F435561

General Info

Members Datasets Scaffolds Average Seq Length
403 320 806 409

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005314921|8005320058
Length 458
Sequence GKSKCSRDRQRGGLMNAGTFTGKSLSKCINSIHDYRGNCMYSTELETTDIRDELIGRFFRYVAIESQSNTASASLPSSPGQLELARQLGQELRELGVEDVVIDEHAIVTGVKRGNQPGAPRIGFIAHLDTVDIGLSPVIRPQIIRFEGEDLCLNAQKDIWLRVAEHPEIRNWRGSDIIFGDGTSVLGADNKAAIAVIMTLLSRLEISQPRGDIFVAFVPDEEIGLLGAKALDLNRFPCEFAYTIDCCELGEVVVENFNAASGEIVFTGVSAHPMSAKGVLVNPLLMALDFVSHFERSETPECTQKREGYFWFKDLVANESKARLKVMIRDFDKAAFDTRKQRIADVADRIAKQYPSGTVRYQVADTYHNIADYLQDDNRPAELLFNALDRLGVEKKLTPMRGGTDGAALCVRGLPTPNFFTGAHNFHSRFEFLPVPAFQKSYETALMICILAAETRGC

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
28 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
30 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
47 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
50 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
54 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
55 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
56 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
57 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
58 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
59 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
60 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
61 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
62 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
63 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
64 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
65 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
72 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
73 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
80 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
81 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
82 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
83 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
84 2506520008 Serratia plymuthica AS12 Isolate Unclassified
85 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
86 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
87 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
88 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
89 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
90 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
91 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
92 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
93 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
94 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
95 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
96 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
97 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
98 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
99 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
100 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
101 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
102 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
103 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
104 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
105 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
106 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
107 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
108 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
109 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
110 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
111 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
112 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
113 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
114 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
115 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
116 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
117 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
118 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
119 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
120 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
121 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
122 2643221557 Ensifer sp. Root558 Isolate Unclassified
123 2643221668 Ensifer sp. Root423 Isolate Unclassified
124 2643221733 Bosea sp. Root381 Isolate Unclassified
125 2643221734 Bosea sp. Root670 Isolate Unclassified
126 2643221736 Bosea sp. Root483D1 Isolate Unclassified
127 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
128 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
129 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
130 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
131 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
132 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
133 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
134 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
135 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
136 2751185917 Enterobacter sp. HK169 Isolate Unclassified
137 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
138 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
139 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
140 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
141 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
142 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
143 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
144 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
145 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
146 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
147 2818991467 Bosea vestrisii 3192 Isolate Unclassified
148 2821118458 Enterobacter asburiae 609 Isolate Unclassified
149 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
150 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
151 2841760612 Bosea sp. Tri-49 Isolate Nodule
152 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
153 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
154 2844104063 Bosea sp. Tri-39 Isolate Nodule
155 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
156 2851182111 Bosea sp. Tri-44 Isolate Nodule
157 2851246043 Bosea sp. Tri-54 Isolate Nodule
158 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
159 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
160 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
161 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
162 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
163 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
164 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
165 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
166 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
167 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
168 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
169 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
170 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
171 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
172 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
173 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
174 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
175 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
176 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
177 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
178 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
179 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
180 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
181 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
182 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
183 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
184 2919150387 Rahnella aceris 1817 Isolate Unclassified
185 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
186 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
187 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
188 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
189 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
190 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
191 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
192 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
193 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
194 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
195 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
196 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
197 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
198 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
199 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
200 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
201 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
202 2927143783 Rahnella sp. 2050 Isolate Unclassified
203 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
204 2932406140 Serratia sp. 2723 Isolate Rhizosphere
205 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
206 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
207 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
208 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
209 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
210 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
211 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
212 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
213 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
214 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
215 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
216 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
217 2937539931 Pantoea sp. LS15 Isolate Unclassified
218 2937967321 Serratia sp. YC16 Isolate Unclassified
219 2939577877 Serratia sp. 509 Isolate Rhizosphere
220 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
221 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
222 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
223 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
224 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
225 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
226 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
227 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
228 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
229 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
230 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
231 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
232 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
233 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
234 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
235 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
236 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
237 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
238 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
239 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
240 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
241 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
242 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
243 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
244 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
245 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
246 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
247 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
248 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
249 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
250 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
251 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
252 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
253 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
254 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
255 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
256 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
257 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
258 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
259 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
260 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
261 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
262 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
263 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
264 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
265 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
266 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
267 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
268 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
269 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
270 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
271 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
272 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
273 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
274 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
275 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
276 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
277 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
278 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
279 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
280 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
281 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
282 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
283 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
284 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
285 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
286 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
287 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
288 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
289 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
290 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
291 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
292 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
293 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
294 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
295 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
296 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
297 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
298 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
299 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
300 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
301 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
302 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
303 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
304 640753048 Serratia proteamaculans 568 Isolate Endosphere
305 641522639 Methylobacterium sp. 4-46 Isolate Nodule
306 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
307 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
308 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
309 8004592986 Serratia sp. S119 Isolate Unclassified
310 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
311 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
312 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
313 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
314 8018221730 Enterobacter sp. CM29 Isolate Unclassified
315 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
316 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
317 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
318 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
319 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
320 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.25
Metatranscriptomes 0
Isolates 66.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 10.92
Nodule 45.66
Rhizoplane 3.97
Rhizosphere 21.09
Stem 0
Stem Tuber 1.24
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001494 3300002737 Bacteria 12194
2 JGI25152J39213_1000051 3300002773 Bacteria 79294
3 JGI25152J39213_1000347 3300002773 Bacteria 28995
4 JGI25151J46595_10000350 3300003187 Bacteria 49262
5 JGI25151J46595_10002067 3300003187 Bacteria 12521
6 JGI25165J46597_1000490 3300003214 Bacteria 38158
7 JGI25153J46596_10000134 3300003215 Bacteria 79294
8 rootL2_10011886 3300003322 Bacteria 21471
9 rootH1_10191137 3300003323 Bacteria 3237
10 Ga0055526_1000953 3300003771 Bacteria 21389
11 Ga0055526_1003392 3300003771 Bacteria 10146
12 Ga0055526_1005432 3300003771 Bacteria 7330
13 Ga0055524_1000104 3300003775 Bacteria 104549
14 Ga0055524_1000262 3300003775 Bacteria 53062
15 Ga0055528_1000040 3300003790 Bacteria 112553
16 Ga0065165_1000141 3300005262 Bacteria 125536
17 Ga0065703_1019052 3300005272 Bacteria 4188
18 Ga0068856_100057055 3300005614 Bacteria 3855
19 Ga0079104_1000975 3300006946 Bacteria 22358
20 Ga0079104_1002601 3300006946 Bacteria 9461
21 Ga0105251_10000329 3300009011 Bacteria 47651
22 Ga0105251_10000644 3300009011 Bacteria 32098
23 Ga0105251_10000779 3300009011 Bacteria 28970
24 Ga0105244_10001891 3300009036 Bacteria 16276
25 Ga0105247_10000166 3300009101 Bacteria 64598
26 Ga0105241_10000001 3300009174 Bacteria 879793
27 Ga0105237_10000384 3300009545 Bacteria 62866
28 Ga0105239_10000394 3300010375 Bacteria 64001
29 Ga0157373_10031271 3300013100 Bacteria 3831
30 Ga0157369_10004201 3300013105 Bacteria 17052
31 Ga0157372_10053292 3300013307 Bacteria 4508
32 Ga0182008_10006857 3300014497 Bacteria 6335
33 Ga0182008_10008818 3300014497 Bacteria 5475
34 Ga0182007_10001889 3300015262 Bacteria 10931
35 Ga0163161_10000003 3300017792 Bacteria 339847
36 Ga0228711_1028484 3300022739 Bacteria 3220
37 Ga0209437_100326 3300025233 Bacteria 60536
38 Ga0209129_1000166 3300025258 Bacteria 97875
39 Ga0209129_1000190 3300025258 Bacteria 84051
40 Ga0209233_1000384 3300025261 Bacteria 38210
41 Ga0209233_1000662 3300025261 Bacteria 16614
42 Ga0209673_1000222 3300025273 Bacteria 112605
43 Ga0209130_1000178 3300025284 Bacteria 90293
44 Ga0209130_1013238 3300025284 Unclassified 2121
45 Ga0209025_1000008 3300025294 Bacteria 1130876
46 Ga0209025_1000336 3300025294 Bacteria 103514
47 Ga0209025_1002196 3300025294 Bacteria 21605
48 Ga0209025_1010848 3300025294 Bacteria 6108
49 Ga0209564_1000015 3300025295 Bacteria 615324
50 Ga0209564_1000258 3300025295 Bacteria 112586
51 Ga0209564_1000730 3300025295 Bacteria 46914
52 Ga0209564_1000752 3300025295 Bacteria 45914
53 Ga0209758_1000316 3300025297 Bacteria 93634
54 Ga0209256_1000062 3300025299 Bacteria 253433
55 Ga0209256_1000202 3300025299 Bacteria 112605
56 Ga0209256_1000995 3300025299 Bacteria 33735
57 Ga0207426_1025514 3300025302 Unclassified 1989
58 Ga0207426_1029585 3300025302 Bacteria 1804
59 Ga0209051_1000604 3300025303 Bacteria 41873
60 Ga0207696_1000001 3300025711 Bacteria 2579611
61 Ga0207655_1000041 3300025728 Bacteria 333962
62 Ga0207713_1000029 3300025735 Bacteria 285054
63 Ga0207713_1000070 3300025735 Bacteria 186597
64 Ga0207713_1000072 3300025735 Bacteria 185652
65 Ga0207713_1002803 3300025735 Bacteria 12302
66 Ga0207710_10000051 3300025900 Bacteria 182751
67 Ga0207654_10000004 3300025911 Bacteria 902334
68 Ga0207671_10000379 3300025914 Bacteria 63039
69 Ga0207702_10116752 3300026078 Bacteria 2382
70 Ga0209281_1000038 3300027111 Bacteria 361154
71 Ga0209281_1002674 3300027111 Bacteria 6749
72 Ga0209282_1013293 3300027666 Bacteria 5245
73 Ga0209282_1020632 3300027666 Bacteria 4172
74 Ga0307409_100195017 3300031995 Bacteria 1807
75 Ga0315915_1000265 3300033464 Bacteria 48403
76 Ga0315915_1003360 3300033464 Bacteria 20328
77 Ga0439438_000419 3300041405 Bacteria 19185
78 Ga0495627_000044 3300046453 Bacteria 182964
79 Ga0495605_0017295 3300046474 Bacteria 3887
80 Ga0495583_0004332 3300046506 Bacteria 10243
81 Ga0495610_0071933 3300046512 Bacteria 1611
82 Ga0495620_0004223 3300046515 Bacteria 8131
83 Ga0495632_0000423 3300046519 Bacteria 40113
84 Ga0495632_0047530 3300046519 Bacteria 2128
85 Ga0495643_0003455 3300046522 Bacteria 11548
86 Ga0495643_0040864 3300046522 Bacteria 2531
87 Ga0495654_0000484 3300046530 Bacteria 32821
88 Ga0495654_0002563 3300046530 Bacteria 11625
89 Ga0495611_0021403 3300046648 Bacteria 2793
90 Ga0495649_0005981 3300046694 Bacteria 7623
91 Ga0495589_0000003 3300046794 Bacteria 453448
92 Ga0495660_0060034 3300046810 Bacteria 2044
93 Ga0495683_0001962 3300047323 Bacteria 12843
94 Ga0495687_010496 3300047443 Bacteria 5076
95 Ga0496100_0089384 3300048903 Bacteria 2098
96 Ga0496102_0000625 3300048905 Bacteria 36336
97 Ga0496103_0002632 3300048906 Bacteria 11243
98 Ga0496103_0032199 3300048906 Bacteria 3199
99 Ga0496116_0000007 3300048919 Bacteria 795464
100 Ga0496116_0000868 3300048919 Bacteria 37701
101 Ga0496117_0001345 3300048920 Bacteria 36055
102 Ga0496117_0014808 3300048920 Bacteria 6691
103 Ga0496118_0000524 3300048921 Bacteria 63074
104 Ga0496118_0009429 3300048921 Bacteria 9857
105 Ga0496118_0099907 3300048921 Bacteria 1964
106 Ga0496119_0000359 3300048922 Bacteria 63918
107 Ga0496119_0001060 3300048922 Bacteria 35062
108 Ga0496119_0019807 3300048922 Bacteria 4933
109 Ga0496119_0025753 3300048922 Bacteria 4100
110 Ga0496120_0000403 3300048923 Bacteria 69285
111 Ga0496120_0000492 3300048923 Bacteria 61827
112 Ga0496120_0001015 3300048923 Bacteria 37573
113 Ga0496120_0004821 3300048923 Bacteria 11041
114 Ga0496121_0001402 3300048924 Bacteria 40798
115 Ga0496122_0013246 3300048925 Bacteria 8086
116 Ga0496122_0034064 3300048925 Bacteria 4175
117 Ga0496122_0046559 3300048925 Bacteria 3357
118 Ga0496123_0008262 3300048926 Bacteria 9596
119 Ga0496123_0025673 3300048926 Bacteria 4433
120 Ga0496124_0000028 3300048927 Bacteria 357219
121 Ga0496124_0002253 3300048927 Bacteria 25627
122 Ga0496124_0016158 3300048927 Bacteria 7116
123 Ga0496124_0026890 3300048927 Bacteria 5179
124 Ga0496124_0101282 3300048927 Bacteria 2334
125 Ga0496125_0002037 3300048928 Bacteria 27348
126 Ga0496125_0041858 3300048928 Bacteria 3910
127 Ga0496126_0033889 3300048929 Bacteria 4803
128 Ga0496126_0287843 3300048929 Bacteria 1359
129 Ga0500618_000031 3300053125 Bacteria 129550
130 Ga0500618_001377 3300053125 Bacteria 10995
131 Ga0500622_0007494 3300053156 Bacteria 6195
132 Ga0500636_0002867 3300053177 Bacteria 9639
133 Ga0500636_0007349 3300053177 Bacteria 6367
134 Ga0500636_0095556 3300053177 Bacteria 1696
135 8005320058 8005314921 Bacteria 7072929
136 2506579635 2506520007 Bacteria 5442880
137 2506584774 2506520008 Bacteria 5443009
138 2508853425 2508501071 Bacteria 5454741
139 2511388665 2511231027 Bacteria 5013807
140 2511499667 2511231052 Bacteria 6974333
141 2512975135 2512875026 Bacteria 6861065
142 2513588395 2513237086 Bacteria 7265287
143 2513619974 2513237091 Bacteria 6900273
144 2513906111 2513237143 Bacteria 6664116
145 2513987752 2513237156 Bacteria 6402557
146 2515611831 2515154107 Bacteria 6795637
147 2516896046 2516653046 Bacteria 6989037
148 2516897224 2516653046 Bacteria 6989037
149 2517567779 2517487022 Bacteria 7227575
150 2524454180 2524023207 Bacteria 6813453
151 2524454698 2524023207 Bacteria 6813453
152 2538426864 2537561728 Bacteria 5149301
153 2545674245 2545555834 Bacteria 8130841
154 2551675202 2551306084 Bacteria 8942552
155 2551682612 2551306084 Bacteria 8942552
156 2551686451 2551306085 Bacteria 7347181
157 2551686574 2551306085 Bacteria 7347181
158 2551688879 2551306085 Bacteria 7347181
159 2551692688 2551306086 Bacteria 6843938
160 2551694709 2551306086 Bacteria 6843938
161 2551698335 2551306087 Bacteria 7351905
162 2551703615 2551306087 Bacteria 7351905
163 2551712276 2551306089 Bacteria 7162724
164 2551718008 2551306090 Bacteria 7953713
165 2551721555 2551306090 Bacteria 7953713
166 2551723905 2551306090 Bacteria 7953713
167 2551731929 2551306092 Bacteria 6992595
168 2551737934 2551306092 Bacteria 6992595
169 2551738840 2551306092 Bacteria 6992595
170 2551741480 2551306093 Bacteria 7064773
171 2551743980 2551306093 Bacteria 7064773
172 2555258039 2554235234 Bacteria 5762085
173 2585281076 2582581308 Bacteria 7413247
174 2585281436 2582581308 Bacteria 7413247
175 2585327094 2582581315 Bacteria 7318924
176 2585336559 2582581316 Bacteria 7774528
177 2585399584 2582581867 Bacteria 7184437
178 2585533126 2585427527 Bacteria 7273426
179 2585555117 2585427530 Bacteria 7383882
180 2585827712 2585427591 Bacteria 5482980
181 2585835045 2585427592 Bacteria 5370892
182 2599723989 2599185236 Bacteria 6875203
183 2603642358 2602042047 Bacteria 4697674
184 2603698515 2602042066 Bacteria 4423871
185 2603702963 2602042067 Bacteria 4863713
186 2603867031 2602042109 Bacteria 5152801
187 2616310837 2615840626 Bacteria 7921970
188 2643806742 2643221557 Bacteria 7184309
189 2644379097 2643221668 Bacteria 7306521
190 2644732725 2643221733 Bacteria 5690728
191 2644736962 2643221734 Bacteria 5365412
192 2644745392 2643221736 Bacteria 6608466
193 2656276933 2654587920 Bacteria 5475511
194 2671102871 2667528172 Bacteria 5170840
195 2671107126 2667528173 Bacteria 5375747
196 2671116945 2667528174 Bacteria 6435400
197 2671587531 2671180115 Bacteria 5353919
198 2681997286 2681812866 Bacteria 4552357
199 2682005412 2681812869 Bacteria 5014465
200 2689446157 2687453601 Bacteria 5546041
201 2707100572 2706794495 Bacteria 4536932
202 2753856011 2751185917 Bacteria 4551186
203 2765588983 2765235842 Bacteria 4799256
204 2772440071 2772190666 Bacteria 5117644
205 2775539032 2775506706 Bacteria 4873073
206 2792313100 2791355010 Bacteria 4864581
207 2802734912 2802428860 Bacteria 6525526
208 2802736693 2802428861 Bacteria 6534206
209 2802747939 2802428862 Bacteria 6633353
210 2807179652 2806310673 Bacteria 4801221
211 2819612165 2818991448 Bacteria 6772224
212 2819642735 2818991453 Bacteria 7181617
213 2819719847 2818991467 Bacteria 5893227
214 2821119844 2821118458 Bacteria 4714306
215 2823374774 2823373977 Bacteria 4779415
216 2839996735 2839993093 Bacteria 5512535
217 2841760906 2841760612 Bacteria 6454112
218 2841912895 2841911363 Bacteria 6173697
219 2841918642 2841917233 Bacteria 6173500
220 2844106563 2844104063 Bacteria 6440972
221 2850085782 2850079185 Bacteria 6848280
222 2851187556 2851182111 Bacteria 6047226
223 2851246919 2851246043 Bacteria 6439203
224 2852107044 2852103415 Bacteria 5193810
225 2854604316 2854601825 Bacteria 4797592
226 2855199262 2855195626 Bacteria 4927512
227 2855829092 2855825444 Bacteria 6785811
228 2855830911 2855825444 Bacteria 6785811
229 2855844209 2855839649 Bacteria 7135830
230 2855845359 2855839649 Bacteria 7135830
231 2858467958 2858466076 Bacteria 4722413
232 2858805007 2858800743 Bacteria 6603254
233 2858806539 2858800743 Bacteria 6603254
234 2869555506 2869551831 Bacteria 5474685
235 2871275817 2871272651 Bacteria 5042015
236 2871286510 2871282230 Bacteria 4917173
237 2888370164 2888366609 Bacteria 5155009
238 2891671836 2891670763 Bacteria 4967099
239 2904476050 2904474040 Bacteria 5504324
240 2915991957 2915986958 Bacteria 6739310
241 2916001190 2916000859 Bacteria 6865702
242 2916008927 2916007675 Bacteria 6898660
243 2916015930 2916014648 Bacteria 6946486
244 2916016268 2916014648 Bacteria 6946486
245 2916029489 2916028427 Bacteria 6748433
246 2916035943 2916035215 Bacteria 6755766
247 2916047848 2916041962 Bacteria 6820487
248 2916053320 2916048683 Bacteria 6543552
249 2916075163 2916068649 Bacteria 6943657
250 2916082682 2916076590 Bacteria 6596108
251 2917702008 2917699015 Bacteria 7043791
252 2919107308 2919100787 Bacteria 7710546
253 2919109281 2919108558 Bacteria 5897419
254 2919152219 2919150387 Bacteria 5500879
255 2919177173 2919171160 Bacteria 6499771
256 2921202347 2921201388 Bacteria 6926299
257 2921238274 2921237296 Bacteria 6876710
258 2921245395 2921244191 Bacteria 6568419
259 2921286886 2921282425 Bacteria 6826397
260 2921291077 2921289301 Bacteria 7316391
261 2923634882 2923634449 Bacteria 4753480
262 2924145661 2924144063 Bacteria 6883928
263 2924151970 2924150972 Bacteria 7169444
264 2924163160 2924158325 Bacteria 7188855
265 2924167272 2924165586 Bacteria 7260590
266 2924173943 2924172951 Bacteria 6749356
267 2924183237 2924179722 Bacteria 6843264
268 2924204900 2924200457 Bacteria 6757188
269 2924207659 2924207177 Bacteria 6917007
270 2924212142 2924207177 Bacteria 6917007
271 2924215523 2924214083 Bacteria 7080103
272 2924222900 2924221636 Bacteria 7113495
273 2927144888 2927143783 Bacteria 5504251
274 2928525527 2928521798 Bacteria 4960112
275 2932409231 2932406140 Bacteria 5134491
276 2937003643 2937002841 Bacteria 6934057
277 2937012468 2937009748 Bacteria 6746052
278 2937020205 2937016420 Bacteria 6782579
279 2937022766 2937016420 Bacteria 6782579
280 2937029437 2937023124 Bacteria 6815156
281 2937044971 2937042894 Bacteria 6741576
282 2937045122 2937042894 Bacteria 6741576
283 2937051124 2937049772 Bacteria 6757901
284 2937058110 2937056579 Bacteria 7107896
285 2937065031 2937063883 Bacteria 7199456
286 2937065371 2937063883 Bacteria 7199456
287 2937076929 2937071275 Bacteria 6984483
288 2937104869 2937098957 Bacteria 7249374
289 2937108182 2937106411 Bacteria 6947143
290 2937118942 2937113482 Bacteria 6505872
291 2937119003 2937113482 Bacteria 6505872
292 2937541634 2937539931 Bacteria 4639830
293 2937968695 2937967321 Bacteria 5094075
294 2939580823 2939577877 Bacteria 5132791
295 2939611133 2939607340 Bacteria 4719256
296 2954012430 2954011201 Bacteria 4762601
297 2957388542 2957382221 Bacteria 6737050
298 2957393625 2957388812 Bacteria 6778072
299 2957397093 2957395598 Bacteria 6822399
300 2957408807 2957402308 Bacteria 6741770
301 2957413544 2957408893 Bacteria 6558585
302 2957416269 2957415311 Bacteria 6991633
303 2957423059 2957422303 Bacteria 7172205
304 2957433772 2957430029 Bacteria 7022557
305 2957444550 2957443900 Bacteria 6869977
306 2957454509 2957450854 Bacteria 6765715
307 2957469746 2957464669 Bacteria 6568877
308 2957484772 2957478035 Bacteria 6756658
309 2957506911 2957505466 Bacteria 7253085
310 2960589590 2960584000 Bacteria 6864594
311 2960603844 2960597568 Bacteria 6550735
312 2960611945 2960610863 Bacteria 6691244
313 2960622662 2960617483 Bacteria 6727748
314 2960622739 2960617483 Bacteria 6727748
315 2960639714 2960637947 Bacteria 7296468
316 2960646604 2960645483 Bacteria 7211087
317 2960654811 2960652885 Bacteria 7083688
318 2960661265 2960660292 Bacteria 7041660
319 2960667963 2960667422 Bacteria 6763020
320 2960681676 2960680706 Bacteria 6624464
321 2960690092 2960687367 Bacteria 6535474
322 2960695565 2960693952 Bacteria 6749742
323 2964610667 2964607997 Bacteria 7101408
324 2964616505 2964615318 Bacteria 6809089
325 2964627304 2964621998 Bacteria 6834995
326 2964629875 2964628898 Bacteria 7083044
327 2964645397 2964643177 Bacteria 6820887
328 2964654753 2964649959 Bacteria 6675118
329 2964660612 2964656573 Bacteria 7100150
330 2964664403 2964663802 Bacteria 7019362
331 2964673891 2964670856 Bacteria 6851364
332 2964689582 2964685014 Bacteria 6839111
333 2964703926 2964698721 Bacteria 6765331
334 2967670092 2967664464 Bacteria 6948836
335 2967685749 2967678726 Bacteria 7264382
336 2967688190 2967686174 Bacteria 6678622
337 2967698685 2967693043 Bacteria 6804451
338 2967702618 2967699805 Bacteria 6854538
339 2967709283 2967706974 Bacteria 7186053
340 2967717209 2967714385 Bacteria 7000047
341 2967726635 2967721400 Bacteria 7073753
342 2967746249 2967742019 Bacteria 6794534
343 2967756522 2967755722 Bacteria 6814706
344 2967762833 2967762386 Bacteria 6923502
345 2967762848 2967762386 Bacteria 6923502
346 2967774129 2967769361 Bacteria 6587838
347 2970026777 2970019648 Bacteria 7072033
348 2970034482 2970033650 Bacteria 7118744
349 2970041874 2970040964 Bacteria 6731123
350 2970048477 2970047711 Bacteria 7088379
351 2970048735 2970047711 Bacteria 7088379
352 2970059846 2970054988 Bacteria 6611507
353 2970063150 2970061556 Bacteria 7099761
354 2970069628 2970068827 Bacteria 7123112
355 2970087033 2970082768 Bacteria 6183754
356 2970096312 2970095765 Bacteria 6936963
357 2970109026 2970102677 Bacteria 6812532
358 2970115932 2970109326 Bacteria 6863976
359 2970115946 2970109326 Bacteria 6863976
360 2970122571 2970116247 Bacteria 6501857
361 2970123093 2970122695 Bacteria 6625855
362 2970134715 2970129317 Bacteria 6806560
363 2970137688 2970136068 Bacteria 7207982
364 2970138462 2970136068 Bacteria 7207982
365 2970156410 2970149975 Bacteria 6779706
366 2970162351 2970156795 Bacteria 7168044
367 2970183397 2970177841 Bacteria 6768001
368 2971823840 2971820967 Bacteria 5823634
369 2974312089 2974310843 Bacteria 4947816
370 2977521478 2977516862 Bacteria 6940108
371 2977527508 2977523885 Bacteria 6960446
372 2977528901 2977523885 Bacteria 6960446
373 2977532375 2977530762 Bacteria 6951399
374 2977543672 2977537788 Bacteria 6929320
375 2977557035 2977551784 Bacteria 7125765
376 2977563556 2977558990 Bacteria 6863948
377 2977571928 2977565890 Bacteria 6901543
378 2977573231 2977572785 Bacteria 6763888
379 2977585685 2977579622 Bacteria 6772100
380 2984587664 2984587000 Bacteria 5263363
381 2996315081 2996310559 Bacteria 6357320
382 3003666431 3003665799 Bacteria 7279786
383 3005420692 3005416602 Bacteria 7064308
384 3005452147 3005445848 Bacteria 6906074
385 640938905 640753048 Bacteria 5495657
386 641643779 641522639 Bacteria 7737025
387 648738407 648276728 Bacteria 6968865
388 648740887 648276728 Bacteria 6968865
389 8003996791 8003992118 Bacteria 7266902
390 8004004550 8003999396 Bacteria 7063185
391 8004005327 8003999396 Bacteria 7063185
392 8004596226 8004592986 Bacteria 5122074
393 8005488241 8005484373 Bacteria 6297373
394 8005648534 8005645114 Bacteria 6950293
395 8005687165 8005682033 Bacteria 6726518
396 8015397866 8015394850 Bacteria 5064660
397 8018226321 8018221730 Bacteria 4616064
398 8018407754 8018405270 Bacteria 4978981
399 8054845767 8054844752 Bacteria 4450330
400 8054850784 8054849141 Bacteria 5232694
401 8055089282 8055087960 Bacteria 4784273
402 8055098965 8055097453 Bacteria 4865496
403 8057530877 8057529695 Bacteria 6306553
404 JGI25162J39368_1001494
405 JGI25152J39213_1000051
406 JGI25152J39213_1000347
407 JGI25151J46595_10000350
408 JGI25151J46595_10002067
409 JGI25165J46597_1000490
410 JGI25153J46596_10000134
411 rootL2_10011886
412 rootH1_10191137
413 Ga0055526_1000953
414 Ga0055526_1003392
415 Ga0055526_1005432
416 Ga0055524_1000104
417 Ga0055524_1000262
418 Ga0055528_1000040
419 Ga0065165_1000141
420 Ga0065703_1019052
421 Ga0068856_100057055
422 Ga0079104_1000975
423 Ga0079104_1002601
424 Ga0105251_10000329
425 Ga0105251_10000644
426 Ga0105251_10000779
427 Ga0105244_10001891
428 Ga0105247_10000166
429 Ga0105241_10000001
430 Ga0105237_10000384
431 Ga0105239_10000394
432 Ga0157373_10031271
433 Ga0157369_10004201
434 Ga0157372_10053292
435 Ga0182008_10006857
436 Ga0182008_10008818
437 Ga0182007_10001889
438 Ga0163161_10000003
439 Ga0228711_1028484
440 Ga0209437_100326
441 Ga0209129_1000166
442 Ga0209129_1000190
443 Ga0209233_1000384
444 Ga0209233_1000662
445 Ga0209673_1000222
446 Ga0209130_1000178
447 Ga0209130_1013238
448 Ga0209025_1000008
449 Ga0209025_1000336
450 Ga0209025_1002196
451 Ga0209025_1010848
452 Ga0209564_1000015
453 Ga0209564_1000258
454 Ga0209564_1000730
455 Ga0209564_1000752
456 Ga0209758_1000316
457 Ga0209256_1000062
458 Ga0209256_1000202
459 Ga0209256_1000995
460 Ga0207426_1025514
461 Ga0207426_1029585
462 Ga0209051_1000604
463 Ga0207696_1000001
464 Ga0207655_1000041
465 Ga0207713_1000029
466 Ga0207713_1000070
467 Ga0207713_1000072
468 Ga0207713_1002803
469 Ga0207710_10000051
470 Ga0207654_10000004
471 Ga0207671_10000379
472 Ga0207702_10116752
473 Ga0209281_1000038
474 Ga0209281_1002674
475 Ga0209282_1013293
476 Ga0209282_1020632
477 Ga0307409_100195017
478 Ga0315915_1000265
479 Ga0315915_1003360
480 Ga0439438_000419
481 Ga0495627_000044
482 Ga0495605_0017295
483 Ga0495583_0004332
484 Ga0495610_0071933
485 Ga0495620_0004223
486 Ga0495632_0000423
487 Ga0495632_0047530
488 Ga0495643_0003455
489 Ga0495643_0040864
490 Ga0495654_0000484
491 Ga0495654_0002563
492 Ga0495611_0021403
493 Ga0495649_0005981
494 Ga0495589_0000003
495 Ga0495660_0060034
496 Ga0495683_0001962
497 Ga0495687_010496
498 Ga0496100_0089384
499 Ga0496102_0000625
500 Ga0496103_0002632
501 Ga0496103_0032199
502 Ga0496116_0000007
503 Ga0496116_0000868
504 Ga0496117_0001345
505 Ga0496117_0014808
506 Ga0496118_0000524
507 Ga0496118_0009429
508 Ga0496118_0099907
509 Ga0496119_0000359
510 Ga0496119_0001060
511 Ga0496119_0019807
512 Ga0496119_0025753
513 Ga0496120_0000403
514 Ga0496120_0000492
515 Ga0496120_0001015
516 Ga0496120_0004821
517 Ga0496121_0001402
518 Ga0496122_0013246
519 Ga0496122_0034064
520 Ga0496122_0046559
521 Ga0496123_0008262
522 Ga0496123_0025673
523 Ga0496124_0000028
524 Ga0496124_0002253
525 Ga0496124_0016158
526 Ga0496124_0026890
527 Ga0496124_0101282
528 Ga0496125_0002037
529 Ga0496125_0041858
530 Ga0496126_0033889
531 Ga0496126_0287843
532 Ga0500618_000031
533 Ga0500618_001377
534 Ga0500622_0007494
535 Ga0500636_0002867
536 Ga0500636_0007349
537 Ga0500636_0095556
538 8005320058
539 2506579635
540 2506584774
541 2508853425
542 2511388665
543 2511499667
544 2512975135
545 2513588395
546 2513619974
547 2513906111
548 2513987752
549 2515611831
550 2516896046
551 2516897224
552 2517567779
553 2524454180
554 2524454698
555 2538426864
556 2545674245
557 2551675202
558 2551682612
559 2551686451
560 2551686574
561 2551688879
562 2551692688
563 2551694709
564 2551698335
565 2551703615
566 2551712276
567 2551718008
568 2551721555
569 2551723905
570 2551731929
571 2551737934
572 2551738840
573 2551741480
574 2551743980
575 2555258039
576 2585281076
577 2585281436
578 2585327094
579 2585336559
580 2585399584
581 2585533126
582 2585555117
583 2585827712
584 2585835045
585 2599723989
586 2603642358
587 2603698515
588 2603702963
589 2603867031
590 2616310837
591 2643806742
592 2644379097
593 2644732725
594 2644736962
595 2644745392
596 2656276933
597 2671102871
598 2671107126
599 2671116945
600 2671587531
601 2681997286
602 2682005412
603 2689446157
604 2707100572
605 2753856011
606 2765588983
607 2772440071
608 2775539032
609 2792313100
610 2802734912
611 2802736693
612 2802747939
613 2807179652
614 2819612165
615 2819642735
616 2819719847
617 2821119844
618 2823374774
619 2839996735
620 2841760906
621 2841912895
622 2841918642
623 2844106563
624 2850085782
625 2851187556
626 2851246919
627 2852107044
628 2854604316
629 2855199262
630 2855829092
631 2855830911
632 2855844209
633 2855845359
634 2858467958
635 2858805007
636 2858806539
637 2869555506
638 2871275817
639 2871286510
640 2888370164
641 2891671836
642 2904476050
643 2915991957
644 2916001190
645 2916008927
646 2916015930
647 2916016268
648 2916029489
649 2916035943
650 2916047848
651 2916053320
652 2916075163
653 2916082682
654 2917702008
655 2919107308
656 2919109281
657 2919152219
658 2919177173
659 2921202347
660 2921238274
661 2921245395
662 2921286886
663 2921291077
664 2923634882
665 2924145661
666 2924151970
667 2924163160
668 2924167272
669 2924173943
670 2924183237
671 2924204900
672 2924207659
673 2924212142
674 2924215523
675 2924222900
676 2927144888
677 2928525527
678 2932409231
679 2937003643
680 2937012468
681 2937020205
682 2937022766
683 2937029437
684 2937044971
685 2937045122
686 2937051124
687 2937058110
688 2937065031
689 2937065371
690 2937076929
691 2937104869
692 2937108182
693 2937118942
694 2937119003
695 2937541634
696 2937968695
697 2939580823
698 2939611133
699 2954012430
700 2957388542
701 2957393625
702 2957397093
703 2957408807
704 2957413544
705 2957416269
706 2957423059
707 2957433772
708 2957444550
709 2957454509
710 2957469746
711 2957484772
712 2957506911
713 2960589590
714 2960603844
715 2960611945
716 2960622662
717 2960622739
718 2960639714
719 2960646604
720 2960654811
721 2960661265
722 2960667963
723 2960681676
724 2960690092
725 2960695565
726 2964610667
727 2964616505
728 2964627304
729 2964629875
730 2964645397
731 2964654753
732 2964660612
733 2964664403
734 2964673891
735 2964689582
736 2964703926
737 2967670092
738 2967685749
739 2967688190
740 2967698685
741 2967702618
742 2967709283
743 2967717209
744 2967726635
745 2967746249
746 2967756522
747 2967762833
748 2967762848
749 2967774129
750 2970026777
751 2970034482
752 2970041874
753 2970048477
754 2970048735
755 2970059846
756 2970063150
757 2970069628
758 2970087033
759 2970096312
760 2970109026
761 2970115932
762 2970115946
763 2970122571
764 2970123093
765 2970134715
766 2970137688
767 2970138462
768 2970156410
769 2970162351
770 2970183397
771 2971823840
772 2974312089
773 2977521478
774 2977527508
775 2977528901
776 2977532375
777 2977543672
778 2977557035
779 2977563556
780 2977571928
781 2977573231
782 2977585685
783 2984587664
784 2996315081
785 3003666431
786 3005420692
787 3005452147
788 640938905
789 641643779
790 648738407
791 648740887
792 8003996791
793 8004004550
794 8004005327
795 8004596226
796 8005488241
797 8005648534
798 8005687165
799 8015397866
800 8018226321
801 8018407754
802 8054845767
803 8054850784
804 8055089282
805 8055098965
806 8057530877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

175

449

0.89

PF07687

M20_dimer

Peptidase dimerisation domain

254

358

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.95 13 414
1vix-assembly1.cif.gz_B crystal structure of a putative peptidase t 0.9388 12 414
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.9342 13 414
1vix-assembly1.cif.gz_B crystal structure of a putative peptidase t 0.9212 12 414
3ife-assembly1.cif.gz_A-2 1.55 angstrom resolution crystal structure of peptidase t (pept-1) from bacillus anthracis str. 'ames ancestor'. 0.8574 6 414
ID Description Score Start End Superfamily
af_Q4D1I9_7_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9788 13 180 3.40.630.10
1vixA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9569 12 414 3.40.630.10
af_Q4D1I9_7_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9564 13 180 3.40.630.10
1vixA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9349 12 414 3.40.630.10
1fnoA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9225 221 328 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A498FD91-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9833 254 406 GO:0045148
AF-A0A021WX35-F1-model_v4 Peptidase T-like protein (EC 3.4.11.-) 0.98 57 415 GO:0004177
GO:0006508
GO:0008237
AF-Q4D1I9-F1-model_v4 Peptidase T, putative 0.9792 10 180
AF-A0A350LL28-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9786 11 414 GO:0006508
GO:0006518
GO:0008237
GO:0008270
GO:0045148
AF-A0A1V2YKT7-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9714 9 414 GO:0006508
GO:0006518
GO:0008237
GO:0008270
GO:0045148

Map