706_100717562 219
155 3300025935 Ga0207709_10063526 Ga0207709_100635262 219
156 3300025942 Ga0207689_10000138 Ga0207689_1000013837 219
157 3300025945 Ga0207679_10282828 Ga0207679_102828281 219
158 3300025949 Ga0207667_10000287 Ga0207667_1000028758 219
159 3300025960 Ga0207651_10081789 Ga0207651_100817891 219
160 3300025981 Ga0207640_10084505 Ga0207640_100845051 219
161 3300026067 Ga0207678_10055685 Ga0207678_100556853 219
162 3300026075 Ga0207708_10308230 Ga0207708_103082302 219
163 3300026078 Ga0207702_10004757 Ga0207702_100047572 219
164 3300026088 Ga0207641_10127250 Ga0207641_101272502 219
165 3300026089 Ga0207648_10001989 Ga0207648_1000198917 219
166 3300026116 Ga0207674_10000315 Ga0207674_1000031545 219
167 3300026118 Ga0207675_100008653 Ga0207675_1000086536 219
168 3300028380 Ga0268265_10008458 Ga0268265_100084583 219
169 3300028381 Ga0268264_10088729 Ga0268264_100887292 219
170 3300035091 Ga0373951_0023536 Ga0373951_0023536_627_1406 219
171 3300042005 Ga0439448_0000436 Ga0439448_0000436_7849_8628 219
172 3300042012 Ga0439455_0015411 Ga0439455_0015411_472_1251 219
173 3300042157 Ga0439458_0006098 Ga0439458_0006098_1060_1839 219
174 3300042438 Ga0439459_0000723 Ga0439459_0000723_1374_2153 219
175 3300042876 Ga0451577_0012719 Ga0451577_0012719_444_1223 219
176 3300045051 Ga0451576_0015951 Ga0451576_0015951_4443_5222 219
177 3300045051 Ga0451576_0017518 Ga0451576_0017518_4109_4888 219
178 3300048909 Ga0496106_0015588 Ga0496106_0015588_4627_5406 219
179 3300049583 Ga0501067_0246948 Ga0501067_0246948_203_982 219
180 3300050507 nmdc:mga05p37_103470_c1 nmdc:mga05p37_103470_c1_1312_2091 219
181 3300050507 nmdc:mga05p37_50236_c1 nmdc:mga05p37_50236_c1_4163_4942 219
182 3300050512 nmdc:mga0n895_17777_c1 nmdc:mga0n895_17777_c1_4289_5068 219
183 3300050513 nmdc:mga0rr50_279947_c1 nmdc:mga0rr50_279947_c1_307_1086 219
184 3300050515 nmdc:mga0a205_59708_c1 nmdc:mga0a205_59708_c1_1409_2188 219
185 3300005468 Ga0070707_100193350 Ga0070707_1001933502 220
186 3300005937 Ga0081455_10086681 Ga0081455_100866813 220
187 3300005981 Ga0081538_10086098 Ga0081538_100860982 220
188 3300044712 Ga0453684_0864811 Ga0453684_0864811_11_727 220
189 3300049575 Ga0501039_0185567 Ga0501039_0185567_800_1570 220
190 3300049576 Ga0501040_0016137 Ga0501040_0016137_1641_2411 220
191 3300049576 Ga0501040_0017330 Ga0501040_0017330_3446_4225 220
192 3300049578 Ga0501042_0076198 Ga0501042_0076198_1008_1787 220
193 3300049591 Ga0501075_0091342 Ga0501075_0091342_586_1356 220
194 3300049741 Ga0501079_0595780 Ga0501079_0595780_50_829 220
195 3300005336 Ga0070680_100388844 Ga0070680_1003888441 221
196 3300005843 Ga0068860_100285245 Ga0068860_1002852452 221
197 3300025917 Ga0207660_10362370 Ga0207660_103623701 221
198 3300028381 Ga0268264_10324176 Ga0268264_103241761 221
199 3300028563 Ga0265319_1001461 Ga0265319_10014612 221
200 3300028563 Ga0265319_1042419 Ga0265319_10424192 221
201 3300028577 Ga0265318_10000099 Ga0265318_1000009920 221
202 3300028577 Ga0265318_10009086 Ga0265318_100090864 221
203 3300031235 Ga0265330_10020202 Ga0265330_100202022 221
204 3300031235 Ga0265330_10139927 Ga0265330_101399271 221
205 3300031241 Ga0265325_10141201 Ga0265325_101412012 221
206 3300031242 Ga0265329_10015697 Ga0265329_100156973 221
207 3300031250 Ga0265331_10000112 Ga0265331_1000011252 221
208 3300031344 Ga0265316_10000051 Ga0265316_1000005144 221
209 3300031595 Ga0265313_10005672 Ga0265313_100056728 221
210 3300031711 Ga0265314_10015100 Ga0265314_100151007 221
211 3300031712 Ga0265342_10000359 Ga0265342_1000035944 221
212 3300042001 Ga0439441_001369 Ga0439441_001369_980_1756 221
213 3300005295 Ga0065707_10184678 Ga0065707_101846782 222
214 3300006844 Ga0075428_100412890 Ga0075428_1004128902 222
215 3300050507 nmdc:mga05p37_469833_c1 nmdc:mga05p37_469833_c1_471_1217 222
216 3300050512 nmdc:mga0n895_918380_c1 nmdc:mga0n895_918380_c1_99_845 222
217 3300006914 Ga0075436_100586457 Ga0075436_1005864571 223
218 3300021388 Ga0213875_10000361 Ga0213875_100003616 223
219 3300037853 Ga0436364_0717863 Ga0436364_0717863_38344_39096 223
220 3300044712 Ga0453684_1012116 Ga0453684_1012116_136_870 223
221 3300045051 Ga0451576_0984228 Ga0451576_0984228_105_857 223
222 3300049585 Ga0501069_0063103 Ga0501069_0063103_902_1642 223
223 3300049586 Ga0501070_0089861 Ga0501070_0089861_1448_2188 223
224 3300049742 Ga0501080_0417167 Ga0501080_0417167_160_900 223
225 3300049744 Ga0501083_0026933 Ga0501083_0026933_512_1252 223
226 3300060353 Ga0501082_0059543 Ga0501082_0059543_534_1274 223
227 3300028563 Ga0265319_1004033 Ga0265319_10040334 224
228 3300028577 Ga0265318_10018455 Ga0265318_100184553 224
229 3300028653 Ga0265323_10001525 Ga0265323_100015254 224
230 3300028654 Ga0265322_10002509 Ga0265322_100025097 224
231 3300031240 Ga0265320_10060274 Ga0265320_100602742 224
232 3300031242 Ga0265329_10003326 Ga0265329_100033262 224
233 3300031344 Ga0265316_10004568 Ga0265316_1000456813 224
234 3300031344 Ga0265316_10015691 Ga0265316_100156912 224
235 3300031712 Ga0265342_10038983 Ga0265342_100389834 224
236 3300005548 Ga0070665_100769581 Ga0070665_1007695811 225
237 3300009093 Ga0105240_10275480 Ga0105240_102754802 225
238 3300009098 Ga0105245_10239126 Ga0105245_102391262 225
239 3300009545 Ga0105237_10417056 Ga0105237_104170562 225
240 3300025932 Ga0207690_10469094 Ga0207690_104690941 225
241 3300026089 Ga0207648_10042800 Ga0207648_100428002 225
242 3300030762 Ga0265775_101401 Ga0265775_1014011 225
243 3300031344 Ga0265316_10063685 Ga0265316_100636852 225
244 3300044712 Ga0453684_0471279 Ga0453684_0471279_152_916 225
245 3300045051 Ga0451576_0084256 Ga0451576_0084256_649_1413 225
246 3300009093 Ga0105240_10526141 Ga0105240_105261412 226
247 3300025913 Ga0207695_10364587 Ga0207695_103645872 226
248 3300026041 Ga0207639_10684492 Ga0207639_106844921 226
249 3300031548 Ga0307408_100171258 Ga0307408_1001712582 226
250 3300042876 Ga0451577_0050250 Ga0451577_0050250_1980_2810 226
251 3300044712 Ga0453684_0001435 Ga0453684_0001435_17690_18520 226
252 3300009094 Ga0111539_10287651 Ga0111539_102876512 227
253 3300011119 Ga0105246_10305267 Ga0105246_103052672 227
254 3300013308 Ga0157375_10229470 Ga0157375_102294701 227
255 3300014325 Ga0163163_10081752 Ga0163163_100817523 227
256 3300014968 Ga0157379_10190545 Ga0157379_101905452 227
257 3300028653 Ga0265323_10000006 Ga0265323_1000000650 227
258 3300028654 Ga0265322_10000464 Ga0265322_1000046410 227
259 3300028800 Ga0265338_10126728 Ga0265338_101267282 227
260 3300031344 Ga0265316_10023076 Ga0265316_100230764 227
261 3300031344 Ga0265316_10050933 Ga0265316_100509334 227
262 3300031712 Ga0265342_10007793 Ga0265342_100077932 227
263 3300042008 Ga0439450_052839 Ga0439450_052839_71_829 227
264 3300044673 Ga0453683_0135827 Ga0453683_0135827_177_929 227
265 3300050507 nmdc:mga05p37_369889_c2 nmdc:mga05p37_369889_c2_543_1295 227
266 3300050508 nmdc:mga09592_37308_c1 nmdc:mga09592_37308_c1_2195_2947 227
267 3300050509 nmdc:mga0qj67_94358_c1 nmdc:mga0qj67_94358_c1_396_1148 227
268 3300050511 nmdc:mga08y16_236681_c1 nmdc:mga08y16_236681_c1_795_1553 227
269 3300050512 nmdc:mga0n895_188583_c1 nmdc:mga0n895_188583_c1_829_1581 227
270 3300050515 nmdc:mga0a205_375766_c1 nmdc:mga0a205_375766_c1_57_809 227
271 3300028563 Ga0265319_1005826 Ga0265319_10058262 228
272 3300028577 Ga0265318_10000041 Ga0265318_1000004175 228
273 3300031235 Ga0265330_10000093 Ga0265330_1000009333 228
274 3300031235 Ga0265330_10002008 Ga0265330_1000200810 228
275 3300031238 Ga0265332_10000099 Ga0265332_1000009960 228
276 3300031239 Ga0265328_10000018 Ga0265328_1000001874 228
277 3300031240 Ga0265320_10008162 Ga0265320_100081629 228
278 3300031241 Ga0265325_10032965 Ga0265325_100329652 228
279 3300031242 Ga0265329_10000017 Ga0265329_1000001754 228
280 3300031249 Ga0265339_10042743 Ga0265339_100427433 228
281 3300031250 Ga0265331_10000274 Ga0265331_1000027413 228
282 3300031344 Ga0265316_10000029 Ga0265316_10000029102 228
283 3300031344 Ga0265316_10009616 Ga0265316_1000961613 228
284 3300031456 Ga0307513_10054297 Ga0307513_100542972 228
285 3300031711 Ga0265314_10000868 Ga0265314_1000086818 228
286 3300031712 Ga0265342_10000370 Ga0265342_1000037020 228
287 3300031712 Ga0265342_10173838 Ga0265342_101738382 228
288 3300044712 Ga0453684_0039527 Ga0453684_0039527_3810_4571 228
289 3300005530 Ga0070679_100103195 Ga0070679_1001031954 229
290 3300006844 Ga0075428_100123196 Ga0075428_1001231962 229
291 3300006847 Ga0075431_100025754 Ga0075431_1000257543 229
292 3300006880 Ga0075429_100277262 Ga0075429_1002772622 229
293 3300009093 Ga0105240_10051445 Ga0105240_100514455 229
294 3300025921 Ga0207652_10078377 Ga0207652_100783774 229
295 3300042876 Ga0451577_0000183 Ga0451577_0000183_20079_20861 229
296 3300044712 Ga0453684_0000697 Ga0453684_0000697_97343_98125 229
297 3300045051 Ga0451576_0003288 Ga0451576_0003288_9103_9885 229
298 3300050510 nmdc:mga06r32_371343_c1 nmdc:mga06r32_371343_c1_573_1331 229
299 3300006852 Ga0075433_10087891 Ga0075433_100878915 230
300 3300006871 Ga0075434_100077755 Ga0075434_1000777552 230
301 3300007076 Ga0075435_100066334 Ga0075435_1000663343 230
302 3300007076 Ga0075435_100386001 Ga0075435_1003860011 230
303 3300009094 Ga0111539_10846027 Ga0111539_108460271 230
304 3300031238 Ga0265332_10011651 Ga0265332_100116512 230
305 3300031711 Ga0265314_10005814 Ga0265314_100058148 230
306 3300031711 Ga0265314_10012852 Ga0265314_100128522 230
307 3300045051 Ga0451576_0021484 Ga0451576_0021484_1995_2750 230
308 3300050511 nmdc:mga08y16_411400_c1 nmdc:mga08y16_411400_c1_147_935 230
309 3300050515 nmdc:mga0a205_148071_c1 nmdc:mga0a205_148071_c1_55_843 230
310 3300031239 Ga0265328_10067415 Ga0265328_100674151 231
311 3300005843 Ga0068860_100230282 Ga0068860_1002302822 232
312 3300028800 Ga0265338_10067171 Ga0265338_100671712 232
313 3300028573 Ga0265334_10029783 Ga0265334_100297832 233
314 3300028653 Ga0265323_10006846 Ga0265323_100068465 233
315 3300031242 Ga0265329_10000467 Ga0265329_100004674 233
316 3300031344 Ga0265316_10000079 Ga0265316_1000007972 233
317 3300031712 Ga0265342_10060640 Ga0265342_100606402 233
318 3300044712 Ga0453684_0442572 Ga0453684_0442572_340_1104 233
319 3300005445 Ga0070708_100074745 Ga0070708_1000747455 234
320 3300005458 Ga0070681_10109431 Ga0070681_101094314 234
321 3300005468 Ga0070707_100147050 Ga0070707_1001470505 234
322 3300005530 Ga0070679_100226091 Ga0070679_1002260911 234
323 3300005564 Ga0070664_100311470 Ga0070664_1003114701 234
324 3300006058 Ga0075432_10096870 Ga0075432_100968701 234
325 3300006194 Ga0075427_10012833 Ga0075427_100128331 234
326 3300006871 Ga0075434_100082333 Ga0075434_1000823333 234
327 3300006881 Ga0068865_100245781 Ga0068865_1002457811 234
328 3300009148 Ga0105243_10232706 Ga0105243_102327063 234
329 3300010375 Ga0105239_10544320 Ga0105239_105443202 234
330 3300013296 Ga0157374_10251001 Ga0157374_102510012 234
331 3300025912 Ga0207707_10274719 Ga0207707_102747191 234
332 3300025917 Ga0207660_10191080 Ga0207660_101910801 234
333 3300025922 Ga0207646_10075032 Ga0207646_100750325 234
334 3300028563 Ga0265319_1000075 Ga0265319_100007522 234
335 3300028577 Ga0265318_10001281 Ga0265318_1000128117 234
336 3300028577 Ga0265318_10001439 Ga0265318_1000143910 234
337 3300028653 Ga0265323_10011778 Ga0265323_100117782 234
338 3300028653 Ga0265323_10047223 Ga0265323_100472232 234
339 3300028800 Ga0265338_10057886 Ga0265338_100578863 234
340 3300031235 Ga0265330_10083604 Ga0265330_100836042 234
341 3300031240 Ga0265320_10007148 Ga0265320_100071482 234
342 3300031251 Ga0265327_10102481 Ga0265327_101024811 234
343 3300031344 Ga0265316_10095047 Ga0265316_100950473 234
344 3300031595 Ga0265313_10013614 Ga0265313_100136145 234
345 3300031616 Ga0307508_10000087 Ga0307508_1000008729 234
346 3300031711 Ga0265314_10002169 Ga0265314_1000216918 234
347 3300031711 Ga0265314_10003120 Ga0265314_1000312014 234
348 3300035398 Ga0316574_0098174 Ga0316574_0098174_998_1756 234
349 3300028653 Ga0265323_10009143 Ga0265323_100091432 235
350 3300028653 Ga0265323_10038126 Ga0265323_100381261 235
351 3300028653 Ga0265323_10086864 Ga0265323_100868641 235
352 3300028654 Ga0265322_10032056 Ga0265322_100320561 235
353 3300028800 Ga0265338_10023551 Ga0265338_100235516 235
354 3300028800 Ga0265338_10131007 Ga0265338_101310072 235
355 3300031344 Ga0265316_10000055 Ga0265316_1000005595 235
356 3300031344 Ga0265316_10010693 Ga0265316_100106939 235
357 3300031344 Ga0265316_10028272 Ga0265316_100282722 235
358 3300036457 Ga0265778_006926 Ga0265778_006926_369_1139 235
359 3300044712 Ga0453684_0000436 Ga0453684_0000436_58152_58922 235
360 3300044712 Ga0453684_0051074 Ga0453684_0051074_4427_5197 235
361 3300044712 Ga0453684_0115295 Ga0453684_0115295_2095_2865 235
362 3300045051 Ga0451576_0127917 Ga0451576_0127917_620_1390 235
363 3300045051 Ga0451576_0183421 Ga0451576_0183421_1048_1821 235
364 3300031242 Ga0265329_10024465 Ga0265329_100244652 236
365 3300031344 Ga0265316_10003822 Ga0265316_1000382215 236
366 3300031824 Ga0307413_10321740 Ga0307413_103217401 236
367 3300036401 Ga0373937_0434034 Ga0373937_0434034_176_1033 236
368 3300044712 Ga0453684_0129854 Ga0453684_0129854_974_1855 236
369 3300009093 Ga0105240_10027163 Ga0105240_100271632 237
370 3300028563 Ga0265319_1006057 Ga0265319_10060574 237
371 3300028573 Ga0265334_10026542 Ga0265334_100265421 237
372 3300028577 Ga0265318_10046584 Ga0265318_100465842 237
373 3300031240 Ga0265320_10005809 Ga0265320_100058093 237
374 3300031595 Ga0265313_10074878 Ga0265313_100748781 237
375 3300031711 Ga0265314_10012661 Ga0265314_100126614 237
376 3300042876 Ga0451577_0178840 Ga0451577_0178840_626_1480 237
377 3300044712 Ga0453684_0080348 Ga0453684_0080348_2229_3071 237
378 3300028653 Ga0265323_10001272 Ga0265323_1000127212 238
379 3300028654 Ga0265322_10001687 Ga0265322_100016873 238
380 3300031344 Ga0265316_10123792 Ga0265316_101237922 238
381 3300042876 Ga0451577_0178997 Ga0451577_0178997_137_946 238
382 3300031241 Ga0265325_10018776 Ga0265325_100187762 239
383 3300005577 Ga0068857_100256398 Ga0068857_1002563982 241
384 3300005618 Ga0068864_100931910 Ga0068864_1009319101 241
385 3300009093 Ga0105240_10147950 Ga0105240_101479503 241
386 3300009098 Ga0105245_10054332 Ga0105245_100543322 241
387 3300009177 Ga0105248_10247986 Ga0105248_102479862 241
388 3300009551 Ga0105238_10244081 Ga0105238_102440812 241
389 3300009553 Ga0105249_10124965 Ga0105249_101249652 241
390 3300025231 Ga0207427_100241 Ga0207427_10024129 241
391 3300025913 Ga0207695_10071079 Ga0207695_100710793 241
392 3300025924 Ga0207694_10032464 Ga0207694_100324645 241
393 3300025927 Ga0207687_10011467 Ga0207687_100114675 241
394 3300025961 Ga0207712_10107469 Ga0207712_101074693 241
395 3300026035 Ga0207703_10358501 Ga0207703_103585012 241
396 3300026116 Ga0207674_10095056 Ga0207674_100950564 241
397 3300046529 Ga0495652_0154700 Ga0495652_0154700_665_1459 241
398 3300046678 Ga0495599_0195921 Ga0495599_0195921_91_885 241
399 3300005467 Ga0070706_100507013 Ga0070706_1005070131 242
400 3300028800 Ga0265338_10024134 Ga0265338_100241345 243
401 3300031344 Ga0265316_10089138 Ga0265316_100891381 244
402 3300003322 rootL2_10014713 rootL2_100147132 254
403 3300003323 rootH1_10113966 rootH1_101139662 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

177

252

0.88

PF05239

PRC

PRC-barrel domain

39

114

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o64-assembly1.cif.gz_H from macrocrystals to microcrystals: a strategy for membrane protein serial crystallography 0.8746 10 102
4ac5-assembly1.cif.gz_H lipidic sponge phase crystal structure of the bl. viridis reaction centre solved using serial femtosecond crystallography 0.8718 10 102
1pm3-assembly1.cif.gz_A mth1859 0.8661 153 219
7ddq-assembly1.cif.gz_H structure of rc-lh1-pufx from rhodobacter veldkampii 0.8376 155 226
1dxr-assembly1.cif.gz_H photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex) 0.8187 155 244
ID Description Score Start End Superfamily
1dxrH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.8728 10 102 3.90.50.10
1pm3A00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8661 153 219 2.30.30.240
af_Q9U1X0_63_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8386 23 55 3.50.50.60
af_Q10LU9_128_201_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8329 156 219 2.30.30.240
af_Q58518_6_77_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.817 154 221 2.30.30.240
ID Description Score Start End GO Terms
AF-T1AYK7-F1-model_v4 PRC-barrel domain-containing protein 0.9893 4 108 GO:0019684
GO:0030077
GO:0045156
AF-A0A3N5ZGP3-F1-model_v4 PRC-barrel domain containing protein 0.9726 149 226 GO:0019684
GO:0030077
GO:0045156
AF-A0A0N1KYR8-F1-model_v4 Photosystem reaction center subunit H 0.968 4 108 GO:0019684
GO:0030077
GO:0045156
AF-A0A1M5N331-F1-model_v4 PRC-barrel domain-containing protein 0.9646 4 102 GO:0019684
GO:0030077
GO:0045156
AF-A0A221K752-F1-model_v4 PRC-barrel domain-containing protein 0.9552 4 109 GO:0019684
GO:0030077
GO:0045156

Feature Viewer

pLDDT pTM Quality
83.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map