F435582

General Info

Members Datasets Scaffolds Average Seq Length
404 221 403 115

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10015982|Ga0070658_100159825
Length 137
Sequence MKRSATEWLRAITAMLPSLSPGGSTLRTIIITVSLLIASNVFMTFAWYAHLRNLAYRPWYVAAFVSWGIALFEYMLQVPANRIGFHQLSLAQLKIIQEVVTLAVFVPFALFYMHQPLKMNFVWAGLCLVGAVFFIFR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
191 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
199 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
200 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
201 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 0.99
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5709342 2162886011 Bacteria 913
2 JGI25406J46586_10022344 3300003203 Bacteria 2522
3 Ga0065712_10154024 3300005290 Bacteria 1341
4 Ga0065712_10164050 3300005290 Unclassified 1277
5 Ga0065715_10000852 3300005293 Bacteria 8668
6 Ga0065715_10377913 3300005293 Bacteria 911
7 Ga0065707_10283614 3300005295 Bacteria 1041
8 Ga0065707_10931732 3300005295 Bacteria 557
9 Ga0070658_10015982 3300005327 Bacteria 6004
10 Ga0070658_10169002 3300005327 Bacteria 1837
11 Ga0070676_10872339 3300005328 Bacteria 668
12 Ga0070683_100031897 3300005329 Bacteria 4794
13 Ga0070683_100038488 3300005329 Bacteria 4385
14 Ga0070683_102197062 3300005329 Bacteria 530
15 Ga0070690_100000182 3300005330 Bacteria 32371
16 Ga0070670_100081357 3300005331 Bacteria 2783
17 Ga0070670_100687737 3300005331 Unclassified 919
18 Ga0070670_101348107 3300005331 Bacteria 654
19 Ga0068869_100001373 3300005334 Bacteria 14418
20 Ga0068869_100008245 3300005334 Bacteria 6710
21 Ga0068869_100067914 3300005334 Bacteria 2632
22 Ga0068869_100088708 3300005334 Bacteria 2322
23 Ga0070666_10108389 3300005335 Bacteria 1919
24 Ga0070680_100001823 3300005336 Bacteria 15647
25 Ga0070680_100217029 3300005336 Bacteria 1614
26 Ga0070680_101160803 3300005336 Bacteria 668
27 Ga0070682_100004224 3300005337 Bacteria 7970
28 Ga0070689_100000521 3300005340 Bacteria 22753
29 Ga0070689_100145482 3300005340 Bacteria 1909
30 Ga0070691_10232750 3300005341 Bacteria 981
31 Ga0070691_10285356 3300005341 Bacteria 897
32 Ga0070687_100000050 3300005343 Bacteria 37797
33 Ga0070692_10003200 3300005345 Bacteria 6586
34 Ga0070692_11137531 3300005345 Bacteria 553
35 Ga0070668_101512614 3300005347 Bacteria 614
36 Ga0070669_100314556 3300005353 Unclassified 1263
37 Ga0070669_101830559 3300005353 Bacteria 530
38 Ga0070675_100083077 3300005354 Bacteria 2673
39 Ga0070675_100106112 3300005354 Bacteria 2371
40 Ga0070675_101399856 3300005354 Unclassified 645
41 Ga0070671_100150805 3300005355 Bacteria 1963
42 Ga0070674_100001504 3300005356 Bacteria 12430
43 Ga0070674_101028233 3300005356 Bacteria 724
44 Ga0070673_100451793 3300005364 Bacteria 1156
45 Ga0070673_100562180 3300005364 Bacteria 1037
46 Ga0070673_100725951 3300005364 Bacteria 914
47 Ga0070688_100169490 3300005365 Bacteria 1505
48 Ga0070688_101584001 3300005365 Bacteria 534
49 Ga0070659_100631526 3300005366 Bacteria 922
50 Ga0070703_10032807 3300005406 Bacteria 1579
51 Ga0070710_10392572 3300005437 Bacteria 928
52 Ga0070701_10000918 3300005438 Bacteria 10655
53 Ga0070701_10045635 3300005438 Bacteria 2249
54 Ga0070701_10195014 3300005438 Bacteria 1194
55 Ga0070701_11019633 3300005438 Bacteria 578
56 Ga0070711_100959666 3300005439 Bacteria 732
57 Ga0070705_100000752 3300005440 Bacteria 18382
58 Ga0070705_100226556 3300005440 Bacteria 1298
59 Ga0070705_100444535 3300005440 Bacteria 971
60 Ga0070700_100002727 3300005441 Bacteria 9028
61 Ga0070700_100128670 3300005441 Bacteria 1706
62 Ga0070700_100583848 3300005441 Bacteria 873
63 Ga0070694_100000128 3300005444 Bacteria 37863
64 Ga0070694_100059508 3300005444 Bacteria 2602
65 Ga0070694_100183479 3300005444 Bacteria 1549
66 Ga0070694_100489555 3300005444 Bacteria 977
67 Ga0070678_100562370 3300005456 Bacteria 1014
68 Ga0068867_100000511 3300005459 Bacteria 25862
69 Ga0068867_100034010 3300005459 Bacteria 3694
70 Ga0068867_100183427 3300005459 Bacteria 1665
71 Ga0070685_10154629 3300005466 Unclassified 1456
72 Ga0070706_100180461 3300005467 Bacteria 1971
73 Ga0070707_100144802 3300005468 Bacteria 2313
74 Ga0070699_100142935 3300005518 Bacteria 2114
75 Ga0070699_100198203 3300005518 Bacteria 1785
76 Ga0070679_100024943 3300005530 Bacteria 5863
77 Ga0070679_101592084 3300005530 Bacteria 601
78 Ga0070684_100953182 3300005535 Bacteria 805
79 Ga0070697_100108337 3300005536 Bacteria 2312
80 Ga0070697_100138526 3300005536 Unclassified 2045
81 Ga0068853_100069631 3300005539 Bacteria 3061
82 Ga0068853_100194024 3300005539 Bacteria 1846
83 Ga0070686_100000107 3300005544 Bacteria 57801
84 Ga0070686_100220564 3300005544 Bacteria 1370
85 Ga0070695_100000172 3300005545 Bacteria 30962
86 Ga0070695_100049306 3300005545 Bacteria 2696
87 Ga0070695_100398162 3300005545 Bacteria 1043
88 Ga0070695_100563120 3300005545 Bacteria 890
89 Ga0070695_100951603 3300005545 Bacteria 696
90 Ga0070696_100003396 3300005546 Bacteria 10625
91 Ga0070696_100055349 3300005546 Bacteria 2766
92 Ga0070696_100660720 3300005546 Bacteria 848
93 Ga0070696_100664618 3300005546 Bacteria 846
94 Ga0070693_100000078 3300005547 Bacteria 40457
95 Ga0070693_100866776 3300005547 Bacteria 674
96 Ga0070704_100000954 3300005549 Bacteria 14659
97 Ga0070704_100079226 3300005549 Bacteria 2413
98 Ga0070704_100428714 3300005549 Bacteria 1134
99 Ga0070704_100585425 3300005549 Bacteria 979
100 Ga0070704_101017437 3300005549 Bacteria 750
101 Ga0068855_100003138 3300005563 Bacteria 20212
102 Ga0070664_100015684 3300005564 Bacteria 6200
103 Ga0070664_100516421 3300005564 Bacteria 1102
104 Ga0070664_100713815 3300005564 Bacteria 935
105 Ga0068857_100039119 3300005577 Bacteria 4201
106 Ga0068857_100187404 3300005577 Bacteria 1884
107 Ga0068854_100002169 3300005578 Bacteria 12051
108 Ga0068854_100233145 3300005578 Bacteria 1462
109 Ga0068854_100545479 3300005578 Bacteria 983
110 Ga0070702_100000048 3300005615 Bacteria 33172
111 Ga0070702_100661554 3300005615 Bacteria 791
112 Ga0068859_100000873 3300005617 Bacteria 30722
113 Ga0068859_100000945 3300005617 Bacteria 29745
114 Ga0068859_100055279 3300005617 Bacteria 3994
115 Ga0068859_100112804 3300005617 Bacteria 2782
116 Ga0068859_100409051 3300005617 Bacteria 1453
117 Ga0068859_101226619 3300005617 Bacteria 826
118 Ga0068864_101041177 3300005618 Unclassified 813
119 Ga0068864_101719804 3300005618 Bacteria 632
120 Ga0068866_10002975 3300005718 Bacteria 6993
121 Ga0068861_100000373 3300005719 Bacteria 25769
122 Ga0068861_100005798 3300005719 Bacteria 8382
123 Ga0068861_100019441 3300005719 Bacteria 4852
124 Ga0068861_100328490 3300005719 Bacteria 1334
125 Ga0068870_10004012 3300005840 Bacteria 6284
126 Ga0068870_10252664 3300005840 Bacteria 1093
127 Ga0068858_100000324 3300005842 Bacteria 50505
128 Ga0068860_100000687 3300005843 Bacteria 39010
129 Ga0068862_100000430 3300005844 Bacteria 45618
130 Ga0068862_100565809 3300005844 Bacteria 1087
131 Ga0068862_101448257 3300005844 Bacteria 691
132 Ga0081539_10000091 3300005985 Bacteria 211445
133 Ga0081539_10000188 3300005985 Bacteria 143987
134 Ga0070712_100191918 3300006175 Bacteria 1599
135 Ga0097621_100000180 3300006237 Bacteria 40011
136 Ga0097621_101149966 3300006237 Bacteria 730
137 Ga0068871_100006394 3300006358 Bacteria 8330
138 Ga0068871_100644326 3300006358 Bacteria 967
139 Ga0075428_100926892 3300006844 Bacteria 923
140 Ga0075430_100032174 3300006846 Bacteria 4453
141 Ga0075430_100054824 3300006846 Bacteria 3354
142 Ga0075430_100616647 3300006846 Bacteria 895
143 Ga0075431_100030540 3300006847 Bacteria 5551
144 Ga0075431_100473564 3300006847 Bacteria 1246
145 Ga0075431_100496112 3300006847 Bacteria 1212
146 Ga0075431_101392947 3300006847 Bacteria 661
147 Ga0075429_100308901 3300006880 Bacteria 1384
148 Ga0068865_100000148 3300006881 Bacteria 37832
149 Ga0075436_100000090 3300006914 Bacteria 52278
150 Ga0097620_100000874 3300006931 Bacteria 30722
151 Ga0097620_100000945 3300006931 Bacteria 29745
152 Ga0097620_100055275 3300006931 Bacteria 3994
153 Ga0097620_100112802 3300006931 Bacteria 2782
154 Ga0097620_100409065 3300006931 Bacteria 1453
155 Ga0097620_101226541 3300006931 Bacteria 826
156 Ga0075435_100007550 3300007076 Bacteria 7765
157 Ga0105240_10012540 3300009093 Bacteria 11693
158 Ga0105240_10318238 3300009093 Bacteria 1774
159 Ga0111539_10012520 3300009094 Bacteria 10630
160 Ga0111539_12267103 3300009094 Bacteria 630
161 Ga0105245_10000429 3300009098 Bacteria 39127
162 Ga0105245_11186605 3300009098 Bacteria 811
163 Ga0105245_11652806 3300009098 Bacteria 692
164 Ga0105243_10002289 3300009148 Bacteria 16060
165 Ga0105243_10074464 3300009148 Bacteria 2754
166 Ga0105243_10156509 3300009148 Bacteria 1960
167 Ga0105243_11746354 3300009148 Bacteria 652
168 Ga0105241_10024619 3300009174 Bacteria 4471
169 Ga0105242_10002750 3300009176 Bacteria 13769
170 Ga0105242_10049235 3300009176 Bacteria 3428
171 Ga0105248_10161431 3300009177 Bacteria 2528
172 Ga0105237_10027015 3300009545 Bacteria 5862
173 Ga0105237_10823190 3300009545 Bacteria 935
174 Ga0105238_11157065 3300009551 Bacteria 797
175 Ga0105238_12402771 3300009551 Bacteria 563
176 Ga0105249_10003569 3300009553 Bacteria 13468
177 Ga0105249_10313409 3300009553 Unclassified 1578
178 Ga0105249_10372014 3300009553 Bacteria 1453
179 Ga0105239_10568823 3300010375 Bacteria 1291
180 Ga0105246_10014351 3300011119 Bacteria 4982
181 Ga0105246_10200352 3300011119 Bacteria 1551
182 Ga0157371_10663662 3300013102 Bacteria 779
183 Ga0157378_10000021 3300013297 Bacteria 130704
184 Ga0157378_10000284 3300013297 Bacteria 49359
185 Ga0157378_10000513 3300013297 Bacteria 36841
186 Ga0157378_11059231 3300013297 Bacteria 847
187 Ga0163162_10586048 3300013306 Bacteria 1242
188 Ga0163162_11573737 3300013306 Bacteria 749
189 Ga0157372_10535125 3300013307 Bacteria 1366
190 Ga0157372_12197881 3300013307 Bacteria 634
191 Ga0157375_10000020 3300013308 Bacteria 251840
192 Ga0157380_10048045 3300014326 Bacteria 3359
193 Ga0157380_10072238 3300014326 Bacteria 2794
194 Ga0157380_11412906 3300014326 Bacteria 747
195 Ga0157380_12109126 3300014326 Bacteria 627
196 Ga0157380_12499040 3300014326 Bacteria 582
197 Ga0157377_10099426 3300014745 Bacteria 1731
198 Ga0157377_10307853 3300014745 Bacteria 1048
199 Ga0157377_10560834 3300014745 Bacteria 808
200 Ga0157376_10267266 3300014969 Bacteria 1605
201 Ga0207653_10102160 3300025885 Bacteria 1015
202 Ga0207682_10005028 3300025893 Bacteria 5420
203 Ga0207680_10037896 3300025903 Bacteria 2787
204 Ga0207647_10228881 3300025904 Bacteria 1070
205 Ga0207647_10324184 3300025904 Bacteria 874
206 Ga0207643_10108848 3300025908 Bacteria 1631
207 Ga0207643_10230598 3300025908 Bacteria 1136
208 Ga0207643_10475736 3300025908 Bacteria 797
209 Ga0207705_10043499 3300025909 Bacteria 3227
210 Ga0207654_10014187 3300025911 Bacteria 4113
211 Ga0207695_10341093 3300025913 Bacteria 1386
212 Ga0207695_10811480 3300025913 Bacteria 816
213 Ga0207671_10124270 3300025914 Bacteria 1975
214 Ga0207660_10008569 3300025917 Bacteria 6618
215 Ga0207660_10097218 3300025917 Bacteria 2194
216 Ga0207660_10583291 3300025917 Bacteria 910
217 Ga0207662_10000165 3300025918 Bacteria 31387
218 Ga0207662_10889673 3300025918 Bacteria 630
219 Ga0207662_11154054 3300025918 Bacteria 551
220 Ga0207649_10583534 3300025920 Bacteria 858
221 Ga0207649_11186258 3300025920 Bacteria 603
222 Ga0207652_11390665 3300025921 Bacteria 605
223 Ga0207646_10071424 3300025922 Bacteria 3100
224 Ga0207681_11042944 3300025923 Bacteria 686
225 Ga0207650_10399753 3300025925 Bacteria 1137
226 Ga0207650_10897952 3300025925 Unclassified 752
227 Ga0207659_10219519 3300025926 Bacteria 1528
228 Ga0207687_10005692 3300025927 Bacteria 8239
229 Ga0207644_10029249 3300025931 Bacteria 3822
230 Ga0207690_11138669 3300025932 Bacteria 651
231 Ga0207686_10001102 3300025934 Bacteria 15806
232 Ga0207709_10002487 3300025935 Bacteria 11552
233 Ga0207709_10216573 3300025935 Bacteria 1378
234 Ga0207709_11242735 3300025935 Bacteria 614
235 Ga0207670_10001683 3300025936 Bacteria 11530
236 Ga0207670_10546687 3300025936 Bacteria 946
237 Ga0207670_11061509 3300025936 Bacteria 683
238 Ga0207669_10001103 3300025937 Bacteria 11541
239 Ga0207669_10140669 3300025937 Bacteria 1675
240 Ga0207704_10000191 3300025938 Bacteria 32206
241 Ga0207691_10034424 3300025940 Bacteria 4709
242 Ga0207711_10110635 3300025941 Bacteria 2443
243 Ga0207689_10000475 3300025942 Bacteria 37746
244 Ga0207689_10009504 3300025942 Bacteria 8396
245 Ga0207689_10175038 3300025942 Bacteria 1769
246 Ga0207689_10343384 3300025942 Bacteria 1240
247 Ga0207689_11342394 3300025942 Bacteria 600
248 Ga0207661_10017386 3300025944 Bacteria 5321
249 Ga0207661_10658634 3300025944 Bacteria 962
250 Ga0207679_10291453 3300025945 Bacteria 1403
251 Ga0207679_10578177 3300025945 Bacteria 1010
252 Ga0207679_10774025 3300025945 Unclassified 874
253 Ga0207679_10979208 3300025945 Bacteria 775
254 Ga0207667_10096961 3300025949 Bacteria 3043
255 Ga0207651_10032443 3300025960 Bacteria 3355
256 Ga0207651_10684554 3300025960 Bacteria 902
257 Ga0207651_10699062 3300025960 Bacteria 893
258 Ga0207712_10021339 3300025961 Bacteria 4252
259 Ga0207712_10321824 3300025961 Bacteria 1276
260 Ga0207640_10001793 3300025981 Bacteria 11532
261 Ga0207640_10413320 3300025981 Bacteria 1102
262 Ga0207640_11054358 3300025981 Bacteria 717
263 Ga0207677_10334897 3300026023 Bacteria 1262
264 Ga0207639_10025987 3300026041 Bacteria 4251
265 Ga0207708_10000465 3300026075 Bacteria 31214
266 Ga0207708_10031344 3300026075 Bacteria 4035
267 Ga0207708_10114429 3300026075 Bacteria 2097
268 Ga0207708_10498683 3300026075 Bacteria 1020
269 Ga0207702_10067906 3300026078 Bacteria 3061
270 Ga0207648_10000171 3300026089 Bacteria 67246
271 Ga0207648_10065305 3300026089 Bacteria 3173
272 Ga0207648_10069166 3300026089 Bacteria 3076
273 Ga0207648_12049557 3300026089 Bacteria 533
274 Ga0207676_10696197 3300026095 Bacteria 984
275 Ga0207674_10051091 3300026116 Bacteria 4220
276 Ga0207674_10450561 3300026116 Bacteria 1244
277 Ga0207675_100000321 3300026118 Bacteria 45579
278 Ga0207675_100002130 3300026118 Bacteria 19629
279 Ga0207675_100018994 3300026118 Bacteria 6417
280 Ga0207683_10119815 3300026121 Bacteria 2361
281 Ga0207428_10000240 3300027907 Bacteria 75186
282 Ga0268266_10247315 3300028379 Bacteria 1648
283 Ga0268266_11479443 3300028379 Bacteria 655
284 Ga0268265_10000632 3300028380 Bacteria 35050
285 Ga0268265_10441312 3300028380 Bacteria 1213
286 Ga0268265_10781437 3300028380 Bacteria 929
287 Ga0268264_10000745 3300028381 Bacteria 36883
288 Ga0265331_10057515 3300031250 Bacteria 1844
289 Ga0307509_10215126 3300031507 Bacteria 1742
290 Ga0307408_100167713 3300031548 Bacteria 1750
291 Ga0307408_100282432 3300031548 Bacteria 1383
292 Ga0307408_101062940 3300031548 Bacteria 749
293 Ga0307408_101375202 3300031548 Bacteria 664
294 Ga0307516_10046181 3300031730 Bacteria 4299
295 Ga0307405_10049545 3300031731 Bacteria 2596
296 Ga0307405_10138546 3300031731 Bacteria 1693
297 Ga0307405_11795657 3300031731 Bacteria 545
298 Ga0307413_10294259 3300031824 Bacteria 1228
299 Ga0307413_11975719 3300031824 Bacteria 525
300 Ga0307410_10030060 3300031852 Bacteria 3467
301 Ga0307410_10451216 3300031852 Bacteria 1049
302 Ga0307410_10982337 3300031852 Bacteria 727
303 Ga0307406_10754885 3300031901 Bacteria 817
304 Ga0307407_10000821 3300031903 Bacteria 10305
305 Ga0307407_10231963 3300031903 Bacteria 1254
306 Ga0307407_10254726 3300031903 Bacteria 1204
307 Ga0307412_10356327 3300031911 Bacteria 1176
308 Ga0307412_11723381 3300031911 Bacteria 575
309 Ga0307409_100055631 3300031995 Bacteria 3056
310 Ga0307409_101461332 3300031995 Bacteria 710
311 Ga0307409_102201696 3300031995 Bacteria 581
312 Ga0307409_102253214 3300031995 Bacteria 574
313 Ga0307416_100160004 3300032002 Bacteria 2080
314 Ga0307416_101637302 3300032002 Bacteria 749
315 Ga0307416_101711942 3300032002 Bacteria 733
316 Ga0307416_102522382 3300032002 Bacteria 612
317 Ga0307416_103809644 3300032002 Bacteria 505
318 Ga0307414_10011345 3300032004 Bacteria 5221
319 Ga0307411_10143089 3300032005 Bacteria 1766
320 Ga0307411_10177533 3300032005 Bacteria 1613
321 Ga0307411_10433372 3300032005 Bacteria 1095
322 Ga0307411_11353257 3300032005 Bacteria 650
323 Ga0307411_11663105 3300032005 Bacteria 590
324 Ga0373958_0129211 3300034819 Bacteria 617
325 Ga0373959_0092875 3300034820 Bacteria 709
326 Ga0373938_0088115 3300034957 Bacteria 764
327 Ga0373928_0100928 3300035084 Bacteria 752
328 Ga0373928_0281496 3300035084 Bacteria 504
329 Ga0373940_0366303 3300035088 Bacteria 508
330 Ga0373944_0004892 3300035089 Bacteria 3509
331 Ga0373952_0007643 3300035092 Bacteria 2032
332 Ga0373932_0003211 3300035112 Bacteria 3968
333 Ga0373932_0043951 3300035112 Bacteria 1301
334 Ga0373936_0008581 3300035113 Bacteria 3847
335 Ga0373945_0011311 3300035116 Bacteria 2951
336 Ga0373960_0131757 3300035121 Bacteria 839
337 Ga0373961_0046654 3300035241 Bacteria 1270
338 Ga0373935_0508355 3300035692 Unclassified 875
339 Ga0395905_1222433 3300037471 Bacteria 655
340 Ga0436363_1567351 3300039450 Bacteria 616
341 Ga0451807_0100411 3300041486 Bacteria 560
342 Ga0451845_0158314 3300041501 Bacteria 583
343 Ga0439433_0188567 3300041999 Bacteria 542
344 Ga0451577_0050312 3300042876 Bacteria 3720
345 Ga0451577_0068300 3300042876 Bacteria 3170
346 Ga0451577_0153215 3300042876 Bacteria 2074
347 Ga0453684_0002647 3300044712 Bacteria 42746
348 Ga0453684_0475849 3300044712 Bacteria 1386
349 Ga0466960_0852919 3300044901 Bacteria 554
350 Ga0451576_0002358 3300045051 Bacteria 28480
351 Ga0451576_0348735 3300045051 Bacteria 1550
352 Ga0451576_0516721 3300045051 Bacteria 1254
353 Ga0451576_1489766 3300045051 Bacteria 703
354 Ga0466967_0938744 3300045976 Bacteria 861
355 Ga0495638_0277000 3300046460 Bacteria 913
356 Ga0495638_0639894 3300046460 Bacteria 518
357 Ga0495583_0207862 3300046506 Bacteria 794
358 Ga0495654_0338361 3300046530 Bacteria 607
359 Ga0495669_0150422 3300046684 Bacteria 1102
360 Ga0495669_0216704 3300046684 Bacteria 917
361 Ga0495671_0278225 3300046692 Bacteria 806
362 Ga0495589_0147358 3300046794 Bacteria 1125
363 Ga0495674_0392808 3300047319 Bacteria 1121
364 Ga0495677_0417975 3300047445 Bacteria 531
365 Ga0495679_006539 3300047446 Bacteria 4991
366 Ga0496102_1044710 3300048905 Bacteria 737
367 Ga0496104_0248897 3300048907 Bacteria 1690
368 Ga0496104_0328652 3300048907 Bacteria 1442
369 Ga0501290_038535 3300049513 Bacteria 709
370 Ga0501299_001342 3300049522 Bacteria 3140
371 Ga0501299_185337 3300049522 Bacteria 545
372 Ga0501031_0007183 3300049568 Bacteria 7267
373 Ga0501031_0485588 3300049568 Bacteria 797
374 Ga0501072_0193252 3300049588 Bacteria 1623
375 Ga0501074_0636254 3300049590 Bacteria 754
376 Ga0501076_0301607 3300049592 Unclassified 1313
377 Ga0501077_0647394 3300049593 Bacteria 679
378 Ga0501207_050890 3300049654 Bacteria 740
379 Ga0501236_012760 3300049670 Bacteria 1139
380 Ga0501239_022731 3300049672 Bacteria 780
381 Ga0501247_056720 3300049677 Bacteria 593
382 Ga0501260_008110 3300049689 Bacteria 1032
383 Ga0501225_0342893 3300049705 Bacteria 515
384 Ga0501283_123166 3300049779 Bacteria 521
385 nmdc:mga05p37_550054_c1 3300050507 Bacteria 1314
386 nmdc:mga0qj67_37792_c1 3300050509 Bacteria 3784
387 nmdc:mga0n895_195127_c1 3300050512 Bacteria 2056
388 nmdc:mga0rr50_5730_c1 3300050513 Bacteria 7448
389 nmdc:mga0a205_1403023_c1 3300050515 Bacteria 546
390 nmdc:mga0a205_211848_c1 3300050515 Bacteria 1826
391 Ga0500583_0040903 3300053092 Bacteria 2102
392 Ga0500651_0171534 3300053093 Bacteria 1293
393 Ga0500641_0213721 3300053096 Bacteria 820
394 Ga0500556_0153828 3300053104 Bacteria 907
395 Ga0500562_174563 3300053108 Bacteria 584
396 Ga0500617_056688 3300053124 Bacteria 1740
397 Ga0500658_0026434 3300053134 Bacteria 2236
398 Ga0500588_0003745 3300053146 Bacteria 3237
399 Ga0500636_0000139 3300053177 Bacteria 37961
400 Ga0500656_012031 3300053732 Bacteria 971
401 Ga0501084_1367084 3300054114 Bacteria 593
402 Ga0590071_016811 3300059421 Bacteria 1716
403 Ga0501082_1379228 3300060353 Bacteria 616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100191918 Ga0070712_1001919182 110
2 3300032002 Ga0307416_103809644 Ga0307416_1038096441 111
3 3300005327 Ga0070658_10015982 Ga0070658_100159825 112
4 3300005327 Ga0070658_10169002 Ga0070658_101690022 112
5 3300005331 Ga0070670_100081357 Ga0070670_1000813573 112
6 3300005334 Ga0068869_100008245 Ga0068869_1000082455 112
7 3300005334 Ga0068869_100088708 Ga0068869_1000887083 112
8 3300005336 Ga0070680_101160803 Ga0070680_1011608032 112
9 3300005345 Ga0070692_11137531 Ga0070692_111375312 112
10 3300005354 Ga0070675_100106112 Ga0070675_1001061122 112
11 3300005356 Ga0070674_100001504 Ga0070674_1000015046 112
12 3300005438 Ga0070701_11019633 Ga0070701_110196331 112
13 3300005459 Ga0068867_100034010 Ga0068867_1000340103 112
14 3300005530 Ga0070679_101592084 Ga0070679_1015920842 112
15 3300005544 Ga0070686_100220564 Ga0070686_1002205643 112
16 3300005545 Ga0070695_100398162 Ga0070695_1003981623 112
17 3300005549 Ga0070704_100585425 Ga0070704_1005854252 112
18 3300005577 Ga0068857_100187404 Ga0068857_1001874043 112
19 3300005617 Ga0068859_100112804 Ga0068859_1001128043 112
20 3300005618 Ga0068864_101719804 Ga0068864_1017198042 112
21 3300005840 Ga0068870_10004012 Ga0068870_100040123 112
22 3300005844 Ga0068862_101448257 Ga0068862_1014482572 112
23 3300006358 Ga0068871_100644326 Ga0068871_1006443262 112
24 3300006844 Ga0075428_100926892 Ga0075428_1009268921 112
25 3300006846 Ga0075430_100054824 Ga0075430_1000548243 112
26 3300006847 Ga0075431_100496112 Ga0075431_1004961122 112
27 3300006880 Ga0075429_100308901 Ga0075429_1003089012 112
28 3300006931 Ga0097620_100112802 Ga0097620_1001128022 112
29 3300007076 Ga0075435_100007550 Ga0075435_1000075504 112
30 3300009094 Ga0111539_12267103 Ga0111539_122671031 112
31 3300009098 Ga0105245_11652806 Ga0105245_116528061 112
32 3300009148 Ga0105243_10074464 Ga0105243_100744646 112
33 3300009148 Ga0105243_10156509 Ga0105243_101565092 112
34 3300011119 Ga0105246_10200352 Ga0105246_102003521 112
35 3300013297 Ga0157378_10000021 Ga0157378_1000002161 112
36 3300013297 Ga0157378_10000284 Ga0157378_1000028428 112
37 3300013308 Ga0157375_10000020 Ga0157375_10000020192 112
38 3300014326 Ga0157380_11412906 Ga0157380_114129061 112
39 3300025893 Ga0207682_10005028 Ga0207682_100050284 112
40 3300025909 Ga0207705_10043499 Ga0207705_100434995 112
41 3300025917 Ga0207660_10583291 Ga0207660_105832913 112
42 3300025920 Ga0207649_10583534 Ga0207649_105835342 112
43 3300025925 Ga0207650_10399753 Ga0207650_103997532 112
44 3300025926 Ga0207659_10219519 Ga0207659_102195192 112
45 3300025935 Ga0207709_10216573 Ga0207709_102165732 112
46 3300025935 Ga0207709_11242735 Ga0207709_112427351 112
47 3300025937 Ga0207669_10001103 Ga0207669_1000110311 112
48 3300025942 Ga0207689_10009504 Ga0207689_100095043 112
49 3300025942 Ga0207689_10175038 Ga0207689_101750383 112
50 3300025945 Ga0207679_10578177 Ga0207679_105781773 112
51 3300026089 Ga0207648_10065305 Ga0207648_100653053 112
52 3300026095 Ga0207676_10696197 Ga0207676_106961971 112
53 3300026116 Ga0207674_10450561 Ga0207674_104505612 112
54 3300027907 Ga0207428_10000240 Ga0207428_1000024015 112
55 3300028380 Ga0268265_10441312 Ga0268265_104413122 112
56 3300031548 Ga0307408_100167713 Ga0307408_1001677132 112
57 3300031731 Ga0307405_10049545 Ga0307405_100495452 112
58 3300031731 Ga0307405_11795657 Ga0307405_117956571 112
59 3300031824 Ga0307413_10294259 Ga0307413_102942592 112
60 3300031852 Ga0307410_10030060 Ga0307410_100300603 112
61 3300031903 Ga0307407_10000821 Ga0307407_100008216 112
62 3300031903 Ga0307407_10254726 Ga0307407_102547262 112
63 3300031911 Ga0307412_10356327 Ga0307412_103563271 112
64 3300031995 Ga0307409_100055631 Ga0307409_1000556312 112
65 3300031995 Ga0307409_101461332 Ga0307409_1014613321 112
66 3300032002 Ga0307416_102522382 Ga0307416_1025223821 112
67 3300032004 Ga0307414_10011345 Ga0307414_100113456 112
68 3300032005 Ga0307411_10177533 Ga0307411_101775332 112
69 3300032005 Ga0307411_10433372 Ga0307411_104333721 112
70 3300035088 Ga0373940_0366303 Ga0373940_0366303_97_438 112
71 3300042876 Ga0451577_0068300 Ga0451577_0068300_2661_2999 112
72 3300045051 Ga0451576_0516721 Ga0451576_0516721_589_927 112
73 3300045051 Ga0451576_1489766 Ga0451576_1489766_254_601 112
74 3300047446 Ga0495679_006539 Ga0495679_006539_661_999 112
75 3300049513 Ga0501290_038535 Ga0501290_038535_47_394 112
76 3300049522 Ga0501299_001342 Ga0501299_001342_2004_2351 112
77 3300049522 Ga0501299_185337 Ga0501299_185337_85_426 112
78 3300049672 Ga0501239_022731 Ga0501239_022731_368_715 112
79 3300049689 Ga0501260_008110 Ga0501260_008110_33_374 112
80 3300050512 nmdc:mga0n895_195127_c1 nmdc:mga0n895_195127_c1_64_402 112
81 3300050513 nmdc:mga0rr50_5730_c1 nmdc:mga0rr50_5730_c1_3656_3997 112
82 3300050515 nmdc:mga0a205_1403023_c1 nmdc:mga0a205_1403023_c1_102_440 112
83 3300050515 nmdc:mga0a205_211848_c1 nmdc:mga0a205_211848_c1_1318_1659 112
84 2162886011 MRS1b_contig_5709342 MRS1b_0612.00003130 113
85 3300003203 JGI25406J46586_10022344 JGI25406J46586_100223443 113
86 3300005290 Ga0065712_10154024 Ga0065712_101540242 113
87 3300005290 Ga0065712_10164050 Ga0065712_101640502 113
88 3300005293 Ga0065715_10000852 Ga0065715_100008527 113
89 3300005293 Ga0065715_10377913 Ga0065715_103779132 113
90 3300005295 Ga0065707_10283614 Ga0065707_102836143 113
91 3300005295 Ga0065707_10931732 Ga0065707_109317321 113
92 3300005328 Ga0070676_10872339 Ga0070676_108723392 113
93 3300005329 Ga0070683_100031897 Ga0070683_1000318973 113
94 3300005329 Ga0070683_100038488 Ga0070683_1000384884 113
95 3300005329 Ga0070683_102197062 Ga0070683_1021970622 113
96 3300005330 Ga0070690_100000182 Ga0070690_10000018228 113
97 3300005331 Ga0070670_100687737 Ga0070670_1006877372 113
98 3300005331 Ga0070670_101348107 Ga0070670_1013481071 113
99 3300005334 Ga0068869_100001373 Ga0068869_10000137313 113
100 3300005334 Ga0068869_100067914 Ga0068869_1000679143 113
101 3300005335 Ga0070666_10108389 Ga0070666_101083893 113
102 3300005336 Ga0070680_100001823 Ga0070680_10000182311 113
103 3300005336 Ga0070680_100217029 Ga0070680_1002170292 113
104 3300005337 Ga0070682_100004224 Ga0070682_1000042243 113
105 3300005340 Ga0070689_100000521 Ga0070689_10000052113 113
106 3300005340 Ga0070689_100145482 Ga0070689_1001454822 113
107 3300005341 Ga0070691_10232750 Ga0070691_102327501 113
108 3300005341 Ga0070691_10285356 Ga0070691_102853562 113
109 3300005343 Ga0070687_100000050 Ga0070687_10000005028 113
110 3300005345 Ga0070692_10003200 Ga0070692_100032009 113
111 3300005347 Ga0070668_101512614 Ga0070668_1015126141 113
112 3300005353 Ga0070669_100314556 Ga0070669_1003145563 113
113 3300005353 Ga0070669_101830559 Ga0070669_1018305591 113
114 3300005354 Ga0070675_100083077 Ga0070675_1000830773 113
115 3300005354 Ga0070675_101399856 Ga0070675_1013998562 113
116 3300005355 Ga0070671_100150805 Ga0070671_1001508053 113
117 3300005356 Ga0070674_101028233 Ga0070674_1010282332 113
118 3300005364 Ga0070673_100451793 Ga0070673_1004517933 113
119 3300005364 Ga0070673_100562180 Ga0070673_1005621803 113
120 3300005364 Ga0070673_100725951 Ga0070673_1007259511 113
121 3300005365 Ga0070688_100169490 Ga0070688_1001694902 113
122 3300005365 Ga0070688_101584001 Ga0070688_1015840011 113
123 3300005366 Ga0070659_100631526 Ga0070659_1006315262 113
124 3300005406 Ga0070703_10032807 Ga0070703_100328073 113
125 3300005437 Ga0070710_10392572 Ga0070710_103925722 113
126 3300005438 Ga0070701_10000918 Ga0070701_100009187 113
127 3300005438 Ga0070701_10045635 Ga0070701_100456353 113
128 3300005438 Ga0070701_10195014 Ga0070701_101950142 113
129 3300005439 Ga0070711_100959666 Ga0070711_1009596662 113
130 3300005440 Ga0070705_100000752 Ga0070705_1000007528 113
131 3300005440 Ga0070705_100226556 Ga0070705_1002265562 113
132 3300005440 Ga0070705_100444535 Ga0070705_1004445352 113
133 3300005441 Ga0070700_100002727 Ga0070700_1000027273 113
134 3300005441 Ga0070700_100128670 Ga0070700_1001286703 113
135 3300005441 Ga0070700_100583848 Ga0070700_1005838482 113
136 3300005444 Ga0070694_100000128 Ga0070694_10000012814 113
137 3300005444 Ga0070694_100059508 Ga0070694_1000595083 113
138 3300005444 Ga0070694_100183479 Ga0070694_1001834792 113
139 3300005444 Ga0070694_100489555 Ga0070694_1004895552 113
140 3300005456 Ga0070678_100562370 Ga0070678_1005623702 113
141 3300005459 Ga0068867_100000511 Ga0068867_10000051121 113
142 3300005459 Ga0068867_100183427 Ga0068867_1001834272 113
143 3300005466 Ga0070685_10154629 Ga0070685_101546292 113
144 3300005467 Ga0070706_100180461 Ga0070706_1001804611 113
145 3300005468 Ga0070707_100144802 Ga0070707_1001448023 113
146 3300005518 Ga0070699_100142935 Ga0070699_1001429353 113
147 3300005518 Ga0070699_100198203 Ga0070699_1001982033 113
148 3300005530 Ga0070679_100024943 Ga0070679_1000249432 113
149 3300005535 Ga0070684_100953182 Ga0070684_1009531821 113
150 3300005536 Ga0070697_100108337 Ga0070697_1001083372 113
151 3300005536 Ga0070697_100138526 Ga0070697_1001385264 113
152 3300005539 Ga0068853_100069631 Ga0068853_1000696313 113
153 3300005539 Ga0068853_100194024 Ga0068853_1001940242 113
154 3300005544 Ga0070686_100000107 Ga0070686_10000010746 113
155 3300005545 Ga0070695_100000172 Ga0070695_10000017220 113
156 3300005545 Ga0070695_100049306 Ga0070695_1000493064 113
157 3300005545 Ga0070695_100563120 Ga0070695_1005631202 113
158 3300005545 Ga0070695_100951603 Ga0070695_1009516031 113
159 3300005546 Ga0070696_100003396 Ga0070696_1000033968 113
160 3300005546 Ga0070696_100055349 Ga0070696_1000553493 113
161 3300005546 Ga0070696_100660720 Ga0070696_1006607201 113
162 3300005546 Ga0070696_100664618 Ga0070696_1006646182 113
163 3300005547 Ga0070693_100000078 Ga0070693_10000007821 113
164 3300005547 Ga0070693_100866776 Ga0070693_1008667762 113
165 3300005549 Ga0070704_100000954 Ga0070704_10000095414 113
166 3300005549 Ga0070704_100079226 Ga0070704_1000792263 113
167 3300005549 Ga0070704_100428714 Ga0070704_1004287143 113
168 3300005549 Ga0070704_101017437 Ga0070704_1010174371 113
169 3300005563 Ga0068855_100003138 Ga0068855_1000031383 113
170 3300005564 Ga0070664_100015684 Ga0070664_1000156843 113
171 3300005564 Ga0070664_100516421 Ga0070664_1005164212 113
172 3300005564 Ga0070664_100713815 Ga0070664_1007138152 113
173 3300005577 Ga0068857_100039119 Ga0068857_1000391193 113
174 3300005578 Ga0068854_100002169 Ga0068854_1000021697 113
175 3300005578 Ga0068854_100233145 Ga0068854_1002331452 113
176 3300005578 Ga0068854_100545479 Ga0068854_1005454792 113
177 3300005615 Ga0070702_100000048 Ga0070702_1000000488 113
178 3300005615 Ga0070702_100661554 Ga0070702_1006615542 113
179 3300005617 Ga0068859_100000873 Ga0068859_10000087315 113
180 3300005617 Ga0068859_100000945 Ga0068859_10000094525 113
181 3300005617 Ga0068859_100055279 Ga0068859_1000552794 113
182 3300005617 Ga0068859_100409051 Ga0068859_1004090512 113
183 3300005617 Ga0068859_101226619 Ga0068859_1012266192 113
184 3300005618 Ga0068864_101041177 Ga0068864_1010411771 113
185 3300005718 Ga0068866_10002975 Ga0068866_100029754 113
186 3300005719 Ga0068861_100000373 Ga0068861_10000037310 113
187 3300005719 Ga0068861_100005798 Ga0068861_1000057982 113
188 3300005719 Ga0068861_100019441 Ga0068861_1000194414 113
189 3300005719 Ga0068861_100328490 Ga0068861_1003284902 113
190 3300005840 Ga0068870_10252664 Ga0068870_102526642 113
191 3300005842 Ga0068858_100000324 Ga0068858_10000032427 113
192 3300005843 Ga0068860_100000687 Ga0068860_10000068714 113
193 3300005844 Ga0068862_100000430 Ga0068862_10000043028 113
194 3300005844 Ga0068862_100565809 Ga0068862_1005658092 113
195 3300005985 Ga0081539_10000091 Ga0081539_1000009124 113
196 3300005985 Ga0081539_10000188 Ga0081539_10000188126 113
197 3300006237 Ga0097621_100000180 Ga0097621_10000018023 113
198 3300006237 Ga0097621_101149966 Ga0097621_1011499662 113
199 3300006358 Ga0068871_100006394 Ga0068871_1000063946 113
200 3300006846 Ga0075430_100032174 Ga0075430_1000321743 113
201 3300006846 Ga0075430_100616647 Ga0075430_1006166472 113
202 3300006847 Ga0075431_100030540 Ga0075431_1000305403 113
203 3300006847 Ga0075431_100473564 Ga0075431_1004735642 113
204 3300006847 Ga0075431_101392947 Ga0075431_1013929472 113
205 3300006881 Ga0068865_100000148 Ga0068865_10000014814 113
206 3300006914 Ga0075436_100000090 Ga0075436_10000009029 113
207 3300006931 Ga0097620_100000874 Ga0097620_10000087420 113
208 3300006931 Ga0097620_100000945 Ga0097620_1000009453 113
209 3300006931 Ga0097620_100055275 Ga0097620_1000552753 113
210 3300006931 Ga0097620_100409065 Ga0097620_1004090652 113
211 3300006931 Ga0097620_101226541 Ga0097620_1012265411 113
212 3300009093 Ga0105240_10012540 Ga0105240_100125402 113
213 3300009093 Ga0105240_10318238 Ga0105240_103182383 113
214 3300009094 Ga0111539_10012520 Ga0111539_100125202 113
215 3300009098 Ga0105245_10000429 Ga0105245_1000042915 113
216 3300009098 Ga0105245_11186605 Ga0105245_111866052 113
217 3300009148 Ga0105243_10002289 Ga0105243_100022893 113
218 3300009148 Ga0105243_11746354 Ga0105243_117463542 113
219 3300009174 Ga0105241_10024619 Ga0105241_100246196 113
220 3300009176 Ga0105242_10002750 Ga0105242_1000275011 113
221 3300009176 Ga0105242_10049235 Ga0105242_100492351 113
222 3300009177 Ga0105248_10161431 Ga0105248_101614313 113
223 3300009545 Ga0105237_10027015 Ga0105237_100270152 113
224 3300009545 Ga0105237_10823190 Ga0105237_108231902 113
225 3300009551 Ga0105238_11157065 Ga0105238_111570651 113
226 3300009551 Ga0105238_12402771 Ga0105238_124027712 113
227 3300009553 Ga0105249_10003569 Ga0105249_1000356911 113
228 3300009553 Ga0105249_10313409 Ga0105249_103134093 113
229 3300009553 Ga0105249_10372014 Ga0105249_103720143 113
230 3300010375 Ga0105239_10568823 Ga0105239_105688232 113
231 3300011119 Ga0105246_10014351 Ga0105246_100143513 113
232 3300013102 Ga0157371_10663662 Ga0157371_106636622 113
233 3300013297 Ga0157378_10000513 Ga0157378_1000051328 113
234 3300013297 Ga0157378_11059231 Ga0157378_110592312 113
235 3300013306 Ga0163162_10586048 Ga0163162_105860482 113
236 3300013306 Ga0163162_11573737 Ga0163162_115737371 113
237 3300013307 Ga0157372_10535125 Ga0157372_105351253 113
238 3300013307 Ga0157372_12197881 Ga0157372_121978811 113
239 3300014326 Ga0157380_10048045 Ga0157380_100480454 113
240 3300014326 Ga0157380_10072238 Ga0157380_100722383 113
241 3300014326 Ga0157380_12109126 Ga0157380_121091261 113
242 3300014326 Ga0157380_12499040 Ga0157380_124990401 113
243 3300014745 Ga0157377_10099426 Ga0157377_100994263 113
244 3300014745 Ga0157377_10307853 Ga0157377_103078532 113
245 3300014745 Ga0157377_10560834 Ga0157377_105608342 113
246 3300014969 Ga0157376_10267266 Ga0157376_102672663 113
247 3300025885 Ga0207653_10102160 Ga0207653_101021601 113
248 3300025903 Ga0207680_10037896 Ga0207680_100378962 113
249 3300025904 Ga0207647_10228881 Ga0207647_102288812 113
250 3300025904 Ga0207647_10324184 Ga0207647_103241841 113
251 3300025908 Ga0207643_10108848 Ga0207643_101088482 113
252 3300025908 Ga0207643_10230598 Ga0207643_102305981 113
253 3300025908 Ga0207643_10475736 Ga0207643_104757363 113
254 3300025911 Ga0207654_10014187 Ga0207654_100141876 113
255 3300025913 Ga0207695_10341093 Ga0207695_103410932 113
256 3300025913 Ga0207695_10811480 Ga0207695_108114801 113
257 3300025914 Ga0207671_10124270 Ga0207671_101242703 113
258 3300025917 Ga0207660_10008569 Ga0207660_100085696 113
259 3300025917 Ga0207660_10097218 Ga0207660_100972182 113
260 3300025918 Ga0207662_10000165 Ga0207662_1000016522 113
261 3300025918 Ga0207662_10889673 Ga0207662_108896732 113
262 3300025918 Ga0207662_11154054 Ga0207662_111540541 113
263 3300025920 Ga0207649_11186258 Ga0207649_111862581 113
264 3300025921 Ga0207652_11390665 Ga0207652_113906652 113
265 3300025922 Ga0207646_10071424 Ga0207646_100714243 113
266 3300025923 Ga0207681_11042944 Ga0207681_110429442 113
267 3300025925 Ga0207650_10897952 Ga0207650_108979522 113
268 3300025927 Ga0207687_10005692 Ga0207687_100056923 113
269 3300025931 Ga0207644_10029249 Ga0207644_100292493 113
270 3300025932 Ga0207690_11138669 Ga0207690_111386692 113
271 3300025934 Ga0207686_10001102 Ga0207686_1000110214 113
272 3300025935 Ga0207709_10002487 Ga0207709_1000248712 113
273 3300025936 Ga0207670_10001683 Ga0207670_100016836 113
274 3300025936 Ga0207670_10546687 Ga0207670_105466872 113
275 3300025936 Ga0207670_11061509 Ga0207670_110615091 113
276 3300025937 Ga0207669_10140669 Ga0207669_101406691 113
277 3300025938 Ga0207704_10000191 Ga0207704_1000019120 113
278 3300025940 Ga0207691_10034424 Ga0207691_100344245 113
279 3300025941 Ga0207711_10110635 Ga0207711_101106353 113
280 3300025942 Ga0207689_10000475 Ga0207689_1000047528 113
281 3300025942 Ga0207689_10343384 Ga0207689_103433842 113
282 3300025942 Ga0207689_11342394 Ga0207689_113423941 113
283 3300025944 Ga0207661_10017386 Ga0207661_100173866 113
284 3300025944 Ga0207661_10658634 Ga0207661_106586342 113
285 3300025945 Ga0207679_10291453 Ga0207679_102914532 113
286 3300025945 Ga0207679_10774025 Ga0207679_107740251 113
287 3300025945 Ga0207679_10979208 Ga0207679_109792082 113
288 3300025949 Ga0207667_10096961 Ga0207667_100969613 113
289 3300025960 Ga0207651_10032443 Ga0207651_100324432 113
290 3300025960 Ga0207651_10684554 Ga0207651_106845541 113
291 3300025960 Ga0207651_10699062 Ga0207651_106990623 113
292 3300025961 Ga0207712_10021339 Ga0207712_100213392 113
293 3300025961 Ga0207712_10321824 Ga0207712_103218243 113
294 3300025981 Ga0207640_10001793 Ga0207640_100017938 113
295 3300025981 Ga0207640_10413320 Ga0207640_104133202 113
296 3300025981 Ga0207640_11054358 Ga0207640_110543582 113
297 3300026023 Ga0207677_10334897 Ga0207677_103348972 113
298 3300026041 Ga0207639_10025987 Ga0207639_100259873 113
299 3300026075 Ga0207708_10000465 Ga0207708_1000046513 113
300 3300026075 Ga0207708_10031344 Ga0207708_100313446 113
301 3300026075 Ga0207708_10114429 Ga0207708_101144292 113
302 3300026075 Ga0207708_10498683 Ga0207708_104986832 113
303 3300026078 Ga0207702_10067906 Ga0207702_100679063 113
304 3300026089 Ga0207648_10000171 Ga0207648_1000017128 113
305 3300026089 Ga0207648_10069166 Ga0207648_100691662 113
306 3300026089 Ga0207648_12049557 Ga0207648_120495572 113
307 3300026116 Ga0207674_10051091 Ga0207674_100510913 113
308 3300026118 Ga0207675_100000321 Ga0207675_10000032120 113
309 3300026118 Ga0207675_100002130 Ga0207675_10000213013 113
310 3300026118 Ga0207675_100018994 Ga0207675_1000189944 113
311 3300026121 Ga0207683_10119815 Ga0207683_101198153 113
312 3300028379 Ga0268266_10247315 Ga0268266_102473152 113
313 3300028379 Ga0268266_11479443 Ga0268266_114794432 113
314 3300028380 Ga0268265_10000632 Ga0268265_1000063215 113
315 3300028380 Ga0268265_10781437 Ga0268265_107814372 113
316 3300028381 Ga0268264_10000745 Ga0268264_1000074533 113
317 3300031250 Ga0265331_10057515 Ga0265331_100575152 113
318 3300031507 Ga0307509_10215126 Ga0307509_102151262 113
319 3300031548 Ga0307408_100282432 Ga0307408_1002824323 113
320 3300031548 Ga0307408_101062940 Ga0307408_1010629402 113
321 3300031548 Ga0307408_101375202 Ga0307408_1013752022 113
322 3300031730 Ga0307516_10046181 Ga0307516_100461814 113
323 3300031731 Ga0307405_10138546 Ga0307405_101385462 113
324 3300031824 Ga0307413_11975719 Ga0307413_119757192 113
325 3300031852 Ga0307410_10451216 Ga0307410_104512163 113
326 3300031852 Ga0307410_10982337 Ga0307410_109823372 113
327 3300031901 Ga0307406_10754885 Ga0307406_107548851 113
328 3300031903 Ga0307407_10231963 Ga0307407_102319632 113
329 3300031911 Ga0307412_11723381 Ga0307412_117233811 113
330 3300031995 Ga0307409_102201696 Ga0307409_1022016962 113
331 3300031995 Ga0307409_102253214 Ga0307409_1022532141 113
332 3300032002 Ga0307416_100160004 Ga0307416_1001600041 113
333 3300032002 Ga0307416_101637302 Ga0307416_1016373022 113
334 3300032002 Ga0307416_101711942 Ga0307416_1017119421 113
335 3300032005 Ga0307411_10143089 Ga0307411_101430892 113
336 3300032005 Ga0307411_11353257 Ga0307411_113532571 113
337 3300032005 Ga0307411_11663105 Ga0307411_116631051 113
338 3300034819 Ga0373958_0129211 Ga0373958_0129211_100_450 113
339 3300034820 Ga0373959_0092875 Ga0373959_0092875_14_364 113
340 3300034957 Ga0373938_0088115 Ga0373938_0088115_84_434 113
341 3300035084 Ga0373928_0100928 Ga0373928_0100928_386_736 113
342 3300035084 Ga0373928_0281496 Ga0373928_0281496_132_485 113
343 3300035089 Ga0373944_0004892 Ga0373944_0004892_281_631 113
344 3300035092 Ga0373952_0007643 Ga0373952_0007643_1010_1360 113
345 3300035112 Ga0373932_0003211 Ga0373932_0003211_39_389 113
346 3300035112 Ga0373932_0043951 Ga0373932_0043951_37_387 113
347 3300035113 Ga0373936_0008581 Ga0373936_0008581_1441_1791 113
348 3300035116 Ga0373945_0011311 Ga0373945_0011311_1312_1662 113
349 3300035121 Ga0373960_0131757 Ga0373960_0131757_289_639 113
350 3300035241 Ga0373961_0046654 Ga0373961_0046654_364_714 113
351 3300035692 Ga0373935_0508355 Ga0373935_0508355_226_582 113
352 3300037471 Ga0395905_1222433 Ga0395905_1222433_145_501 113
353 3300039450 Ga0436363_1567351 Ga0436363_1567351_132_485 113
354 3300041486 Ga0451807_0100411 Ga0451807_0100411_43_384 113
355 3300041501 Ga0451845_0158314 Ga0451845_0158314_167_517 113
356 3300041999 Ga0439433_0188567 Ga0439433_0188567_59_400 113
357 3300042876 Ga0451577_0050312 Ga0451577_0050312_1779_2129 113
358 3300042876 Ga0451577_0153215 Ga0451577_0153215_326_679 113
359 3300044712 Ga0453684_0002647 Ga0453684_0002647_12023_12385 113
360 3300044712 Ga0453684_0475849 Ga0453684_0475849_921_1274 113
361 3300044901 Ga0466960_0852919 Ga0466960_0852919_49_411 113
362 3300045051 Ga0451576_0002358 Ga0451576_0002358_17690_18040 113
363 3300045051 Ga0451576_0348735 Ga0451576_0348735_580_927 113
364 3300045976 Ga0466967_0938744 Ga0466967_0938744_183_536 113
365 3300046460 Ga0495638_0277000 Ga0495638_0277000_187_543 113
366 3300046460 Ga0495638_0639894 Ga0495638_0639894_117_467 113
367 3300046506 Ga0495583_0207862 Ga0495583_0207862_322_672 113
368 3300046530 Ga0495654_0338361 Ga0495654_0338361_172_522 113
369 3300046684 Ga0495669_0150422 Ga0495669_0150422_322_669 113
370 3300046684 Ga0495669_0216704 Ga0495669_0216704_65_418 113
371 3300046692 Ga0495671_0278225 Ga0495671_0278225_372_725 113
372 3300046794 Ga0495589_0147358 Ga0495589_0147358_668_1018 113
373 3300047319 Ga0495674_0392808 Ga0495674_0392808_297_638 113
374 3300047445 Ga0495677_0417975 Ga0495677_0417975_141_488 113
375 3300048905 Ga0496102_1044710 Ga0496102_1044710_54_419 113
376 3300048907 Ga0496104_0248897 Ga0496104_0248897_670_1014 113
377 3300048907 Ga0496104_0328652 Ga0496104_0328652_1040_1387 113
378 3300049568 Ga0501031_0007183 Ga0501031_0007183_6178_6540 113
379 3300049568 Ga0501031_0485588 Ga0501031_0485588_418_765 113
380 3300049588 Ga0501072_0193252 Ga0501072_0193252_677_1027 113
381 3300049590 Ga0501074_0636254 Ga0501074_0636254_18_368 113
382 3300049592 Ga0501076_0301607 Ga0501076_0301607_207_548 113
383 3300049593 Ga0501077_0647394 Ga0501077_0647394_132_485 113
384 3300049654 Ga0501207_050890 Ga0501207_050890_152_496 113
385 3300049670 Ga0501236_012760 Ga0501236_012760_454_801 113
386 3300049677 Ga0501247_056720 Ga0501247_056720_238_582 113
387 3300049705 Ga0501225_0342893 Ga0501225_0342893_11_358 113
388 3300049779 Ga0501283_123166 Ga0501283_123166_152_496 113
389 3300050507 nmdc:mga05p37_550054_c1 nmdc:mga05p37_550054_c1_121_468 113
390 3300050509 nmdc:mga0qj67_37792_c1 nmdc:mga0qj67_37792_c1_3325_3666 113
391 3300053092 Ga0500583_0040903 Ga0500583_0040903_1731_2075 113
392 3300053093 Ga0500651_0171534 Ga0500651_0171534_887_1231 113
393 3300053096 Ga0500641_0213721 Ga0500641_0213721_294_638 113
394 3300053104 Ga0500556_0153828 Ga0500556_0153828_156_500 113
395 3300053108 Ga0500562_174563 Ga0500562_174563_58_402 113
396 3300053124 Ga0500617_056688 Ga0500617_056688_39_383 113
397 3300053134 Ga0500658_0026434 Ga0500658_0026434_775_1119 113
398 3300053146 Ga0500588_0003745 Ga0500588_0003745_1724_2068 113
399 3300053177 Ga0500636_0000139 Ga0500636_0000139_26140_26511 113
400 3300053732 Ga0500656_012031 Ga0500656_012031_236_580 113
401 3300054114 Ga0501084_1367084 Ga0501084_1367084_66_416 113
402 3300059421 Ga0590071_016811 Ga0590071_016811_87_455 113
403 3300060353 Ga0501082_1379228 Ga0501082_1379228_227_601 113
404 iso_pu_bacteria 2547132512 2548846303 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

32

136

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.7241 7 110
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6902 7 110
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6753 7 110
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.666 7 107
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.6654 7 110
ID Description Score Start End Superfamily
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7953 6 113 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7948 8 112 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7816 7 110 1.10.3730.20
af_Q69YG0_38_145_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7716 7 110 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7697 7 113 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A4Q6CTP5-F1-model_v4 deleted 0.9774 3 102
AF-A0A2M7PBL8-F1-model_v4 DMT family protein 0.9755 1 86 GO:0016020
AF-A0A6I3RYD6-F1-model_v4 DMT family protein 0.9652 3 112
AF-A0A2M7PBL8-F1-model_v4 DMT family protein 0.9646 1 86 GO:0016020
AF-A0A2H0CFC1-F1-model_v4 DMT family protein 0.9641 2 112 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.46 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map