F435513

General Info

Members Datasets Scaffolds Average Seq Length
403 240 806 255

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0093435|Ga0496124_0093435_178_1089
Length 303
Sequence LSDRGGRAALTETGVPSGDFEPEMMLASEECRDGTTQGLGTRARGPHLFPMTSVASRWPARLWLIRHGQSAGNVARDAAHVAGAERIALDQRDVDVPLSALGERQSQALGRWFAEGEGHGAPDAILCSPYARAHATARLFRDAGGAARSAALCADERLREKEFGILDGLTTAGIAAQIPDQAEFRRLLGKFYHRPPGGESWCDVILRLRSLLDTVSLHYAGQQVMIVAHQVVVLCMRYILEGMSEAEILAIDREGDVANCSVTEYVCDDKGLQLVRYNVTAPMDDDAVATVTAAPDAMVGARA

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
182 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
183 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
184 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
199 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
200 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
213 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
214 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
215 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
216 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
217 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
218 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
219 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
220 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
221 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
222 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
223 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
224 2791355267 Rhizobium sp. L18 Isolate Nodule
225 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
226 2849560528 Caulobacter zeae 410 Isolate Unclassified
227 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
228 2851153111 Caulobacter radicis 736 Isolate Unclassified
229 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
230 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
231 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
232 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
233 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
234 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
235 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
236 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
237 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
238 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
239 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
240 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 34.24
Nodule 0.99
Rhizoplane 2.23
Rhizosphere 52.61
Stem 0
Stem Tuber 0.25
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0093435 3300048927 Bacteria 2448
2 JGI24736J21556_1000150 3300001904 Bacteria 12238
3 JGI24741J21665_1001648 3300001915 Bacteria 6219
4 JGI24740J21852_10008802 3300001979 Bacteria 4001
5 JGI24739J22299_10000517 3300001989 Bacteria 13765
6 JGI24739J22299_10043526 3300001989 Bacteria 1484
7 JGI24735J21928_10000101 3300002067 Bacteria 31877
8 JGI24735J21928_10005265 3300002067 Bacteria 4299
9 JGI24738J21930_10009583 3300002075 Bacteria 2175
10 JGI25153J46596_10000109 3300003215 Bacteria 93661
11 rootH1_10119790 3300003323 Bacteria 1917
12 Ga0055532_1006213 3300003758 Bacteria 1611
13 Ga0055536_1000607 3300003781 Bacteria 24398
14 Ga0055536_1000713 3300003781 Bacteria 22261
15 Ga0055536_1000985 3300003781 Bacteria 18054
16 Ga0055536_1020776 3300003781 Bacteria 2015
17 Ga0055536_1028816 3300003781 Bacteria 1505
18 Ga0055534_1013976 3300003784 Bacteria 1521
19 Ga0055530_10000067 3300003791 Bacteria 92653
20 Ga0055530_10003511 3300003791 Bacteria 8870
21 Ga0055530_10005971 3300003791 Bacteria 5599
22 Ga0055540_1000185 3300003792 Bacteria 60356
23 Ga0055531_10000088 3300003794 Bacteria 100973
24 Ga0055531_10000260 3300003794 Bacteria 55686
25 Ga0055531_10000289 3300003794 Bacteria 50645
26 Ga0055531_10000545 3300003794 Bacteria 33360
27 Ga0055531_10002065 3300003794 Bacteria 13840
28 Ga0055531_10032887 3300003794 Bacteria 1684
29 Ga0055531_10038327 3300003794 Bacteria 1440
30 Ga0065165_1001164 3300005262 Bacteria 30599
31 Ga0065165_1046107 3300005262 Bacteria 1266
32 Ga0065704_10001975 3300005289 Bacteria 9225
33 Ga0065704_10124728 3300005289 Bacteria 1713
34 Ga0065704_10143957 3300005289 Bacteria 1490
35 Ga0065707_10082725 3300005295 Bacteria 12483
36 Ga0070658_10000106 3300005327 Bacteria 74827
37 Ga0070670_100528575 3300005331 Bacteria 1051
38 Ga0070660_100000383 3300005339 Bacteria 29464
39 Ga0070689_100657593 3300005340 Bacteria 912
40 Ga0070668_100016416 3300005347 Bacteria 5536
41 Ga0070668_100028523 3300005347 Bacteria 4237
42 Ga0070669_100022424 3300005353 Bacteria 4513
43 Ga0070671_100215185 3300005355 Bacteria 1630
44 Ga0070659_100168290 3300005366 Bacteria 1794
45 Ga0070667_100000076 3300005367 Bacteria 120555
46 Ga0070667_100158335 3300005367 Bacteria 1993
47 Ga0070705_100176451 3300005440 Bacteria 1443
48 Ga0070708_100135702 3300005445 Bacteria 2279
49 Ga0070665_100703743 3300005548 Bacteria 1023
50 Ga0068855_100092503 3300005563 Bacteria 3488
51 Ga0068855_100218737 3300005563 Bacteria 2137
52 Ga0068855_100720506 3300005563 Bacteria 1066
53 Ga0068857_100005194 3300005577 Bacteria 11079
54 Ga0068854_100018351 3300005578 Bacteria 4696
55 Ga0068856_100181813 3300005614 Bacteria 2116
56 Ga0068856_100524884 3300005614 Bacteria 1205
57 Ga0068852_100001556 3300005616 Bacteria 15590
58 Ga0068852_100001585 3300005616 Bacteria 15462
59 Ga0068852_100041002 3300005616 Bacteria 3910
60 Ga0068859_100038299 3300005617 Bacteria 4811
61 Ga0068863_100015698 3300005841 Bacteria 7271
62 Ga0068860_100000131 3300005843 Bacteria 121109
63 Ga0068860_100005013 3300005843 Bacteria 13481
64 Ga0068860_100006222 3300005843 Bacteria 12002
65 Ga0068862_100000625 3300005844 Bacteria 36732
66 Ga0068862_100000928 3300005844 Bacteria 28369
67 Ga0075368_10000072 3300006042 Bacteria 24174
68 Ga0075368_10000143 3300006042 Bacteria 18920
69 Ga0075363_100030482 3300006048 Bacteria 2793
70 Ga0075363_100034896 3300006048 Bacteria 2628
71 Ga0075363_100204684 3300006048 Bacteria 1128
72 Ga0075364_10016953 3300006051 Bacteria 4540
73 Ga0075362_10000008 3300006177 Bacteria 112391
74 Ga0075362_10014953 3300006177 Bacteria 3146
75 Ga0075362_10116076 3300006177 Bacteria 1264
76 Ga0075362_10158338 3300006177 Bacteria 1089
77 Ga0075367_10000365 3300006178 Bacteria 16314
78 Ga0075367_10001455 3300006178 Bacteria 10205
79 Ga0075369_10000738 3300006186 Bacteria 10607
80 Ga0075369_10006807 3300006186 Bacteria 4338
81 Ga0075366_10000016 3300006195 Bacteria 64473
82 Ga0075366_10016337 3300006195 Bacteria 4265
83 Ga0075366_10091041 3300006195 Bacteria 1827
84 Ga0075366_10161039 3300006195 Bacteria 1360
85 Ga0075366_10196911 3300006195 Bacteria 1225
86 Ga0075366_10242854 3300006195 Bacteria 1098
87 Ga0075370_10000018 3300006353 Bacteria 59800
88 Ga0075370_10012673 3300006353 Bacteria 4463
89 Ga0075370_10020316 3300006353 Bacteria 3628
90 Ga0075370_10032725 3300006353 Bacteria 2908
91 Ga0075370_10037190 3300006353 Bacteria 2736
92 Ga0075370_10083678 3300006353 Bacteria 1836
93 Ga0075370_10130011 3300006353 Bacteria 1469
94 Ga0068871_100112835 3300006358 Bacteria 2288
95 Ga0097620_100038299 3300006931 Bacteria 4811
96 Ga0079104_1014771 3300006946 Bacteria 2342
97 Ga0105240_10003892 3300009093 Bacteria 23054
98 Ga0105240_10008865 3300009093 Bacteria 14316
99 Ga0105240_10049941 3300009093 Bacteria 5276
100 Ga0111539_10497013 3300009094 Bacteria 1421
101 Ga0105242_10014223 3300009176 Bacteria 6162
102 Ga0105248_10027449 3300009177 Bacteria 6339
103 Ga0105237_10413222 3300009545 Bacteria 1354
104 Ga0123342_1004422 3300009766 Bacteria 21471
105 Ga0105239_10001630 3300010375 Bacteria 29606
106 Ga0157373_10110542 3300013100 Bacteria 1932
107 Ga0157373_10529268 3300013100 Bacteria 853
108 Ga0157371_10076545 3300013102 Bacteria 2369
109 Ga0157370_10046826 3300013104 Bacteria 4146
110 Ga0157369_10252886 3300013105 Bacteria 1839
111 Ga0157372_10044362 3300013307 Bacteria 4926
112 Ga0157380_10020349 3300014326 Bacteria 4958
113 Ga0157380_10162785 3300014326 Bacteria 1941
114 Ga0213875_10001149 3300021388 Bacteria 18195
115 Ga0209147_100740 3300025229 Bacteria 16154
116 Ga0209147_101263 3300025229 Bacteria 9908
117 Ga0207425_1000073 3300025245 Bacteria 113233
118 Ga0207425_1012808 3300025245 Bacteria 1955
119 Ga0209129_1000435 3300025258 Bacteria 31097
120 Ga0209565_1000062 3300025263 Bacteria 184007
121 Ga0209565_1007352 3300025263 Bacteria 2981
122 Ga0209673_1014155 3300025273 Bacteria 3101
123 Ga0209675_1000037 3300025291 Bacteria 250958
124 Ga0209675_1000126 3300025291 Bacteria 104792
125 Ga0209676_1000288 3300025292 Bacteria 103217
126 Ga0209676_1000296 3300025292 Bacteria 100635
127 Ga0209676_1000323 3300025292 Bacteria 92049
128 Ga0209676_1000566 3300025292 Bacteria 55814
129 Ga0209676_1000588 3300025292 Bacteria 54210
130 Ga0209676_1019427 3300025292 Bacteria 2339
131 Ga0209025_1000202 3300025294 Bacteria 145750
132 Ga0209025_1019511 3300025294 Bacteria 3766
133 Ga0209025_1034882 3300025294 Bacteria 2286
134 Ga0209564_1000378 3300025295 Bacteria 81676
135 Ga0209758_1000242 3300025297 Bacteria 113233
136 Ga0209758_1015272 3300025297 Bacteria 3994
137 Ga0209050_1000001 3300025298 Bacteria 3563507
138 Ga0209050_1000047 3300025298 Bacteria 380561
139 Ga0209050_1000102 3300025298 Bacteria 229971
140 Ga0209050_1000104 3300025298 Bacteria 228921
141 Ga0209050_1000619 3300025298 Bacteria 55726
142 Ga0209050_1001041 3300025298 Bacteria 34372
143 Ga0209051_1000209 3300025303 Bacteria 102832
144 Ga0209257_1000111 3300025304 Bacteria 234809
145 Ga0209257_1000112 3300025304 Bacteria 234058
146 Ga0209257_1000120 3300025304 Bacteria 223025
147 Ga0209257_1000232 3300025304 Bacteria 130749
148 Ga0209257_1000551 3300025304 Bacteria 64327
149 Ga0209257_1002394 3300025304 Bacteria 18771
150 Ga0209257_1014490 3300025304 Bacteria 3384
151 Ga0209257_1036992 3300025304 Bacteria 1493
152 Ga0207647_10009945 3300025904 Bacteria 6737
153 Ga0207647_10039943 3300025904 Bacteria 2958
154 Ga0207647_10087949 3300025904 Bacteria 1856
155 Ga0207705_10037589 3300025909 Bacteria 3464
156 Ga0207695_10000525 3300025913 Bacteria 81111
157 Ga0207695_10104523 3300025913 Unclassified 2821
158 Ga0207695_10144517 3300025913 Bacteria 2324
159 Ga0207657_10001650 3300025919 Bacteria 24065
160 Ga0207681_10010266 3300025923 Bacteria 5734
161 Ga0207681_10039619 3300025923 Bacteria 3130
162 Ga0207681_10076925 3300025923 Bacteria 2345
163 Ga0207644_10622330 3300025931 Bacteria 897
164 Ga0207690_10456531 3300025932 Bacteria 1028
165 Ga0207706_10021274 3300025933 Bacteria 5827
166 Ga0207706_10087851 3300025933 Bacteria 2734
167 Ga0207711_10218290 3300025941 Bacteria 1743
168 Ga0207689_10337127 3300025942 Bacteria 1252
169 Ga0207667_10149238 3300025949 Bacteria 2406
170 Ga0207667_10574307 3300025949 Bacteria 1139
171 Ga0207667_10716792 3300025949 Bacteria 1002
172 Ga0207712_10001218 3300025961 Bacteria 17746
173 Ga0207712_10266533 3300025961 Bacteria 1391
174 Ga0207668_10038877 3300025972 Bacteria 3197
175 Ga0207668_10047824 3300025972 Bacteria 2931
176 Ga0207640_10019085 3300025981 Bacteria 4043
177 Ga0207640_10058100 3300025981 Bacteria 2547
178 Ga0207658_10000094 3300025986 Bacteria 98638
179 Ga0207658_10127495 3300025986 Bacteria 2039
180 Ga0207702_10011279 3300026078 Bacteria 7449
181 Ga0207641_10012005 3300026088 Bacteria 7107
182 Ga0207674_10009324 3300026116 Bacteria 11236
183 Ga0207674_10037785 3300026116 Bacteria 5017
184 Ga0207698_10000978 3300026142 Bacteria 16625
185 Ga0207698_10031490 3300026142 Bacteria 3828
186 Ga0207698_10060648 3300026142 Bacteria 2943
187 Ga0209813_10000070 3300027866 Bacteria 38898
188 Ga0209813_10000161 3300027866 Bacteria 22357
189 Ga0207428_10021157 3300027907 Bacteria 5509
190 Ga0268265_10000552 3300028380 Bacteria 38141
191 Ga0268265_10092199 3300028380 Bacteria 2424
192 Ga0268264_10000204 3300028381 Bacteria 120959
193 Ga0268264_10004747 3300028381 Bacteria 11541
194 Ga0268264_10038653 3300028381 Bacteria 3939
195 Ga0307513_10114029 3300031456 Bacteria 2689
196 Ga0307408_100241121 3300031548 Bacteria 1486
197 Ga0265314_10000093 3300031711 Bacteria 136857
198 Ga0307413_10650849 3300031824 Bacteria 869
199 Ga0307410_10204953 3300031852 Bacteria 1508
200 Ga0307410_10209809 3300031852 Bacteria 1491
201 Ga0307412_10000483 3300031911 Bacteria 23799
202 Ga0307412_10017489 3300031911 Bacteria 4292
203 Ga0307412_10025389 3300031911 Bacteria 3670
204 Ga0307412_10027719 3300031911 Bacteria 3536
205 Ga0307412_10058016 3300031911 Bacteria 2587
206 Ga0307412_10127899 3300031911 Bacteria 1840
207 Ga0307409_100027415 3300031995 Bacteria 4037
208 Ga0307416_100065235 3300032002 Bacteria 2991
209 Ga0307416_100410948 3300032002 Bacteria 1394
210 Ga0307414_10003948 3300032004 Bacteria 7997
211 Ga0307414_10120383 3300032004 Bacteria 2017
212 Ga0307414_10289380 3300032004 Bacteria 1380
213 Ga0307411_10082503 3300032005 Bacteria 2217
214 Ga0307415_100038402 3300032126 Bacteria 3155
215 Ga0307415_100247703 3300032126 Bacteria 1446
216 Ga0395905_0040294 3300037471 Bacteria 4382
217 Ga0436364_0484549 3300037853 Bacteria 37401
218 Ga0237819_00470 3300038705 Bacteria 13737
219 Ga0436365_0771421 3300039437 Bacteria 2033
220 Ga0436365_0858666 3300039437 Bacteria 1082
221 Ga0439461_0002027 3300041410 Bacteria 3201
222 Ga0439466_0020739 3300041411 Bacteria 2340
223 Ga0451791_1377009 3300041451 Bacteria 1441
224 Ga0451802_0705728 3300041460 Bacteria 2779
225 Ga0439431_0000187 3300041997 Bacteria 12043
226 Ga0439442_022487 3300042002 Bacteria 1308
227 Ga0439445_0000562 3300042004 Bacteria 7575
228 Ga0439432_001968 3300042006 Bacteria 7759
229 Ga0439449_0123133 3300042007 Bacteria 963
230 Ga0439455_0002227 3300042012 Bacteria 3475
231 Ga0439462_0018966 3300042015 Bacteria 1788
232 Ga0439458_0000402 3300042157 Bacteria 10873
233 Ga0439434_0000613 3300042435 Bacteria 10275
234 Ga0439434_0010670 3300042435 Bacteria 2709
235 Ga0450916_004111 3300042530 Bacteria 1628
236 Ga0466972_0011858 3300044658 Bacteria 4378
237 Ga0466965_0155913 3300044683 Bacteria 1195
238 Ga0466966_0025315 3300044684 Bacteria 3877
239 Ga0466961_0010401 3300044693 Bacteria 5938
240 Ga0466961_0132118 3300044693 Bacteria 1564
241 Ga0466963_0013084 3300044694 Bacteria 5089
242 Ga0466971_0021544 3300044719 Bacteria 2867
243 Ga0466970_0008819 3300044765 Bacteria 5081
244 Ga0466957_0022004 3300044842 Bacteria 3760
245 Ga0466957_0026647 3300044842 Bacteria 3431
246 Ga0466959_0047375 3300045049 Bacteria 3161
247 Ga0466958_0016887 3300045836 Bacteria 4211
248 Ga0466967_0024922 3300045976 Bacteria 4925
249 Ga0466967_0069640 3300045976 Bacteria 3145
250 Ga0495627_004492 3300046453 Bacteria 5831
251 Ga0495627_009084 3300046453 Bacteria 3672
252 Ga0495638_0000488 3300046460 Bacteria 47418
253 Ga0495638_0142044 3300046460 Bacteria 1400
254 Ga0495584_0015496 3300046491 Bacteria 3884
255 Ga0495606_0002289 3300046507 Bacteria 22641
256 Ga0495606_0025302 3300046507 Bacteria 4254
257 Ga0495606_0047090 3300046507 Bacteria 2845
258 Ga0495610_0001372 3300046512 Bacteria 21642
259 Ga0495610_0002639 3300046512 Bacteria 14830
260 Ga0495610_0026677 3300046512 Bacteria 3081
261 Ga0495620_0003982 3300046515 Bacteria 8397
262 Ga0495620_0112530 3300046515 Bacteria 1078
263 Ga0495632_0003956 3300046519 Bacteria 10283
264 Ga0495637_0046137 3300046520 Bacteria 1844
265 Ga0495643_0000166 3300046522 Bacteria 104972
266 Ga0495643_0002294 3300046522 Bacteria 15452
267 Ga0495643_0052155 3300046522 Bacteria 2197
268 Ga0495648_0019605 3300046524 Bacteria 4748
269 Ga0495663_0001314 3300046525 Bacteria 7866
270 Ga0495663_0008680 3300046525 Bacteria 2818
271 Ga0495654_0047322 3300046530 Bacteria 2114
272 Ga0495654_0141820 3300046530 Bacteria 1070
273 Ga0495598_0000408 3300046537 Bacteria 7731
274 Ga0495621_0014325 3300046539 Bacteria 2507
275 Ga0495633_0000179 3300046558 Bacteria 82201
276 Ga0495668_0000013 3300046616 Bacteria 452938
277 Ga0495625_0002047 3300046660 Bacteria 22672
278 Ga0495625_0039404 3300046660 Bacteria 3451
279 Ga0495625_0120663 3300046660 Bacteria 1784
280 Ga0495625_0244370 3300046660 Bacteria 1167
281 Ga0495670_0000008 3300046691 Bacteria 219555
282 Ga0495671_0096808 3300046692 Bacteria 1444
283 Ga0495672_0121521 3300047320 Bacteria 1387
284 Ga0495677_0001966 3300047445 Bacteria 8201
285 Ga0495681_0000036 3300047470 Bacteria 124207
286 Ga0495681_0136708 3300047470 Bacteria 1039
287 Ga0495686_0002437 3300047472 Bacteria 17562
288 Ga0495686_0004090 3300047472 Bacteria 12149
289 Ga0495686_0037913 3300047472 Bacteria 3086
290 Ga0496102_0087651 3300048905 Bacteria 2876
291 Ga0496102_0627446 3300048905 Bacteria 998
292 Ga0496103_0088195 3300048906 Bacteria 1956
293 Ga0496108_0003893 3300048911 Bacteria 11988
294 Ga0496115_0376213 3300048918 Bacteria 1156
295 Ga0496117_0023633 3300048920 Bacteria 4891
296 Ga0496118_0007722 3300048921 Bacteria 11305
297 Ga0496118_0129260 3300048921 Bacteria 1626
298 Ga0496120_0018438 3300048923 Bacteria 4499
299 Ga0496121_0002091 3300048924 Bacteria 31505
300 Ga0496121_0005584 3300048924 Bacteria 16063
301 Ga0496123_0092310 3300048926 Bacteria 1792
302 Ga0496124_0002343 3300048927 Bacteria 25006
303 Ga0496124_0004097 3300048927 Bacteria 17235
304 Ga0496124_0052474 3300048927 Bacteria 3463
305 Ga0496124_0233351 3300048927 Bacteria 1374
306 Ga0496125_0096098 3300048928 Bacteria 2201
307 Ga0496125_0112871 3300048928 Bacteria 1962
308 Ga0496126_0510433 3300048929 Bacteria 959
309 Ga0501032_0000611 3300049569 Bacteria 28900
310 Ga0501033_0000215 3300049570 Bacteria 55477
311 Ga0501034_0086197 3300049571 Bacteria 3142
312 Ga0501047_0009954 3300049581 Bacteria 8991
313 Ga0501249_000281 3300049679 Bacteria 14630
314 Ga0501257_000034 3300049686 Bacteria 39265
315 Ga0501241_010381 3300049758 Bacteria 1695
316 Ga0501262_001033 3300049759 Bacteria 3148
317 Ga0501280_000281 3300049776 Bacteria 12966
318 Ga0501282_002947 3300049778 Bacteria 1844
319 Ga0501035_0010438 3300049822 Bacteria 8610
320 Ga0501044_0000160 3300049823 Bacteria 83543
321 nmdc:mga03683_1004_c1 3300050489 Bacteria 8245
322 nmdc:mga03683_10915_c1 3300050489 Bacteria 3269
323 nmdc:mga03683_78766_c1 3300050489 Bacteria 1419
324 nmdc:mga03n38_102801_c1 3300050490 Bacteria 1380
325 nmdc:mga03n38_4079_c1 3300050490 Bacteria 4788
326 nmdc:mga00v17_16005_c1 3300050491 Bacteria 4221
327 nmdc:mga00v17_174154_c1 3300050491 Bacteria 1388
328 nmdc:mga00v17_32532_c1 3300050491 Bacteria 3084
329 nmdc:mga0k408_19843_c1 3300050493 Bacteria 3256
330 nmdc:mga0k408_306487_c1 3300050493 Bacteria 948
331 nmdc:mga06z11_320_c1 3300050494 Bacteria 18232
332 nmdc:mga06z11_88_c1 3300050494 Bacteria 38889
333 nmdc:mga04h51_684_c1 3300050495 Bacteria 7878
334 nmdc:mga04h51_68_c1 3300050495 Bacteria 33109
335 nmdc:mga07m45_101_c1 3300050496 Bacteria 33567
336 nmdc:mga07m45_13_c2 3300050496 Bacteria 88503
337 nmdc:mga07m45_165087_c1 3300050496 Bacteria 1286
338 nmdc:mga07m45_175178_c1 3300050496 Bacteria 1247
339 nmdc:mga07m45_212962_c1 3300050496 Bacteria 1124
340 nmdc:mga07m45_4157_c1 3300050496 Bacteria 7067
341 nmdc:mga07m45_61629_c1 3300050496 Bacteria 2125
342 nmdc:mga0sz30_533_c1 3300050516 Bacteria 14155
343 nmdc:mga0sz30_5947_c1 3300050516 Bacteria 4500
344 Ga0500643_000916 3300053087 Bacteria 18579
345 Ga0500643_005377 3300053087 Bacteria 5534
346 Ga0500644_0043843 3300053088 Bacteria 1499
347 Ga0500651_0067141 3300053093 Bacteria 2233
348 Ga0500562_000818 3300053108 Bacteria 7588
349 Ga0500592_000065 3300053116 Bacteria 28864
350 Ga0500592_013316 3300053116 Bacteria 1319
351 Ga0500607_000036 3300053121 Bacteria 87178
352 Ga0500607_000052 3300053121 Bacteria 80355
353 Ga0500608_038681 3300053122 Bacteria 2283
354 Ga0500658_0000541 3300053134 Bacteria 15952
355 Ga0500658_0000793 3300053134 Bacteria 13099
356 Ga0500658_0234622 3300053134 Bacteria 842
357 Ga0500559_0000751 3300053136 Bacteria 21285
358 Ga0500568_0039742 3300053139 Bacteria 1897
359 Ga0500568_0049250 3300053139 Bacteria 1663
360 Ga0500573_0036513 3300053140 Bacteria 2837
361 Ga0500604_0034348 3300053151 Bacteria 1504
362 Ga0500604_0039600 3300053151 Bacteria 1418
363 Ga0500616_0056042 3300053153 Bacteria 2058
364 Ga0500616_0072819 3300053153 Bacteria 1746
365 Ga0500622_0001014 3300053156 Bacteria 23572
366 Ga0500622_0096478 3300053156 Unclassified 1461
367 Ga0500627_0000052 3300053158 Bacteria 55881
368 Ga0500627_0000086 3300053158 Bacteria 31214
369 Ga0500627_0119235 3300053158 Bacteria 1189
370 Ga0500627_0147461 3300053158 Bacteria 1063
371 Ga0500645_004669 3300053730 Bacteria 5213
372 Ga0466962_0000734 3300061719 Bacteria 14701
373 Ga0466962_0113701 3300061719 Bacteria 1304
374 2511127917 2510917021 Bacteria 5705459
375 2600204192 2599185354 Bacteria 4398675
376 2600224732 2599185359 Bacteria 4772316
377 2643822633 2643221560 Bacteria 4801179
378 2643833288 2643221563 Bacteria 4726935
379 2644054215 2643221608 Bacteria 4724829
380 2644125729 2643221622 Bacteria 4212502
381 2644203865 2643221636 Bacteria 6583769
382 2644498556 2643221689 Bacteria 6042950
383 2715499031 2713897090 Bacteria 3353799
384 2739651376 2739367664 Bacteria 4114334
385 2740029849 2739367865 Bacteria 4114482
386 2793371186 2791355267 Bacteria 7222458
387 2843747450 2843744320 Bacteria 5659202
388 2849565330 2849560528 Bacteria 5393480
389 2849574405 2849573788 Bacteria 5421256
390 2851158213 2851153111 Bacteria 5542585
391 2852656831 2852653556 Bacteria 4050083
392 2852681988 2852680915 Bacteria 4100189
393 2855022894 2855020534 Bacteria 3204685
394 2885430924 2885429604 Bacteria 3642894
395 2895881300 2895880812 Bacteria 11255272
396 2899260118 2899259804 Bacteria 3320927
397 2928972101 2928968154 Bacteria 4633371
398 2946789414 2946787523 Bacteria 4366789
399 2946791683 2946787523 Bacteria 4366789
400 2990267293 2990265787 Bacteria 3943888
401 2993694246 2993693658 Bacteria 4040749
402 3003669067 3003665799 Bacteria 7279786
403 8054303142 8054302542 Bacteria 5698134
404 Ga0496124_0093435
405 JGI24736J21556_1000150
406 JGI24741J21665_1001648
407 JGI24740J21852_10008802
408 JGI24739J22299_10000517
409 JGI24739J22299_10043526
410 JGI24735J21928_10000101
411 JGI24735J21928_10005265
412 JGI24738J21930_10009583
413 JGI25153J46596_10000109
414 rootH1_10119790
415 Ga0055532_1006213
416 Ga0055536_1000607
417 Ga0055536_1000713
418 Ga0055536_1000985
419 Ga0055536_1020776
420 Ga0055536_1028816
421 Ga0055534_1013976
422 Ga0055530_10000067
423 Ga0055530_10003511
424 Ga0055530_10005971
425 Ga0055540_1000185
426 Ga0055531_10000088
427 Ga0055531_10000260
428 Ga0055531_10000289
429 Ga0055531_10000545
430 Ga0055531_10002065
431 Ga0055531_10032887
432 Ga0055531_10038327
433 Ga0065165_1001164
434 Ga0065165_1046107
435 Ga0065704_10001975
436 Ga0065704_10124728
437 Ga0065704_10143957
438 Ga0065707_10082725
439 Ga0070658_10000106
440 Ga0070670_100528575
441 Ga0070660_100000383
442 Ga0070689_100657593
443 Ga0070668_100016416
444 Ga0070668_100028523
445 Ga0070669_100022424
446 Ga0070671_100215185
447 Ga0070659_100168290
448 Ga0070667_100000076
449 Ga0070667_100158335
450 Ga0070705_100176451
451 Ga0070708_100135702
452 Ga0070665_100703743
453 Ga0068855_100092503
454 Ga0068855_100218737
455 Ga0068855_100720506
456 Ga0068857_100005194
457 Ga0068854_100018351
458 Ga0068856_100181813
459 Ga0068856_100524884
460 Ga0068852_100001556
461 Ga0068852_100001585
462 Ga0068852_100041002
463 Ga0068859_100038299
464 Ga0068863_100015698
465 Ga0068860_100000131
466 Ga0068860_100005013
467 Ga0068860_100006222
468 Ga0068862_100000625
469 Ga0068862_100000928
470 Ga0075368_10000072
471 Ga0075368_10000143
472 Ga0075363_100030482
473 Ga0075363_100034896
474 Ga0075363_100204684
475 Ga0075364_10016953
476 Ga0075362_10000008
477 Ga0075362_10014953
478 Ga0075362_10116076
479 Ga0075362_10158338
480 Ga0075367_10000365
481 Ga0075367_10001455
482 Ga0075369_10000738
483 Ga0075369_10006807
484 Ga0075366_10000016
485 Ga0075366_10016337
486 Ga0075366_10091041
487 Ga0075366_10161039
488 Ga0075366_10196911
489 Ga0075366_10242854
490 Ga0075370_10000018
491 Ga0075370_10012673
492 Ga0075370_10020316
493 Ga0075370_10032725
494 Ga0075370_10037190
495 Ga0075370_10083678
496 Ga0075370_10130011
497 Ga0068871_100112835
498 Ga0097620_100038299
499 Ga0079104_1014771
500 Ga0105240_10003892
501 Ga0105240_10008865
502 Ga0105240_10049941
503 Ga0111539_10497013
504 Ga0105242_10014223
505 Ga0105248_10027449
506 Ga0105237_10413222
507 Ga0123342_1004422
508 Ga0105239_10001630
509 Ga0157373_10110542
510 Ga0157373_10529268
511 Ga0157371_10076545
512 Ga0157370_10046826
513 Ga0157369_10252886
514 Ga0157372_10044362
515 Ga0157380_10020349
516 Ga0157380_10162785
517 Ga0213875_10001149
518 Ga0209147_100740
519 Ga0209147_101263
520 Ga0207425_1000073
521 Ga0207425_1012808
522 Ga0209129_1000435
523 Ga0209565_1000062
524 Ga0209565_1007352
525 Ga0209673_1014155
526 Ga0209675_1000037
527 Ga0209675_1000126
528 Ga0209676_1000288
529 Ga0209676_1000296
530 Ga0209676_1000323
531 Ga0209676_1000566
532 Ga0209676_1000588
533 Ga0209676_1019427
534 Ga0209025_1000202
535 Ga0209025_1019511
536 Ga0209025_1034882
537 Ga0209564_1000378
538 Ga0209758_1000242
539 Ga0209758_1015272
540 Ga0209050_1000001
541 Ga0209050_1000047
542 Ga0209050_1000102
543 Ga0209050_1000104
544 Ga0209050_1000619
545 Ga0209050_1001041
546 Ga0209051_1000209
547 Ga0209257_1000111
548 Ga0209257_1000112
549 Ga0209257_1000120
550 Ga0209257_1000232
551 Ga0209257_1000551
552 Ga0209257_1002394
553 Ga0209257_1014490
554 Ga0209257_1036992
555 Ga0207647_10009945
556 Ga0207647_10039943
557 Ga0207647_10087949
558 Ga0207705_10037589
559 Ga0207695_10000525
560 Ga0207695_10104523
561 Ga0207695_10144517
562 Ga0207657_10001650
563 Ga0207681_10010266
564 Ga0207681_10039619
565 Ga0207681_10076925
566 Ga0207644_10622330
567 Ga0207690_10456531
568 Ga0207706_10021274
569 Ga0207706_10087851
570 Ga0207711_10218290
571 Ga0207689_10337127
572 Ga0207667_10149238
573 Ga0207667_10574307
574 Ga0207667_10716792
575 Ga0207712_10001218
576 Ga0207712_10266533
577 Ga0207668_10038877
578 Ga0207668_10047824
579 Ga0207640_10019085
580 Ga0207640_10058100
581 Ga0207658_10000094
582 Ga0207658_10127495
583 Ga0207702_10011279
584 Ga0207641_10012005
585 Ga0207674_10009324
586 Ga0207674_10037785
587 Ga0207698_10000978
588 Ga0207698_10031490
589 Ga0207698_10060648
590 Ga0209813_10000070
591 Ga0209813_10000161
592 Ga0207428_10021157
593 Ga0268265_10000552
594 Ga0268265_10092199
595 Ga0268264_10000204
596 Ga0268264_10004747
597 Ga0268264_10038653
598 Ga0307513_10114029
599 Ga0307408_100241121
600 Ga0265314_10000093
601 Ga0307413_10650849
602 Ga0307410_10204953
603 Ga0307410_10209809
604 Ga0307412_10000483
605 Ga0307412_10017489
606 Ga0307412_10025389
607 Ga0307412_10027719
608 Ga0307412_10058016
609 Ga0307412_10127899
610 Ga0307409_100027415
611 Ga0307416_100065235
612 Ga0307416_100410948
613 Ga0307414_10003948
614 Ga0307414_10120383
615 Ga0307414_10289380
616 Ga0307411_10082503
617 Ga0307415_100038402
618 Ga0307415_100247703
619 Ga0395905_0040294
620 Ga0436364_0484549
621 Ga0237819_00470
622 Ga0436365_0771421
623 Ga0436365_0858666
624 Ga0439461_0002027
625 Ga0439466_0020739
626 Ga0451791_1377009
627 Ga0451802_0705728
628 Ga0439431_0000187
629 Ga0439442_022487
630 Ga0439445_0000562
631 Ga0439432_001968
632 Ga0439449_0123133
633 Ga0439455_0002227
634 Ga0439462_0018966
635 Ga0439458_0000402
636 Ga0439434_0000613
637 Ga0439434_0010670
638 Ga0450916_004111
639 Ga0466972_0011858
640 Ga0466965_0155913
641 Ga0466966_0025315
642 Ga0466961_0010401
643 Ga0466961_0132118
644 Ga0466963_0013084
645 Ga0466971_0021544
646 Ga0466970_0008819
647 Ga0466957_0022004
648 Ga0466957_0026647
649 Ga0466959_0047375
650 Ga0466958_0016887
651 Ga0466967_0024922
652 Ga0466967_0069640
653 Ga0495627_004492
654 Ga0495627_009084
655 Ga0495638_0000488
656 Ga0495638_0142044
657 Ga0495584_0015496
658 Ga0495606_0002289
659 Ga0495606_0025302
660 Ga0495606_0047090
661 Ga0495610_0001372
662 Ga0495610_0002639
663 Ga0495610_0026677
664 Ga0495620_0003982
665 Ga0495620_0112530
666 Ga0495632_0003956
667 Ga0495637_0046137
668 Ga0495643_0000166
669 Ga0495643_0002294
670 Ga0495643_0052155
671 Ga0495648_0019605
672 Ga0495663_0001314
673 Ga0495663_0008680
674 Ga0495654_0047322
675 Ga0495654_0141820
676 Ga0495598_0000408
677 Ga0495621_0014325
678 Ga0495633_0000179
679 Ga0495668_0000013
680 Ga0495625_0002047
681 Ga0495625_0039404
682 Ga0495625_0120663
683 Ga0495625_0244370
684 Ga0495670_0000008
685 Ga0495671_0096808
686 Ga0495672_0121521
687 Ga0495677_0001966
688 Ga0495681_0000036
689 Ga0495681_0136708
690 Ga0495686_0002437
691 Ga0495686_0004090
692 Ga0495686_0037913
693 Ga0496102_0087651
694 Ga0496102_0627446
695 Ga0496103_0088195
696 Ga0496108_0003893
697 Ga0496115_0376213
698 Ga0496117_0023633
699 Ga0496118_0007722
700 Ga0496118_0129260
701 Ga0496120_0018438
702 Ga0496121_0002091
703 Ga0496121_0005584
704 Ga0496123_0092310
705 Ga0496124_0002343
706 Ga0496124_0004097
707 Ga0496124_0052474
708 Ga0496124_0233351
709 Ga0496125_0096098
710 Ga0496125_0112871
711 Ga0496126_0510433
712 Ga0501032_0000611
713 Ga0501033_0000215
714 Ga0501034_0086197
715 Ga0501047_0009954
716 Ga0501249_000281
717 Ga0501257_000034
718 Ga0501241_010381
719 Ga0501262_001033
720 Ga0501280_000281
721 Ga0501282_002947
722 Ga0501035_0010438
723 Ga0501044_0000160
724 nmdc:mga03683_1004_c1
725 nmdc:mga03683_10915_c1
726 nmdc:mga03683_78766_c1
727 nmdc:mga03n38_102801_c1
728 nmdc:mga03n38_4079_c1
729 nmdc:mga00v17_16005_c1
730 nmdc:mga00v17_174154_c1
731 nmdc:mga00v17_32532_c1
732 nmdc:mga0k408_19843_c1
733 nmdc:mga0k408_306487_c1
734 nmdc:mga06z11_320_c1
735 nmdc:mga06z11_88_c1
736 nmdc:mga04h51_684_c1
737 nmdc:mga04h51_68_c1
738 nmdc:mga07m45_101_c1
739 nmdc:mga07m45_13_c2
740 nmdc:mga07m45_165087_c1
741 nmdc:mga07m45_175178_c1
742 nmdc:mga07m45_212962_c1
743 nmdc:mga07m45_4157_c1
744 nmdc:mga07m45_61629_c1
745 nmdc:mga0sz30_533_c1
746 nmdc:mga0sz30_5947_c1
747 Ga0500643_000916
748 Ga0500643_005377
749 Ga0500644_0043843
750 Ga0500651_0067141
751 Ga0500562_000818
752 Ga0500592_000065
753 Ga0500592_013316
754 Ga0500607_000036
755 Ga0500607_000052
756 Ga0500608_038681
757 Ga0500658_0000541
758 Ga0500658_0000793
759 Ga0500658_0234622
760 Ga0500559_0000751
761 Ga0500568_0039742
762 Ga0500568_0049250
763 Ga0500573_0036513
764 Ga0500604_0034348
765 Ga0500604_0039600
766 Ga0500616_0056042
767 Ga0500616_0072819
768 Ga0500622_0001014
769 Ga0500622_0096478
770 Ga0500627_0000052
771 Ga0500627_0000086
772 Ga0500627_0119235
773 Ga0500627_0147461
774 Ga0500645_004669
775 Ga0466962_0000734
776 Ga0466962_0113701
777 2511127917
778 2600204192
779 2600224732
780 2643822633
781 2643833288
782 2644054215
783 2644125729
784 2644203865
785 2644498556
786 2715499031
787 2739651376
788 2740029849
789 2793371186
790 2843747450
791 2849565330
792 2849574405
793 2851158213
794 2852656831
795 2852681988
796 2855022894
797 2885430924
798 2895881300
799 2899260118
800 2928972101
801 2946789414
802 2946791683
803 2990267293
804 2993694246
805 3003669067
806 8054303142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

62

280

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8757 11 240
1tip-assembly1.cif.gz_B the bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 0.86 10 230
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8577 11 238
3qpu-assembly1.cif.gz_A-2 pfkfb3 in complex with ppi 0.8553 11 235
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8544 11 232
ID Description Score Start End Superfamily
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8745 12 212 3.40.50.1240
af_Q54SI2_327_480_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8684 71 198 3.40.50.1240
af_A0A368UGZ2_77_264_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8663 12 234 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8623 12 212 3.40.50.1240
af_A0A1D6QHM8_37_228_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8589 11 222 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A2G1LJM6-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9856 5 230 GO:0006096
GO:0016868
AF-E6J6I2-F1-model_v4 deleted 0.9779 105 234
AF-A0A6I3I9K2-F1-model_v4 Histidine phosphatase family protein 0.9686 4 233 GO:0005737
GO:0016791
AF-A0A4P7SND5-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9682 6 235 GO:0006096
GO:0046538
AF-A0A2S1R6N1-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9674 7 234 GO:0006096
GO:0046538

Map