F435519

General Info

Members Datasets Scaffolds Average Seq Length
403 257 806 328

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0205021|Ga0501031_0205021_138_1187
Length 349
Sequence MVAGNSHPNRIAREEKPMKAMLCKEYGPPETLQLTEVSNPVAGKNQVVVSVKSCGVNFPDFLIIQNKYQFKPALPFAPGAELSGVVKSVGEGVTRFKPGDRVIASVGNGGMAEEVAVDANRLIPMPDSMDFETGSALILTYGTSHYALKDRAKLKPGENLVVLGAAGGVGLAAVELGKAMGARVIAGASSQEKVDLAKKHGADDGFVYPAGSLSRDQQKELSEKIKALTGGNGADVLYDPVGGDYSEPAIRAMNWEGRFLVIGFAAGEIPRIPLNLTLLKSCDVLGVFWGAFTARNPKRNQEHLAEIAQWVAEGKIKPYISARFPLARAGEAIRMLADRKATGKVVVTM

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
101 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
184 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
219 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
220 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
221 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
245 2643221584 Caulobacter sp. Root656 Isolate Unclassified
246 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
247 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
248 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
249 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
250 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
251 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
252 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
253 2849560528 Caulobacter zeae 410 Isolate Unclassified
254 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
255 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
256 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
257 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0.5
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0.74
Rhizoplane 1.99
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0205021 3300049568 Bacteria 1286
2 JGI24739J22299_10009715 3300001989 Unclassified 3579
3 JGI24737J22298_10002072 3300001990 Bacteria 7164
4 JGI25153J46596_10037411 3300003215 Bacteria 1543
5 Ga0055535_1000302 3300003761 Bacteria 50219
6 Ga0055530_10002467 3300003791 Bacteria 11861
7 Ga0055540_1010214 3300003792 Bacteria 3142
8 Ga0055531_10001198 3300003794 Bacteria 19883
9 Ga0065165_1000856 3300005262 Bacteria 39851
10 Ga0070658_10042447 3300005327 Bacteria 3673
11 Ga0070683_100195589 3300005329 Bacteria 1920
12 Ga0070670_100050545 3300005331 Bacteria 3572
13 Ga0070666_10187623 3300005335 Bacteria 1452
14 Ga0070680_100001763 3300005336 Bacteria 15903
15 Ga0070660_100152719 3300005339 Bacteria 1857
16 Ga0070691_10018710 3300005341 Bacteria 3194
17 Ga0070661_100004939 3300005344 Bacteria 9181
18 Ga0070661_100099689 3300005344 Bacteria 2159
19 Ga0070692_10005830 3300005345 Bacteria 5297
20 Ga0070668_100015975 3300005347 Bacteria 5616
21 Ga0070659_100019616 3300005366 Bacteria 5128
22 Ga0070667_100038059 3300005367 Bacteria 4033
23 Ga0070709_10115121 3300005434 Bacteria 1813
24 Ga0070714_100123467 3300005435 Bacteria 2306
25 Ga0070714_100127009 3300005435 Bacteria 2275
26 Ga0070713_100063732 3300005436 Bacteria 3092
27 Ga0070710_10032567 3300005437 Bacteria 2825
28 Ga0070708_100015835 3300005445 Bacteria 6236
29 Ga0070681_10000010 3300005458 Bacteria 140126
30 Ga0070681_10053948 3300005458 Bacteria 4005
31 Ga0070679_100001260 3300005530 Bacteria 22333
32 Ga0070679_100088097 3300005530 Bacteria 3091
33 Ga0070679_100148438 3300005530 Bacteria 2322
34 Ga0068853_100124503 3300005539 Bacteria 2302
35 Ga0070665_100001428 3300005548 Bacteria 28009
36 Ga0068855_100000034 3300005563 Bacteria 166436
37 Ga0068855_100000490 3300005563 Bacteria 48844
38 Ga0068855_100006061 3300005563 Bacteria 14745
39 Ga0068855_100121171 3300005563 Bacteria 2994
40 Ga0068855_100144802 3300005563 Bacteria 2706
41 Ga0068857_100011589 3300005577 Bacteria 7671
42 Ga0068854_100031770 3300005578 Unclassified 3671
43 Ga0068856_100013401 3300005614 Bacteria 7938
44 Ga0068852_100025059 3300005616 Bacteria 4828
45 Ga0068852_100184077 3300005616 Bacteria 1966
46 Ga0068852_100422848 3300005616 Bacteria 1315
47 Ga0068859_100025638 3300005617 Bacteria 5913
48 Ga0068861_100035817 3300005719 Bacteria 3679
49 Ga0068863_100051967 3300005841 Bacteria 3884
50 Ga0068860_100000066 3300005843 Bacteria 182836
51 Ga0068860_100061951 3300005843 Bacteria 3555
52 Ga0068862_100001593 3300005844 Bacteria 20666
53 Ga0068862_100037517 3300005844 Bacteria 4107
54 Ga0070716_100046003 3300006173 Bacteria 2453
55 Ga0097621_100227287 3300006237 Bacteria 1628
56 Ga0068871_100110552 3300006358 Bacteria 2311
57 Ga0075428_100089991 3300006844 Bacteria 3347
58 Ga0075430_100007022 3300006846 Bacteria 9496
59 Ga0068865_100000753 3300006881 Bacteria 18176
60 Ga0097620_100025640 3300006931 Bacteria 5913
61 Ga0099794_10061268 3300007265 Bacteria 1828
62 Ga0099795_10000212 3300007788 Bacteria 10035
63 Ga0105240_10000382 3300009093 Bacteria 83108
64 Ga0105240_10000428 3300009093 Bacteria 77995
65 Ga0105240_10005701 3300009093 Bacteria 18483
66 Ga0105240_10028281 3300009093 Bacteria 7323
67 Ga0105240_10035240 3300009093 Bacteria 6450
68 Ga0105240_10086484 3300009093 Bacteria 3839
69 Ga0105240_10210680 3300009093 Bacteria 2271
70 Ga0105240_10605917 3300009093 Bacteria 1205
71 Ga0105245_10000136 3300009098 Bacteria 69874
72 Ga0105247_10023648 3300009101 Bacteria 3703
73 Ga0114129_10003541 3300009147 Bacteria 21982
74 Ga0114129_10269064 3300009147 Bacteria 2281
75 Ga0114129_10400322 3300009147 Bacteria 1809
76 Ga0114129_10418790 3300009147 Bacteria 1762
77 Ga0105242_10102358 3300009176 Bacteria 2429
78 Ga0105242_10151652 3300009176 Bacteria 2021
79 Ga0105248_10000013 3300009177 Bacteria 328864
80 Ga0105237_10124939 3300009545 Bacteria 2567
81 Ga0105238_10002317 3300009551 Bacteria 19137
82 Ga0105238_10014492 3300009551 Bacteria 7972
83 Ga0105238_10020353 3300009551 Bacteria 6754
84 Ga0105238_10044608 3300009551 Bacteria 4482
85 Ga0105238_10067896 3300009551 Bacteria 3566
86 Ga0105238_10182930 3300009551 Bacteria 2072
87 Ga0105238_10235025 3300009551 Bacteria 1810
88 Ga0105249_10145728 3300009553 Bacteria 2275
89 Ga0105249_10283942 3300009553 Bacteria 1654
90 Ga0105239_10003417 3300010375 Bacteria 19473
91 Ga0105239_10004908 3300010375 Bacteria 15821
92 Ga0105239_10087269 3300010375 Bacteria 3439
93 Ga0157373_10000756 3300013100 Bacteria 25102
94 Ga0157373_10000801 3300013100 Bacteria 24325
95 Ga0157369_10035920 3300013105 Bacteria 5432
96 Ga0157369_10059219 3300013105 Bacteria 4130
97 Ga0157378_10178237 3300013297 Bacteria 1998
98 Ga0163162_10140621 3300013306 Bacteria 2527
99 Ga0157380_10051913 3300014326 Bacteria 3245
100 Ga0182007_10046980 3300015262 Bacteria 1428
101 Ga0183362_10002 3300015683 Bacteria 1432711
102 Ga0213876_10000965 3300021384 Bacteria 18920
103 Ga0213875_10003043 3300021388 Bacteria 9708
104 Ga0209026_1002163 3300025250 Bacteria 7650
105 Ga0209455_1023730 3300025272 Bacteria 1144
106 Ga0209758_1001260 3300025297 Bacteria 31379
107 Ga0209050_1000073 3300025298 Bacteria 292046
108 Ga0209257_1000099 3300025304 Bacteria 255304
109 Ga0209257_1012124 3300025304 Bacteria 4039
110 Ga0207647_10002243 3300025904 Bacteria 14729
111 Ga0207707_10000005 3300025912 Bacteria 382024
112 Ga0207707_10036136 3300025912 Bacteria 4320
113 Ga0207695_10000004 3300025913 Bacteria 1288665
114 Ga0207695_10003931 3300025913 Bacteria 20558
115 Ga0207695_10027263 3300025913 Bacteria 6364
116 Ga0207695_10048356 3300025913 Bacteria 4492
117 Ga0207695_10246180 3300025913 Bacteria 1688
118 Ga0207695_10323691 3300025913 Bacteria 1431
119 Ga0207693_10005114 3300025915 Bacteria 10993
120 Ga0207660_10008980 3300025917 Bacteria 6469
121 Ga0207657_10160425 3300025919 Bacteria 1826
122 Ga0207649_10000392 3300025920 Bacteria 32840
123 Ga0207652_10000068 3300025921 Bacteria 110287
124 Ga0207694_10000010 3300025924 Bacteria 439722
125 Ga0207694_10001252 3300025924 Bacteria 21941
126 Ga0207694_10020557 3300025924 Plasmid 4997
127 Ga0207694_10091793 3300025924 Bacteria 2397
128 Ga0207694_10200829 3300025924 Bacteria 1622
129 Ga0207700_10051491 3300025928 Bacteria 3073
130 Ga0207664_10057933 3300025929 Bacteria 3081
131 Ga0207686_10019522 3300025934 Bacteria 3858
132 Ga0207704_10011593 3300025938 Bacteria 4346
133 Ga0207665_10064548 3300025939 Bacteria 2488
134 Ga0207711_10000003 3300025941 Bacteria 1042791
135 Ga0207661_10093476 3300025944 Bacteria 2510
136 Ga0207679_10024925 3300025945 Bacteria 4107
137 Ga0207667_10000065 3300025949 Bacteria 186655
138 Ga0207667_10000645 3300025949 Bacteria 45224
139 Ga0207667_10008555 3300025949 Bacteria 12145
140 Ga0207667_10030602 3300025949 Bacteria 5820
141 Ga0207667_10220111 3300025949 Bacteria 1945
142 Ga0207712_10155909 3300025961 Bacteria 1769
143 Ga0207668_10121116 3300025972 Bacteria 1981
144 Ga0207640_10005643 3300025981 Bacteria 6823
145 Ga0207658_10005731 3300025986 Bacteria 8491
146 Ga0207641_10049351 3300026088 Bacteria 3556
147 Ga0207674_10004503 3300026116 Bacteria 16750
148 Ga0207674_10309965 3300026116 Bacteria 1528
149 Ga0207675_100171246 3300026118 Bacteria 2075
150 Ga0207698_10015751 3300026142 Bacteria 5077
151 Ga0207698_10109443 3300026142 Bacteria 2312
152 Ga0265354_1001576 3300028016 Bacteria 3198
153 Ga0265356_1000703 3300028017 Bacteria 5728
154 Ga0268266_10000945 3300028379 Bacteria 36992
155 Ga0268265_10001213 3300028380 Bacteria 22410
156 Ga0268265_10001214 3300028380 Bacteria 22398
157 Ga0268265_10335222 3300028380 Bacteria 1375
158 Ga0268264_10000113 3300028381 Bacteria 203262
159 Ga0265334_10019320 3300028573 Bacteria 2805
160 Ga0307515_10000064 3300028794 Bacteria 245452
161 Ga0307515_10015163 3300028794 Bacteria 14215
162 Ga0307515_10020953 3300028794 Bacteria 11618
163 Ga0265770_1000418 3300030878 Bacteria 5806
164 Ga0265760_10000579 3300031090 Bacteria 10390
165 Ga0265332_10006728 3300031238 Bacteria 5209
166 Ga0265325_10000016 3300031241 Bacteria 130316
167 Ga0265339_10001067 3300031249 Bacteria 20841
168 Ga0265331_10000003 3300031250 Bacteria 499358
169 Ga0265331_10000625 3300031250 Bacteria 30747
170 Ga0265331_10003377 3300031250 Bacteria 10348
171 Ga0265331_10010490 3300031250 Bacteria 5125
172 Ga0265327_10000442 3300031251 Bacteria 75162
173 Ga0265327_10001057 3300031251 Bacteria 38486
174 Ga0265327_10002842 3300031251 Bacteria 17457
175 Ga0307513_10014814 3300031456 Bacteria 9485
176 Ga0265313_10009857 3300031595 Bacteria 6147
177 Ga0265314_10030031 3300031711 Bacteria 4028
178 Ga0265342_10041625 3300031712 Bacteria 2780
179 Ga0307516_10008347 3300031730 Bacteria 11737
180 Ga0307405_10099818 3300031731 Bacteria 1944
181 Ga0307416_100029826 3300032002 Bacteria 4082
182 Ga0373936_0012343 3300035113 Bacteria 3249
183 Ga0373956_0000167 3300035119 Bacteria 24627
184 Ga0373935_0086934 3300035692 Bacteria 2041
185 Ga0373935_0165098 3300035692 Bacteria 1512
186 Ga0373927_0000124 3300035695 Bacteria 58788
187 Ga0373933_0051610 3300035724 Unclassified 2459
188 Ga0373933_0153010 3300035724 Bacteria 1462
189 Ga0395899_0000991 3300037312 Bacteria 26130
190 Ga0395899_0133246 3300037312 Bacteria 1773
191 Ga0395900_0000002 3300037418 Bacteria 671103
192 Ga0395900_0056830 3300037418 Bacteria 4028
193 Ga0395900_0166403 3300037418 Bacteria 2247
194 Ga0395900_0509809 3300037418 Bacteria 1152
195 Ga0395898_0006370 3300037466 Bacteria 12608
196 Ga0395905_0000033 3300037471 Bacteria 279363
197 Ga0395905_0000389 3300037471 Bacteria 62338
198 Ga0395905_0009959 3300037471 Bacteria 9261
199 Ga0395905_0014734 3300037471 Bacteria 7455
200 Ga0395905_0030600 3300037471 Bacteria 5070
201 Ga0436364_0437552 3300037853 Bacteria 1679
202 Ga0436364_0726367 3300037853 Bacteria 25170
203 Ga0395901_0000021 3300038443 Bacteria 307734
204 Ga0395901_0089226 3300038443 Bacteria 3226
205 Ga0436365_0166028 3300039437 Bacteria 30952
206 Ga0436360_0810242 3300039438 Bacteria 2103
207 Ga0436360_1114290 3300039438 Bacteria 1422
208 Ga0436361_0414754 3300039447 Bacteria 8003
209 Ga0436363_0607081 3300039450 Bacteria 4420
210 Ga0436362_1016656 3300039453 Bacteria 2761
211 Ga0451853_0852369 3300041512 Bacteria 1667
212 Ga0439449_0007711 3300042007 Bacteria 4086
213 Ga0439435_0012472 3300042436 Bacteria 2061
214 Ga0451576_0068531 3300045051 Bacteria 3692
215 Ga0495590_0000311 3300046457 Bacteria 25443
216 Ga0495638_0001837 3300046460 Bacteria 18398
217 Ga0495638_0028799 3300046460 Bacteria 3584
218 Ga0495580_0001337 3300046472 Bacteria 21733
219 Ga0495664_0138078 3300046477 Bacteria 1477
220 Ga0495585_0041335 3300046492 Bacteria 2586
221 Ga0495607_0062641 3300046501 Bacteria 2107
222 Ga0495583_0000003 3300046506 Bacteria 709273
223 Ga0495606_0004219 3300046507 Bacteria 14545
224 Ga0495616_0000016 3300046513 Bacteria 182686
225 Ga0495620_0016763 3300046515 Bacteria 3668
226 Ga0495632_0146392 3300046519 Bacteria 1093
227 Ga0495643_0060924 3300046522 Bacteria 2002
228 Ga0495666_0006293 3300046526 Bacteria 5980
229 Ga0495654_0000039 3300046530 Bacteria 185363
230 Ga0495665_0005568 3300046531 Bacteria 6789
231 Ga0495597_0116288 3300046542 Bacteria 1118
232 Ga0495645_0081068 3300046543 Bacteria 2328
233 Ga0495622_0156960 3300046557 Bacteria 1027
234 Ga0495668_0017110 3300046616 Bacteria 4210
235 Ga0495625_0000069 3300046660 Bacteria 168800
236 Ga0495625_0085580 3300046660 Bacteria 2188
237 Ga0495669_0000006 3300046684 Bacteria 190838
238 Ga0495669_0000216 3300046684 Bacteria 34639
239 Ga0495604_0003312 3300047317 Bacteria 12852
240 Ga0495683_0039223 3300047323 Bacteria 2395
241 Ga0495677_0025402 3300047445 Bacteria 2149
242 Ga0495679_003249 3300047446 Bacteria 7886
243 Ga0495673_0005754 3300047469 Bacteria 7431
244 Ga0495681_0020666 3300047470 Bacteria 3567
245 Ga0495686_0000305 3300047472 Bacteria 83657
246 Ga0495686_0002475 3300047472 Bacteria 17394
247 Ga0495626_0051304 3300048091 Bacteria 1903
248 Ga0496102_0124854 3300048905 Bacteria 2405
249 Ga0496104_0205448 3300048907 Bacteria 1881
250 Ga0496105_0000256 3300048908 Bacteria 35835
251 Ga0496107_0031811 3300048910 Bacteria 3768
252 Ga0496112_0241284 3300048915 Bacteria 1760
253 Ga0496114_0021675 3300048917 Bacteria 5228
254 Ga0496114_0441342 3300048917 Bacteria 1153
255 Ga0496115_0013929 3300048918 Bacteria 6084
256 Ga0496118_0024069 3300048921 Bacteria 5268
257 Ga0496119_0042509 3300048922 Bacteria 2880
258 Ga0496120_0001365 3300048923 Bacteria 29928
259 Ga0496125_0015580 3300048928 Bacteria 7341
260 Ga0496125_0083587 3300048928 Bacteria 2428
261 Ga0496126_0051801 3300048929 Bacteria 3735
262 Ga0495682_0002792 3300049460 Bacteria 8068
263 Ga0501290_000608 3300049513 Bacteria 5381
264 Ga0501292_000014 3300049515 Bacteria 64546
265 Ga0501031_0004925 3300049568 Bacteria 8678
266 Ga0501032_0002697 3300049569 Bacteria 13842
267 Ga0501032_0192428 3300049569 Bacteria 1333
268 Ga0501033_0015111 3300049570 Bacteria 5858
269 Ga0501033_0073880 3300049570 Bacteria 2503
270 Ga0501034_0013490 3300049571 Bacteria 8412
271 Ga0501034_0389975 3300049571 Bacteria 1316
272 Ga0501036_0042398 3300049572 Bacteria 3853
273 Ga0501037_0019741 3300049573 Bacteria 4973
274 Ga0501038_0007227 3300049574 Bacteria 10260
275 Ga0501038_0018167 3300049574 Bacteria 6349
276 Ga0501038_0204477 3300049574 Bacteria 1583
277 Ga0501039_0001926 3300049575 Bacteria 15386
278 Ga0501039_0021627 3300049575 Bacteria 4935
279 Ga0501040_0013445 3300049576 Bacteria 5380
280 Ga0501041_0002967 3300049577 Bacteria 9729
281 Ga0501041_0031806 3300049577 Bacteria 3190
282 Ga0501042_0000004 3300049578 Bacteria 65867
283 Ga0501043_0007808 3300049579 Bacteria 8457
284 Ga0501043_0012182 3300049579 Bacteria 6721
285 Ga0501046_0017631 3300049580 Bacteria 5954
286 Ga0501046_0092770 3300049580 Bacteria 2321
287 Ga0501047_0004398 3300049581 Bacteria 13262
288 Ga0501047_0016627 3300049581 Bacteria 7024
289 Ga0501047_0030444 3300049581 Bacteria 5203
290 Ga0501047_0064473 3300049581 Bacteria 3533
291 Ga0501047_0083463 3300049581 Bacteria 3071
292 Ga0501047_0125023 3300049581 Bacteria 2453
293 Ga0501048_0048907 3300049582 Bacteria 3015
294 Ga0501067_0001111 3300049583 Bacteria 14540
295 Ga0501067_0005297 3300049583 Bacteria 7164
296 Ga0501067_0012704 3300049583 Bacteria 4668
297 Ga0501067_0140381 3300049583 Bacteria 1345
298 Ga0501068_0001818 3300049584 Bacteria 11329
299 Ga0501068_0011421 3300049584 Bacteria 5016
300 Ga0501069_0015352 3300049585 Bacteria 4104
301 Ga0501070_0033897 3300049586 Bacteria 4272
302 Ga0501071_0197111 3300049587 Bacteria 1512
303 Ga0501072_0005213 3300049588 Bacteria 9897
304 Ga0501072_0075859 3300049588 Bacteria 2659
305 Ga0501072_0247611 3300049588 Bacteria 1419
306 Ga0501073_0000068 3300049589 Bacteria 63524
307 Ga0501073_0002074 3300049589 Bacteria 14995
308 Ga0501073_0107169 3300049589 Bacteria 1939
309 Ga0501074_0034323 3300049590 Bacteria 3677
310 Ga0501074_0109551 3300049590 Bacteria 1976
311 Ga0501074_0259703 3300049590 Bacteria 1235
312 Ga0501075_0023539 3300049591 Bacteria 4511
313 Ga0501075_0160871 3300049591 Bacteria 1713
314 Ga0501075_0179588 3300049591 Bacteria 1615
315 Ga0501076_0059669 3300049592 Bacteria 3034
316 Ga0501076_0231018 3300049592 Bacteria 1512
317 Ga0501077_0000194 3300049593 Bacteria 35095
318 Ga0501077_0002761 3300049593 Bacteria 10524
319 Ga0501077_0161917 3300049593 Bacteria 1421
320 Ga0501206_005163 3300049653 Bacteria 1678
321 Ga0501222_000435 3300049662 Bacteria 6258
322 Ga0501224_010409 3300049664 Bacteria 1364
323 Ga0501259_005541 3300049688 Bacteria 2001
324 Ga0501225_0002981 3300049705 Bacteria 5179
325 Ga0501079_0000094 3300049741 Bacteria 43739
326 Ga0501079_0083823 3300049741 Bacteria 2466
327 Ga0501079_0091741 3300049741 Bacteria 2354
328 Ga0501079_0179320 3300049741 Bacteria 1653
329 Ga0501080_0003510 3300049742 Bacteria 13808
330 Ga0501080_0004480 3300049742 Bacteria 12437
331 Ga0501080_0004496 3300049742 Bacteria 12429
332 Ga0501080_0023234 3300049742 Bacteria 5749
333 Ga0501080_0054820 3300049742 Bacteria 3713
334 Ga0501080_0055817 3300049742 Bacteria 3678
335 Ga0501080_0069058 3300049742 Bacteria 3286
336 Ga0501080_0430921 3300049742 Bacteria 1184
337 Ga0501083_0012131 3300049744 Bacteria 6033
338 Ga0501083_0036708 3300049744 Bacteria 3341
339 Ga0501279_000007 3300049775 Bacteria 141756
340 Ga0501280_000269 3300049776 Bacteria 13181
341 Ga0501282_000370 3300049778 Bacteria 5397
342 Ga0501283_001041 3300049779 Bacteria 3648
343 Ga0501035_0003077 3300049822 Bacteria 16011
344 Ga0501035_0050248 3300049822 Bacteria 3737
345 Ga0501035_0170517 3300049822 Bacteria 1880
346 Ga0501035_0174819 3300049822 Bacteria 1853
347 Ga0501035_0426410 3300049822 Bacteria 1100
348 Ga0501044_0003871 3300049823 Bacteria 16772
349 Ga0501044_0008403 3300049823 Bacteria 11322
350 Ga0501044_0011706 3300049823 Bacteria 9504
351 Ga0501044_0028811 3300049823 Bacteria 5857
352 Ga0501044_0061990 3300049823 Bacteria 3824
353 Ga0501044_0130814 3300049823 Bacteria 2504
354 Ga0501044_0154198 3300049823 Bacteria 2277
355 Ga0501045_0001041 3300049824 Bacteria 18252
356 nmdc:mga07m45_33181_c1 3300050496 Bacteria 2866
357 nmdc:mga05p37_10671_c1 3300050507 Bacteria 10901
358 nmdc:mga05p37_273119_c1 3300050507 Bacteria 2019
359 nmdc:mga06r32_392929_c1 3300050510 Bacteria 1369
360 Ga0495601_0177086 3300053077 Bacteria 1394
361 Ga0500644_0001239 3300053088 Bacteria 7043
362 Ga0500647_0040022 3300053091 Bacteria 2248
363 Ga0500566_0085005 3300053094 Bacteria 1755
364 Ga0500556_0000648 3300053104 Bacteria 21783
365 Ga0500562_001933 3300053108 Bacteria 5193
366 Ga0500595_005679 3300053119 Bacteria 5416
367 Ga0500595_013939 3300053119 Bacteria 3064
368 Ga0500618_000014 3300053125 Bacteria 177186
369 Ga0500559_0000068 3300053136 Bacteria 82896
370 Ga0500559_0004679 3300053136 Bacteria 6444
371 Ga0500564_001221 3300053138 Bacteria 8669
372 Ga0500622_0008076 3300053156 Bacteria 5920
373 Ga0500627_0014122 3300053158 Bacteria 3051
374 Ga0500645_001609 3300053730 Bacteria 11202
375 Ga0501084_0006364 3300054114 Bacteria 9697
376 Ga0501084_0007656 3300054114 Bacteria 8900
377 Ga0501084_0023266 3300054114 Bacteria 5173
378 Ga0501084_0043516 3300054114 Bacteria 3757
379 Ga0501084_0197760 3300054114 Bacteria 1696
380 Ga0501082_0005494 3300060353 Bacteria 11001
381 Ga0501082_0024783 3300060353 Bacteria 5171
382 Ga0501082_0030613 3300060353 Bacteria 4638
383 Ga0501082_0208526 3300060353 Bacteria 1700
384 Ga0501082_0216122 3300060353 Bacteria 1668
385 Ga0530510_0004525 3300061734 Bacteria 9624
386 Ga0530510_0008925 3300061734 Bacteria 7020
387 Ga0530510_0042513 3300061734 Bacteria 3283
388 Ga0530510_0109555 3300061734 Bacteria 2022
389 Ga0530510_0195602 3300061734 Bacteria 1501
390 2513592122 2513237087 Bacteria 5817514
391 2643930384 2643221584 Bacteria 5511711
392 2643999711 2643221598 Bacteria 4578346
393 2644087699 2643221614 Bacteria 4260023
394 2644344258 2643221661 Bacteria 4267604
395 2644367057 2643221666 Bacteria 4265935
396 2792461211 2791355048 Bacteria 5832535
397 2792644179 2791355094 Bacteria 7011481
398 2843745280 2843744320 Bacteria 5659202
399 2849564558 2849560528 Bacteria 5393480
400 2849577671 2849573788 Bacteria 5421256
401 2876380432 2876377896 Bacteria 6565995
402 2904542390 2904541872 Bacteria 8915136
403 2928532022 2928531327 Bacteria 5101314
404 Ga0501031_0205021
405 JGI24739J22299_10009715
406 JGI24737J22298_10002072
407 JGI25153J46596_10037411
408 Ga0055535_1000302
409 Ga0055530_10002467
410 Ga0055540_1010214
411 Ga0055531_10001198
412 Ga0065165_1000856
413 Ga0070658_10042447
414 Ga0070683_100195589
415 Ga0070670_100050545
416 Ga0070666_10187623
417 Ga0070680_100001763
418 Ga0070660_100152719
419 Ga0070691_10018710
420 Ga0070661_100004939
421 Ga0070661_100099689
422 Ga0070692_10005830
423 Ga0070668_100015975
424 Ga0070659_100019616
425 Ga0070667_100038059
426 Ga0070709_10115121
427 Ga0070714_100123467
428 Ga0070714_100127009
429 Ga0070713_100063732
430 Ga0070710_10032567
431 Ga0070708_100015835
432 Ga0070681_10000010
433 Ga0070681_10053948
434 Ga0070679_100001260
435 Ga0070679_100088097
436 Ga0070679_100148438
437 Ga0068853_100124503
438 Ga0070665_100001428
439 Ga0068855_100000034
440 Ga0068855_100000490
441 Ga0068855_100006061
442 Ga0068855_100121171
443 Ga0068855_100144802
444 Ga0068857_100011589
445 Ga0068854_100031770
446 Ga0068856_100013401
447 Ga0068852_100025059
448 Ga0068852_100184077
449 Ga0068852_100422848
450 Ga0068859_100025638
451 Ga0068861_100035817
452 Ga0068863_100051967
453 Ga0068860_100000066
454 Ga0068860_100061951
455 Ga0068862_100001593
456 Ga0068862_100037517
457 Ga0070716_100046003
458 Ga0097621_100227287
459 Ga0068871_100110552
460 Ga0075428_100089991
461 Ga0075430_100007022
462 Ga0068865_100000753
463 Ga0097620_100025640
464 Ga0099794_10061268
465 Ga0099795_10000212
466 Ga0105240_10000382
467 Ga0105240_10000428
468 Ga0105240_10005701
469 Ga0105240_10028281
470 Ga0105240_10035240
471 Ga0105240_10086484
472 Ga0105240_10210680
473 Ga0105240_10605917
474 Ga0105245_10000136
475 Ga0105247_10023648
476 Ga0114129_10003541
477 Ga0114129_10269064
478 Ga0114129_10400322
479 Ga0114129_10418790
480 Ga0105242_10102358
481 Ga0105242_10151652
482 Ga0105248_10000013
483 Ga0105237_10124939
484 Ga0105238_10002317
485 Ga0105238_10014492
486 Ga0105238_10020353
487 Ga0105238_10044608
488 Ga0105238_10067896
489 Ga0105238_10182930
490 Ga0105238_10235025
491 Ga0105249_10145728
492 Ga0105249_10283942
493 Ga0105239_10003417
494 Ga0105239_10004908
495 Ga0105239_10087269
496 Ga0157373_10000756
497 Ga0157373_10000801
498 Ga0157369_10035920
499 Ga0157369_10059219
500 Ga0157378_10178237
501 Ga0163162_10140621
502 Ga0157380_10051913
503 Ga0182007_10046980
504 Ga0183362_10002
505 Ga0213876_10000965
506 Ga0213875_10003043
507 Ga0209026_1002163
508 Ga0209455_1023730
509 Ga0209758_1001260
510 Ga0209050_1000073
511 Ga0209257_1000099
512 Ga0209257_1012124
513 Ga0207647_10002243
514 Ga0207707_10000005
515 Ga0207707_10036136
516 Ga0207695_10000004
517 Ga0207695_10003931
518 Ga0207695_10027263
519 Ga0207695_10048356
520 Ga0207695_10246180
521 Ga0207695_10323691
522 Ga0207693_10005114
523 Ga0207660_10008980
524 Ga0207657_10160425
525 Ga0207649_10000392
526 Ga0207652_10000068
527 Ga0207694_10000010
528 Ga0207694_10001252
529 Ga0207694_10020557
530 Ga0207694_10091793
531 Ga0207694_10200829
532 Ga0207700_10051491
533 Ga0207664_10057933
534 Ga0207686_10019522
535 Ga0207704_10011593
536 Ga0207665_10064548
537 Ga0207711_10000003
538 Ga0207661_10093476
539 Ga0207679_10024925
540 Ga0207667_10000065
541 Ga0207667_10000645
542 Ga0207667_10008555
543 Ga0207667_10030602
544 Ga0207667_10220111
545 Ga0207712_10155909
546 Ga0207668_10121116
547 Ga0207640_10005643
548 Ga0207658_10005731
549 Ga0207641_10049351
550 Ga0207674_10004503
551 Ga0207674_10309965
552 Ga0207675_100171246
553 Ga0207698_10015751
554 Ga0207698_10109443
555 Ga0265354_1001576
556 Ga0265356_1000703
557 Ga0268266_10000945
558 Ga0268265_10001213
559 Ga0268265_10001214
560 Ga0268265_10335222
561 Ga0268264_10000113
562 Ga0265334_10019320
563 Ga0307515_10000064
564 Ga0307515_10015163
565 Ga0307515_10020953
566 Ga0265770_1000418
567 Ga0265760_10000579
568 Ga0265332_10006728
569 Ga0265325_10000016
570 Ga0265339_10001067
571 Ga0265331_10000003
572 Ga0265331_10000625
573 Ga0265331_10003377
574 Ga0265331_10010490
575 Ga0265327_10000442
576 Ga0265327_10001057
577 Ga0265327_10002842
578 Ga0307513_10014814
579 Ga0265313_10009857
580 Ga0265314_10030031
581 Ga0265342_10041625
582 Ga0307516_10008347
583 Ga0307405_10099818
584 Ga0307416_100029826
585 Ga0373936_0012343
586 Ga0373956_0000167
587 Ga0373935_0086934
588 Ga0373935_0165098
589 Ga0373927_0000124
590 Ga0373933_0051610
591 Ga0373933_0153010
592 Ga0395899_0000991
593 Ga0395899_0133246
594 Ga0395900_0000002
595 Ga0395900_0056830
596 Ga0395900_0166403
597 Ga0395900_0509809
598 Ga0395898_0006370
599 Ga0395905_0000033
600 Ga0395905_0000389
601 Ga0395905_0009959
602 Ga0395905_0014734
603 Ga0395905_0030600
604 Ga0436364_0437552
605 Ga0436364_0726367
606 Ga0395901_0000021
607 Ga0395901_0089226
608 Ga0436365_0166028
609 Ga0436360_0810242
610 Ga0436360_1114290
611 Ga0436361_0414754
612 Ga0436363_0607081
613 Ga0436362_1016656
614 Ga0451853_0852369
615 Ga0439449_0007711
616 Ga0439435_0012472
617 Ga0451576_0068531
618 Ga0495590_0000311
619 Ga0495638_0001837
620 Ga0495638_0028799
621 Ga0495580_0001337
622 Ga0495664_0138078
623 Ga0495585_0041335
624 Ga0495607_0062641
625 Ga0495583_0000003
626 Ga0495606_0004219
627 Ga0495616_0000016
628 Ga0495620_0016763
629 Ga0495632_0146392
630 Ga0495643_0060924
631 Ga0495666_0006293
632 Ga0495654_0000039
633 Ga0495665_0005568
634 Ga0495597_0116288
635 Ga0495645_0081068
636 Ga0495622_0156960
637 Ga0495668_0017110
638 Ga0495625_0000069
639 Ga0495625_0085580
640 Ga0495669_0000006
641 Ga0495669_0000216
642 Ga0495604_0003312
643 Ga0495683_0039223
644 Ga0495677_0025402
645 Ga0495679_003249
646 Ga0495673_0005754
647 Ga0495681_0020666
648 Ga0495686_0000305
649 Ga0495686_0002475
650 Ga0495626_0051304
651 Ga0496102_0124854
652 Ga0496104_0205448
653 Ga0496105_0000256
654 Ga0496107_0031811
655 Ga0496112_0241284
656 Ga0496114_0021675
657 Ga0496114_0441342
658 Ga0496115_0013929
659 Ga0496118_0024069
660 Ga0496119_0042509
661 Ga0496120_0001365
662 Ga0496125_0015580
663 Ga0496125_0083587
664 Ga0496126_0051801
665 Ga0495682_0002792
666 Ga0501290_000608
667 Ga0501292_000014
668 Ga0501031_0004925
669 Ga0501032_0002697
670 Ga0501032_0192428
671 Ga0501033_0015111
672 Ga0501033_0073880
673 Ga0501034_0013490
674 Ga0501034_0389975
675 Ga0501036_0042398
676 Ga0501037_0019741
677 Ga0501038_0007227
678 Ga0501038_0018167
679 Ga0501038_0204477
680 Ga0501039_0001926
681 Ga0501039_0021627
682 Ga0501040_0013445
683 Ga0501041_0002967
684 Ga0501041_0031806
685 Ga0501042_0000004
686 Ga0501043_0007808
687 Ga0501043_0012182
688 Ga0501046_0017631
689 Ga0501046_0092770
690 Ga0501047_0004398
691 Ga0501047_0016627
692 Ga0501047_0030444
693 Ga0501047_0064473
694 Ga0501047_0083463
695 Ga0501047_0125023
696 Ga0501048_0048907
697 Ga0501067_0001111
698 Ga0501067_0005297
699 Ga0501067_0012704
700 Ga0501067_0140381
701 Ga0501068_0001818
702 Ga0501068_0011421
703 Ga0501069_0015352
704 Ga0501070_0033897
705 Ga0501071_0197111
706 Ga0501072_0005213
707 Ga0501072_0075859
708 Ga0501072_0247611
709 Ga0501073_0000068
710 Ga0501073_0002074
711 Ga0501073_0107169
712 Ga0501074_0034323
713 Ga0501074_0109551
714 Ga0501074_0259703
715 Ga0501075_0023539
716 Ga0501075_0160871
717 Ga0501075_0179588
718 Ga0501076_0059669
719 Ga0501076_0231018
720 Ga0501077_0000194
721 Ga0501077_0002761
722 Ga0501077_0161917
723 Ga0501206_005163
724 Ga0501222_000435
725 Ga0501224_010409
726 Ga0501259_005541
727 Ga0501225_0002981
728 Ga0501079_0000094
729 Ga0501079_0083823
730 Ga0501079_0091741
731 Ga0501079_0179320
732 Ga0501080_0003510
733 Ga0501080_0004480
734 Ga0501080_0004496
735 Ga0501080_0023234
736 Ga0501080_0054820
737 Ga0501080_0055817
738 Ga0501080_0069058
739 Ga0501080_0430921
740 Ga0501083_0012131
741 Ga0501083_0036708
742 Ga0501279_000007
743 Ga0501280_000269
744 Ga0501282_000370
745 Ga0501283_001041
746 Ga0501035_0003077
747 Ga0501035_0050248
748 Ga0501035_0170517
749 Ga0501035_0174819
750 Ga0501035_0426410
751 Ga0501044_0003871
752 Ga0501044_0008403
753 Ga0501044_0011706
754 Ga0501044_0028811
755 Ga0501044_0061990
756 Ga0501044_0130814
757 Ga0501044_0154198
758 Ga0501045_0001041
759 nmdc:mga07m45_33181_c1
760 nmdc:mga05p37_10671_c1
761 nmdc:mga05p37_273119_c1
762 nmdc:mga06r32_392929_c1
763 Ga0495601_0177086
764 Ga0500644_0001239
765 Ga0500647_0040022
766 Ga0500566_0085005
767 Ga0500556_0000648
768 Ga0500562_001933
769 Ga0500595_005679
770 Ga0500595_013939
771 Ga0500618_000014
772 Ga0500559_0000068
773 Ga0500559_0004679
774 Ga0500564_001221
775 Ga0500622_0008076
776 Ga0500627_0014122
777 Ga0500645_001609
778 Ga0501084_0006364
779 Ga0501084_0007656
780 Ga0501084_0023266
781 Ga0501084_0043516
782 Ga0501084_0197760
783 Ga0501082_0005494
784 Ga0501082_0024783
785 Ga0501082_0030613
786 Ga0501082_0208526
787 Ga0501082_0216122
788 Ga0530510_0004525
789 Ga0530510_0008925
790 Ga0530510_0042513
791 Ga0530510_0109555
792 Ga0530510_0195602
793 2513592122
794 2643930384
795 2643999711
796 2644087699
797 2644344258
798 2644367057
799 2792461211
800 2792644179
801 2843745280
802 2849564558
803 2849577671
804 2876380432
805 2904542390
806 2928532022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

43

127

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

168

312

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

201

347

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9416 1 330
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9415 1 330
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9355 1 330
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.9309 1 333
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.9282 1 330
ID Description Score Start End Superfamily
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9741 2 129 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9728 18 110 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9687 15 132 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9629 1 119 3.90.180.10
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9619 3 115 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A3B9KZH4-F1-model_v4 NADPH:quinone oxidoreductase 0.9863 51 289 GO:0016491
AF-A0A7X5WVL9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9834 21 115 GO:0016491
AF-A0A818H2R6-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9793 18 132 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A5E6MFL2-F1-model_v4 Partial enoyl reductase 0.9777 1 163 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A5C8T711-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9768 1 158 GO:0016491

Map