F435586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 206 | 802 | 477 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100251572|Ga0070683_1002515721 |
| Length | 511 |
| Sequence | MKISINNSLNSLSAETQASDNKKTNYSLMKKRIKIIGTVVLLSLGLNKSTIAQVGKPFIHDPSTITECEGKYYTFGTGGGGLISEDGWRWNGGGVRPGGGAAPDVVKIGDRYLVVYGATGGGLGGGHNGRILTMWNKTLDPKSPDFKYTEAVVVASSDGKEDNDAIDPGLLLDPTDGRLWLSYGTYFGFIRLVELDPKTGKRVEGNKAINIAIDCEATDLMYRDGWYYLLGTHGTCCDGANSTYNIVVGRSKKVTGPYLDNMGRDMIKGGGKMVLAASDRLLGPGHFGRVVIGDGVEKMSCHYEADLDQSGRSVLGIRPLLWKNGWPLAGEIFKEGTYEIESERRGYALELVVDFTRMPGGPRGFNRANDEPIKPVASQQLADVIKTWPTGNIGARIGDYMGRPHQKWTITAAPDTVGYLGGSYYKIVIAGTDRALAATADAEVTTVPTFTGAPEQLWRIDQLIDGTYRIMPKVVPNSGKKLALVSSGDSTPTLAEFDFNSDNSKWNFKAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 125 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 135 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 185 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 188 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 189 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 193 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 194 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 195 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 196 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 197 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 198 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 199 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 200 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 201 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 202 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 203 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 204 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 205 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 206 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0 |
| Isolates | 3.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 91.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100251572 | 3300005329 | Bacteria | 1681 |
| 2 | JGI24736J21556_1000523 | 3300001904 | Bacteria | 7155 |
| 3 | rootH1_10005922 | 3300003316 | Bacteria | 19957 |
| 4 | rootH1_10017603 | 3300003316 | Bacteria | 25834 |
| 5 | rootH2_10020059 | 3300003320 | Unclassified | 2941 |
| 6 | rootH2_10055859 | 3300003320 | Bacteria | 26943 |
| 7 | rootL2_10199803 | 3300003322 | Bacteria | 5029 |
| 8 | rootL2_10229607 | 3300003322 | Bacteria | 2498 |
| 9 | rootH1_10019484 | 3300003323 | Bacteria | 37264 |
| 10 | rootH1_10035803 | 3300003323 | Unclassified | 3253 |
| 11 | Ga0065712_10003886 | 3300005290 | Bacteria | 3475 |
| 12 | Ga0065712_10020399 | 3300005290 | Bacteria | 2183 |
| 13 | Ga0070658_10006373 | 3300005327 | Bacteria | 9562 |
| 14 | Ga0070658_10049928 | 3300005327 | Bacteria | 3390 |
| 15 | Ga0070658_10083676 | 3300005327 | Unclassified | 2623 |
| 16 | Ga0070658_10174907 | 3300005327 | Bacteria | 1805 |
| 17 | Ga0070658_10224512 | 3300005327 | Bacteria | 1589 |
| 18 | Ga0070676_10004279 | 3300005328 | Bacteria | 7502 |
| 19 | Ga0070683_100003502 | 3300005329 | Bacteria | 12764 |
| 20 | Ga0070683_100026520 | 3300005329 | Bacteria | 5219 |
| 21 | Ga0070683_100087425 | 3300005329 | Bacteria | 2923 |
| 22 | Ga0070670_100005179 | 3300005331 | Bacteria | 10975 |
| 23 | Ga0070670_100152886 | 3300005331 | Bacteria | 1997 |
| 24 | Ga0068869_100005738 | 3300005334 | Bacteria | 7836 |
| 25 | Ga0068868_100008133 | 3300005338 | Bacteria | 7503 |
| 26 | Ga0068868_100115392 | 3300005338 | Bacteria | 2186 |
| 27 | Ga0070660_100016083 | 3300005339 | Bacteria | 5422 |
| 28 | Ga0070660_100021396 | 3300005339 | Bacteria | 4769 |
| 29 | Ga0070660_100025120 | 3300005339 | Bacteria | 4427 |
| 30 | Ga0070689_100027861 | 3300005340 | Bacteria | 4263 |
| 31 | Ga0070689_100030083 | 3300005340 | Unclassified | 4118 |
| 32 | Ga0070661_100004688 | 3300005344 | Bacteria | 9414 |
| 33 | Ga0070661_100028193 | 3300005344 | Bacteria | 4048 |
| 34 | Ga0070661_100033799 | 3300005344 | Bacteria | 3706 |
| 35 | Ga0070671_100061828 | 3300005355 | Bacteria | 3119 |
| 36 | Ga0070671_100154321 | 3300005355 | Bacteria | 1939 |
| 37 | Ga0070674_100091079 | 3300005356 | Bacteria | 2201 |
| 38 | Ga0070673_100000016 | 3300005364 | Bacteria | 114927 |
| 39 | Ga0070673_100017134 | 3300005364 | Bacteria | 5143 |
| 40 | Ga0070673_100049983 | 3300005364 | Bacteria | 3267 |
| 41 | Ga0070659_100025186 | 3300005366 | Bacteria | 4567 |
| 42 | Ga0070659_100041864 | 3300005366 | Bacteria | 3581 |
| 43 | Ga0070667_100119414 | 3300005367 | Bacteria | 2292 |
| 44 | Ga0070667_100178717 | 3300005367 | Bacteria | 1876 |
| 45 | Ga0070714_100111506 | 3300005435 | Bacteria | 2423 |
| 46 | Ga0070713_100003138 | 3300005436 | Bacteria | 10878 |
| 47 | Ga0070663_100000576 | 3300005455 | Bacteria | 19619 |
| 48 | Ga0070663_100010215 | 3300005455 | Bacteria | 5846 |
| 49 | Ga0070662_100000479 | 3300005457 | Bacteria | 23707 |
| 50 | Ga0070681_10040154 | 3300005458 | Bacteria | 4691 |
| 51 | Ga0068867_100000962 | 3300005459 | Bacteria | 19626 |
| 52 | Ga0068867_100008348 | 3300005459 | Bacteria | 7308 |
| 53 | Ga0070685_10029194 | 3300005466 | Bacteria | 3062 |
| 54 | Ga0070685_10108195 | 3300005466 | Unclassified | 1708 |
| 55 | Ga0070698_100017592 | 3300005471 | Bacteria | 7533 |
| 56 | Ga0070679_100057757 | 3300005530 | Bacteria | 3868 |
| 57 | Ga0070679_100095177 | 3300005530 | Bacteria | 2966 |
| 58 | Ga0068853_100001281 | 3300005539 | Bacteria | 18024 |
| 59 | Ga0068853_100007517 | 3300005539 | Bacteria | 8723 |
| 60 | Ga0068853_100078046 | 3300005539 | Bacteria | 2894 |
| 61 | Ga0068853_100209319 | 3300005539 | Bacteria | 1777 |
| 62 | Ga0068855_100000007 | 3300005563 | Bacteria | 273676 |
| 63 | Ga0068855_100000035 | 3300005563 | Bacteria | 165487 |
| 64 | Ga0068855_100000125 | 3300005563 | Bacteria | 96961 |
| 65 | Ga0068855_100032817 | 3300005563 | Bacteria | 6198 |
| 66 | Ga0068855_100145986 | 3300005563 | Bacteria | 2693 |
| 67 | Ga0070664_100021816 | 3300005564 | Bacteria | 5279 |
| 68 | Ga0070664_100039772 | 3300005564 | Bacteria | 3963 |
| 69 | Ga0070664_100102830 | 3300005564 | Bacteria | 2486 |
| 70 | Ga0068857_100047911 | 3300005577 | Bacteria | 3795 |
| 71 | Ga0068857_100149655 | 3300005577 | Bacteria | 2114 |
| 72 | Ga0068857_100169154 | 3300005577 | Bacteria | 1986 |
| 73 | Ga0068854_100000092 | 3300005578 | Bacteria | 63516 |
| 74 | Ga0068854_100013629 | 3300005578 | Bacteria | 5342 |
| 75 | Ga0068854_100077358 | 3300005578 | Bacteria | 2448 |
| 76 | Ga0068856_100000063 | 3300005614 | Bacteria | 99730 |
| 77 | Ga0068856_100002132 | 3300005614 | Bacteria | 20518 |
| 78 | Ga0068852_100028665 | 3300005616 | Bacteria | 4561 |
| 79 | Ga0068852_100030909 | 3300005616 | Bacteria | 4413 |
| 80 | Ga0068852_100040690 | 3300005616 | Bacteria | 3923 |
| 81 | Ga0068859_100009722 | 3300005617 | Bacteria | 9712 |
| 82 | Ga0068859_100056580 | 3300005617 | Bacteria | 3948 |
| 83 | Ga0068864_100023383 | 3300005618 | Bacteria | 5189 |
| 84 | Ga0068861_100030366 | 3300005719 | Bacteria | 3960 |
| 85 | Ga0068863_100007353 | 3300005841 | Bacteria | 10779 |
| 86 | Ga0068863_100031610 | 3300005841 | Bacteria | 5050 |
| 87 | Ga0068863_100075192 | 3300005841 | Bacteria | 3196 |
| 88 | Ga0068863_100076171 | 3300005841 | Bacteria | 3174 |
| 89 | Ga0068858_100013656 | 3300005842 | Bacteria | 7664 |
| 90 | Ga0097621_100027639 | 3300006237 | Bacteria | 4463 |
| 91 | Ga0068865_100000026 | 3300006881 | Bacteria | 93349 |
| 92 | Ga0068865_100023849 | 3300006881 | Bacteria | 4011 |
| 93 | Ga0097620_100009722 | 3300006931 | Bacteria | 9712 |
| 94 | Ga0097620_100056577 | 3300006931 | Bacteria | 3948 |
| 95 | Ga0105240_10000025 | 3300009093 | Bacteria | 367124 |
| 96 | Ga0105240_10001016 | 3300009093 | Bacteria | 50008 |
| 97 | Ga0105240_10001737 | 3300009093 | Bacteria | 36795 |
| 98 | Ga0105240_10002867 | 3300009093 | Bacteria | 27262 |
| 99 | Ga0105240_10026091 | 3300009093 | Bacteria | 7671 |
| 100 | Ga0105240_10062653 | 3300009093 | Bacteria | 4629 |
| 101 | Ga0105240_10078148 | 3300009093 | Bacteria | 4076 |
| 102 | Ga0105240_10094455 | 3300009093 | Bacteria | 3648 |
| 103 | Ga0105240_10147555 | 3300009093 | Bacteria | 2805 |
| 104 | Ga0111539_10227279 | 3300009094 | Bacteria | 2173 |
| 105 | Ga0105245_10003035 | 3300009098 | Bacteria | 15050 |
| 106 | Ga0105247_10009665 | 3300009101 | Bacteria | 5849 |
| 107 | Ga0105247_10147979 | 3300009101 | Bacteria | 1545 |
| 108 | Ga0105243_10000394 | 3300009148 | Bacteria | 46074 |
| 109 | Ga0105241_10012337 | 3300009174 | Bacteria | 6267 |
| 110 | Ga0105241_10127097 | 3300009174 | Bacteria | 2060 |
| 111 | Ga0105242_10000137 | 3300009176 | Bacteria | 53136 |
| 112 | Ga0105242_10008291 | 3300009176 | Bacteria | 7983 |
| 113 | Ga0105237_10000130 | 3300009545 | Bacteria | 105282 |
| 114 | Ga0105237_10001236 | 3300009545 | Bacteria | 34077 |
| 115 | Ga0105237_10003126 | 3300009545 | Bacteria | 19922 |
| 116 | Ga0105237_10009906 | 3300009545 | Bacteria | 10174 |
| 117 | Ga0105237_10135902 | 3300009545 | Bacteria | 2453 |
| 118 | Ga0105237_10179618 | 3300009545 | Bacteria | 2117 |
| 119 | Ga0105238_10004413 | 3300009551 | Bacteria | 13951 |
| 120 | Ga0105238_10006795 | 3300009551 | Bacteria | 11425 |
| 121 | Ga0105238_10064176 | 3300009551 | Bacteria | 3673 |
| 122 | Ga0105238_10066980 | 3300009551 | Bacteria | 3592 |
| 123 | Ga0105249_10006774 | 3300009553 | Bacteria | 9982 |
| 124 | Ga0105249_10012551 | 3300009553 | Bacteria | 7468 |
| 125 | Ga0105249_10047304 | 3300009553 | Bacteria | 3919 |
| 126 | Ga0105249_10086313 | 3300009553 | Bacteria | 2927 |
| 127 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 128 | Ga0105239_10000605 | 3300010375 | Bacteria | 51086 |
| 129 | Ga0105239_10011594 | 3300010375 | Bacteria | 9833 |
| 130 | Ga0105246_10001927 | 3300011119 | Bacteria | 12509 |
| 131 | Ga0157373_10006307 | 3300013100 | Bacteria | 8861 |
| 132 | Ga0157373_10010274 | 3300013100 | Bacteria | 6897 |
| 133 | Ga0157373_10087157 | 3300013100 | Bacteria | 2200 |
| 134 | Ga0157371_10001497 | 3300013102 | Bacteria | 24172 |
| 135 | Ga0157371_10002301 | 3300013102 | Bacteria | 18394 |
| 136 | Ga0157371_10005464 | 3300013102 | Bacteria | 10712 |
| 137 | Ga0157371_10007442 | 3300013102 | Bacteria | 8865 |
| 138 | Ga0157370_10001067 | 3300013104 | Bacteria | 34290 |
| 139 | Ga0157370_10050650 | 3300013104 | Bacteria | 3969 |
| 140 | Ga0157369_10000238 | 3300013105 | Bacteria | 76209 |
| 141 | Ga0157369_10004653 | 3300013105 | Bacteria | 16126 |
| 142 | Ga0157369_10014121 | 3300013105 | Bacteria | 9028 |
| 143 | Ga0157374_10006730 | 3300013296 | Bacteria | 9768 |
| 144 | Ga0157378_10000854 | 3300013297 | Bacteria | 28266 |
| 145 | Ga0163162_10012970 | 3300013306 | Bacteria | 8133 |
| 146 | Ga0163162_10022587 | 3300013306 | Bacteria | 6202 |
| 147 | Ga0163162_10205962 | 3300013306 | Bacteria | 2096 |
| 148 | Ga0157372_10000020 | 3300013307 | Bacteria | 208056 |
| 149 | Ga0157372_10013483 | 3300013307 | Bacteria | 8736 |
| 150 | Ga0157372_10015450 | 3300013307 | Bacteria | 8183 |
| 151 | Ga0157372_10021230 | 3300013307 | Bacteria | 7015 |
| 152 | Ga0157372_10141036 | 3300013307 | Bacteria | 2776 |
| 153 | Ga0157375_10000503 | 3300013308 | Bacteria | 35295 |
| 154 | Ga0157375_10071309 | 3300013308 | Bacteria | 3487 |
| 155 | Ga0157375_10088794 | 3300013308 | Bacteria | 3146 |
| 156 | Ga0163163_10057819 | 3300014325 | Bacteria | 3835 |
| 157 | Ga0157380_10151588 | 3300014326 | Bacteria | 2005 |
| 158 | Ga0157377_10009290 | 3300014745 | Bacteria | 4817 |
| 159 | Ga0157379_10085224 | 3300014968 | Unclassified | 2831 |
| 160 | Ga0163161_10094945 | 3300017792 | Bacteria | 2211 |
| 161 | Ga0163161_10191478 | 3300017792 | Bacteria | 1573 |
| 162 | Ga0209026_1002621 | 3300025250 | Bacteria | 6569 |
| 163 | Ga0209026_1006398 | 3300025250 | Bacteria | 2893 |
| 164 | Ga0209455_1003716 | 3300025272 | Bacteria | 5281 |
| 165 | Ga0207647_10009891 | 3300025904 | Bacteria | 6755 |
| 166 | Ga0207645_10008418 | 3300025907 | Bacteria | 7195 |
| 167 | Ga0207705_10000383 | 3300025909 | Bacteria | 39578 |
| 168 | Ga0207705_10000669 | 3300025909 | Bacteria | 28496 |
| 169 | Ga0207705_10001068 | 3300025909 | Bacteria | 22281 |
| 170 | Ga0207705_10012489 | 3300025909 | Bacteria | 6136 |
| 171 | Ga0207654_10083334 | 3300025911 | Bacteria | 1930 |
| 172 | Ga0207707_10056208 | 3300025912 | Bacteria | 3424 |
| 173 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 174 | Ga0207695_10002290 | 3300025913 | Bacteria | 28600 |
| 175 | Ga0207695_10009245 | 3300025913 | Bacteria | 12214 |
| 176 | Ga0207695_10023247 | 3300025913 | Bacteria | 7011 |
| 177 | Ga0207695_10074901 | 3300025913 | Bacteria | 3445 |
| 178 | Ga0207695_10081274 | 3300025913 | Bacteria | 3280 |
| 179 | Ga0207671_10001177 | 3300025914 | Bacteria | 31119 |
| 180 | Ga0207671_10003751 | 3300025914 | Bacteria | 14957 |
| 181 | Ga0207671_10014831 | 3300025914 | Bacteria | 6138 |
| 182 | Ga0207657_10000077 | 3300025919 | Bacteria | 92227 |
| 183 | Ga0207657_10005036 | 3300025919 | Bacteria | 13864 |
| 184 | Ga0207657_10013117 | 3300025919 | Bacteria | 8139 |
| 185 | Ga0207649_10001205 | 3300025920 | Bacteria | 15596 |
| 186 | Ga0207649_10017837 | 3300025920 | Bacteria | 4026 |
| 187 | Ga0207649_10036468 | 3300025920 | Bacteria | 2962 |
| 188 | Ga0207652_10000776 | 3300025921 | Bacteria | 30553 |
| 189 | Ga0207652_10004689 | 3300025921 | Bacteria | 11085 |
| 190 | Ga0207652_10011329 | 3300025921 | Bacteria | 7185 |
| 191 | Ga0207681_10018016 | 3300025923 | Bacteria | 4443 |
| 192 | Ga0207694_10008213 | 3300025924 | Bacteria | 7891 |
| 193 | Ga0207694_10022742 | 3300025924 | Bacteria | 4755 |
| 194 | Ga0207650_10000926 | 3300025925 | Bacteria | 22125 |
| 195 | Ga0207687_10003505 | 3300025927 | Bacteria | 10555 |
| 196 | Ga0207700_10145100 | 3300025928 | Unclassified | 1955 |
| 197 | Ga0207644_10116596 | 3300025931 | Bacteria | 2027 |
| 198 | Ga0207690_10015148 | 3300025932 | Bacteria | 4669 |
| 199 | Ga0207690_10027257 | 3300025932 | Bacteria | 3610 |
| 200 | Ga0207706_10000204 | 3300025933 | Bacteria | 65744 |
| 201 | Ga0207686_10001220 | 3300025934 | Bacteria | 14932 |
| 202 | Ga0207686_10004559 | 3300025934 | Bacteria | 7425 |
| 203 | Ga0207686_10008098 | 3300025934 | Bacteria | 5668 |
| 204 | Ga0207709_10000187 | 3300025935 | Bacteria | 82937 |
| 205 | Ga0207670_10006497 | 3300025936 | Bacteria | 6488 |
| 206 | Ga0207670_10019948 | 3300025936 | Unclassified | 4107 |
| 207 | Ga0207704_10000006 | 3300025938 | Bacteria | 220005 |
| 208 | Ga0207689_10001911 | 3300025942 | Bacteria | 19691 |
| 209 | Ga0207661_10019718 | 3300025944 | Bacteria | 5033 |
| 210 | Ga0207679_10042450 | 3300025945 | Bacteria | 3269 |
| 211 | Ga0207679_10064430 | 3300025945 | Bacteria | 2739 |
| 212 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 213 | Ga0207667_10000038 | 3300025949 | Bacteria | 280720 |
| 214 | Ga0207667_10000984 | 3300025949 | Bacteria | 36433 |
| 215 | Ga0207667_10039034 | 3300025949 | Bacteria | 5062 |
| 216 | Ga0207667_10080230 | 3300025949 | Bacteria | 3381 |
| 217 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 218 | Ga0207651_10056679 | 3300025960 | Bacteria | 2698 |
| 219 | Ga0207712_10007576 | 3300025961 | Bacteria | 6860 |
| 220 | Ga0207712_10035418 | 3300025961 | Bacteria | 3391 |
| 221 | Ga0207668_10154343 | 3300025972 | Bacteria | 1782 |
| 222 | Ga0207640_10000142 | 3300025981 | Bacteria | 52324 |
| 223 | Ga0207640_10000219 | 3300025981 | Bacteria | 40135 |
| 224 | Ga0207677_10000016 | 3300026023 | Bacteria | 153771 |
| 225 | Ga0207677_10004445 | 3300026023 | Bacteria | 7526 |
| 226 | Ga0207639_10005197 | 3300026041 | Bacteria | 8780 |
| 227 | Ga0207639_10012823 | 3300026041 | Bacteria | 5848 |
| 228 | Ga0207678_10003654 | 3300026067 | Bacteria | 13821 |
| 229 | Ga0207678_10014796 | 3300026067 | Bacteria | 6865 |
| 230 | Ga0207678_10105110 | 3300026067 | Bacteria | 2409 |
| 231 | Ga0207702_10000508 | 3300026078 | Bacteria | 43847 |
| 232 | Ga0207641_10000013 | 3300026088 | Bacteria | 341378 |
| 233 | Ga0207641_10012744 | 3300026088 | Bacteria | 6894 |
| 234 | Ga0207641_10025238 | 3300026088 | Bacteria | 4901 |
| 235 | Ga0207641_10097331 | 3300026088 | Bacteria | 2586 |
| 236 | Ga0207648_10000042 | 3300026089 | Bacteria | 114885 |
| 237 | Ga0207648_10008386 | 3300026089 | Bacteria | 10015 |
| 238 | Ga0207674_10025180 | 3300026116 | Bacteria | 6349 |
| 239 | Ga0207675_100161036 | 3300026118 | Bacteria | 2140 |
| 240 | Ga0207698_10002293 | 3300026142 | Bacteria | 11334 |
| 241 | Ga0207698_10048761 | 3300026142 | Bacteria | 3218 |
| 242 | Ga0207698_10090558 | 3300026142 | Bacteria | 2502 |
| 243 | Ga0265337_1000099 | 3300028556 | Bacteria | 42527 |
| 244 | Ga0265319_1000219 | 3300028563 | Bacteria | 42787 |
| 245 | Ga0265334_10002323 | 3300028573 | Bacteria | 8950 |
| 246 | Ga0265318_10001424 | 3300028577 | Bacteria | 14152 |
| 247 | Ga0265322_10002800 | 3300028654 | Bacteria | 5326 |
| 248 | Ga0265336_10000568 | 3300028666 | Bacteria | 20940 |
| 249 | Ga0265336_10002559 | 3300028666 | Bacteria | 7441 |
| 250 | Ga0265336_10003497 | 3300028666 | Bacteria | 6147 |
| 251 | Ga0307515_10001422 | 3300028794 | Bacteria | 54180 |
| 252 | Ga0265338_10000781 | 3300028800 | Bacteria | 53976 |
| 253 | Ga0265338_10001890 | 3300028800 | Bacteria | 32781 |
| 254 | Ga0265338_10012330 | 3300028800 | Bacteria | 9751 |
| 255 | Ga0265338_10016725 | 3300028800 | Bacteria | 7948 |
| 256 | Ga0265324_10003182 | 3300029957 | Bacteria | 7944 |
| 257 | Ga0265330_10008733 | 3300031235 | Bacteria | 4857 |
| 258 | Ga0265328_10033574 | 3300031239 | Bacteria | 1902 |
| 259 | Ga0265320_10008459 | 3300031240 | Bacteria | 6298 |
| 260 | Ga0265325_10000327 | 3300031241 | Bacteria | 33635 |
| 261 | Ga0265329_10031247 | 3300031242 | Bacteria | 1731 |
| 262 | Ga0265340_10014624 | 3300031247 | Bacteria | 4094 |
| 263 | Ga0265339_10001000 | 3300031249 | Bacteria | 21539 |
| 264 | Ga0265339_10001428 | 3300031249 | Bacteria | 17718 |
| 265 | Ga0265331_10063888 | 3300031250 | Bacteria | 1733 |
| 266 | Ga0265316_10006946 | 3300031344 | Bacteria | 10735 |
| 267 | Ga0265316_10020991 | 3300031344 | Bacteria | 5543 |
| 268 | Ga0265316_10026636 | 3300031344 | Bacteria | 4803 |
| 269 | Ga0307509_10041004 | 3300031507 | Bacteria | 5030 |
| 270 | Ga0265313_10002637 | 3300031595 | Bacteria | 15261 |
| 271 | Ga0265313_10009761 | 3300031595 | Bacteria | 6185 |
| 272 | Ga0265314_10000027 | 3300031711 | Bacteria | 278331 |
| 273 | Ga0265314_10004734 | 3300031711 | Bacteria | 12483 |
| 274 | Ga0265314_10004869 | 3300031711 | Bacteria | 12272 |
| 275 | Ga0265314_10041107 | 3300031711 | Bacteria | 3312 |
| 276 | Ga0265314_10052201 | 3300031711 | Bacteria | 2843 |
| 277 | Ga0265342_10004255 | 3300031712 | Bacteria | 11340 |
| 278 | Ga0265342_10011089 | 3300031712 | Bacteria | 6186 |
| 279 | Ga0265342_10029047 | 3300031712 | Bacteria | 3437 |
| 280 | Ga0316576_10001323 | 3300031727 | Bacteria | 13145 |
| 281 | Ga0316576_10058813 | 3300031727 | Bacteria | 2812 |
| 282 | Ga0316578_10015555 | 3300031728 | Bacteria | 4094 |
| 283 | Ga0316578_10057790 | 3300031728 | Bacteria | 2280 |
| 284 | Ga0307412_10000539 | 3300031911 | Bacteria | 22481 |
| 285 | Ga0307412_10001523 | 3300031911 | Bacteria | 12824 |
| 286 | Ga0307412_10020767 | 3300031911 | Unclassified | 4002 |
| 287 | Ga0316574_0030033 | 3300035398 | Unclassified | 3288 |
| 288 | Ga0373937_0146271 | 3300036401 | Bacteria | 2212 |
| 289 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 290 | Ga0395899_0000136 | 3300037312 | Bacteria | 112112 |
| 291 | Ga0395899_0000185 | 3300037312 | Bacteria | 91682 |
| 292 | Ga0395899_0027460 | 3300037312 | Bacteria | 4292 |
| 293 | Ga0395899_0036800 | 3300037312 | Bacteria | 3670 |
| 294 | Ga0395900_0000410 | 3300037418 | Bacteria | 62004 |
| 295 | Ga0395898_0006534 | 3300037466 | Bacteria | 12444 |
| 296 | Ga0395898_0019297 | 3300037466 | Bacteria | 6941 |
| 297 | Ga0395898_0029908 | 3300037466 | Bacteria | 5453 |
| 298 | Ga0395905_0000203 | 3300037471 | Bacteria | 92320 |
| 299 | Ga0395905_0013977 | 3300037471 | Bacteria | 7680 |
| 300 | Ga0395905_0048319 | 3300037471 | Bacteria | 3988 |
| 301 | Ga0395901_0000262 | 3300038443 | Bacteria | 65898 |
| 302 | Ga0450923_001907 | 3300042125 | Bacteria | 2881 |
| 303 | Ga0451577_0037617 | 3300042876 | Bacteria | 4356 |
| 304 | Ga0451577_0144444 | 3300042876 | Bacteria | 2139 |
| 305 | Ga0451577_0278934 | 3300042876 | Bacteria | 1514 |
| 306 | Ga0466966_0017176 | 3300044684 | Bacteria | 4786 |
| 307 | Ga0466961_0058971 | 3300044693 | Bacteria | 2441 |
| 308 | Ga0453684_0000199 | 3300044712 | Bacteria | 264155 |
| 309 | Ga0453684_0000529 | 3300044712 | Bacteria | 145936 |
| 310 | Ga0453684_0001043 | 3300044712 | Bacteria | 88750 |
| 311 | Ga0453684_0001256 | 3300044712 | Bacteria | 76375 |
| 312 | Ga0453684_0002159 | 3300044712 | Bacteria | 49195 |
| 313 | Ga0453684_0018832 | 3300044712 | Bacteria | 10563 |
| 314 | Ga0453684_0027496 | 3300044712 | Bacteria | 8155 |
| 315 | Ga0453684_0040087 | 3300044712 | Bacteria | 6368 |
| 316 | Ga0453684_0096472 | 3300044712 | Bacteria | 3632 |
| 317 | Ga0453684_0104514 | 3300044712 | Bacteria | 3457 |
| 318 | Ga0453684_0139238 | 3300044712 | Bacteria | 2901 |
| 319 | Ga0453684_0291891 | 3300044712 | Bacteria | 1856 |
| 320 | Ga0466971_0001282 | 3300044719 | Bacteria | 10482 |
| 321 | Ga0466959_0099221 | 3300045049 | Bacteria | 2085 |
| 322 | Ga0451576_0000109 | 3300045051 | Bacteria | 210549 |
| 323 | Ga0451576_0000264 | 3300045051 | Bacteria | 128283 |
| 324 | Ga0451576_0001852 | 3300045051 | Bacteria | 34253 |
| 325 | Ga0451576_0004415 | 3300045051 | Bacteria | 18299 |
| 326 | Ga0451576_0009706 | 3300045051 | Bacteria | 11132 |
| 327 | Ga0451576_0124906 | 3300045051 | Bacteria | 2681 |
| 328 | Ga0451576_0135112 | 3300045051 | Bacteria | 2572 |
| 329 | Ga0466958_0005260 | 3300045836 | Bacteria | 6935 |
| 330 | Ga0466958_0052135 | 3300045836 | Bacteria | 2479 |
| 331 | Ga0495651_0002889 | 3300046462 | Bacteria | 13297 |
| 332 | Ga0495650_0000057 | 3300046471 | Bacteria | 303569 |
| 333 | Ga0495585_0000461 | 3300046492 | Bacteria | 38870 |
| 334 | Ga0495585_0000832 | 3300046492 | Bacteria | 26625 |
| 335 | Ga0495596_0004881 | 3300046500 | Bacteria | 6434 |
| 336 | Ga0495583_0025180 | 3300046506 | Bacteria | 2977 |
| 337 | Ga0495583_0026688 | 3300046506 | Bacteria | 2859 |
| 338 | Ga0495610_0000888 | 3300046512 | Bacteria | 27794 |
| 339 | Ga0495616_0004310 | 3300046513 | Bacteria | 8988 |
| 340 | Ga0495616_0015330 | 3300046513 | Bacteria | 4262 |
| 341 | Ga0495630_0067718 | 3300046517 | Bacteria | 2684 |
| 342 | Ga0495648_0009312 | 3300046524 | Bacteria | 7631 |
| 343 | Ga0495652_0076850 | 3300046529 | Bacteria | 2769 |
| 344 | Ga0495652_0078695 | 3300046529 | Bacteria | 2728 |
| 345 | Ga0495587_0013946 | 3300046536 | Bacteria | 5047 |
| 346 | Ga0495609_0003446 | 3300046538 | Bacteria | 9057 |
| 347 | Ga0495633_0006361 | 3300046558 | Bacteria | 7020 |
| 348 | Ga0495667_0007132 | 3300046559 | Bacteria | 7578 |
| 349 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 350 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 351 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 352 | Ga0495625_0000316 | 3300046660 | Bacteria | 73939 |
| 353 | Ga0495625_0007009 | 3300046660 | Bacteria | 9924 |
| 354 | Ga0495625_0165475 | 3300046660 | Bacteria | 1479 |
| 355 | Ga0495661_0001280 | 3300046665 | Bacteria | 21554 |
| 356 | Ga0495661_0009171 | 3300046665 | Bacteria | 6798 |
| 357 | Ga0495599_0021849 | 3300046678 | Bacteria | 3994 |
| 358 | Ga0495599_0038372 | 3300046678 | Bacteria | 3010 |
| 359 | Ga0495623_0006764 | 3300046679 | Bacteria | 7462 |
| 360 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 361 | Ga0495600_0059085 | 3300046809 | Bacteria | 2505 |
| 362 | Ga0495660_0013608 | 3300046810 | Bacteria | 4717 |
| 363 | Ga0495683_0027392 | 3300047323 | Bacteria | 2913 |
| 364 | Ga0495687_000061 | 3300047443 | Bacteria | 176412 |
| 365 | Ga0495675_0002913 | 3300047444 | Bacteria | 10279 |
| 366 | Ga0495673_0016448 | 3300047469 | Bacteria | 3781 |
| 367 | Ga0495684_0000399 | 3300047471 | Bacteria | 35508 |
| 368 | Ga0495684_0069209 | 3300047471 | Bacteria | 2684 |
| 369 | Ga0495686_0000699 | 3300047472 | Bacteria | 45297 |
| 370 | Ga0495686_0001566 | 3300047472 | Bacteria | 24335 |
| 371 | Ga0495686_0008762 | 3300047472 | Bacteria | 7377 |
| 372 | Ga0495614_0032083 | 3300048089 | Bacteria | 2261 |
| 373 | Ga0496117_0014553 | 3300048920 | Bacteria | 6770 |
| 374 | Ga0496117_0041799 | 3300048920 | Bacteria | 3353 |
| 375 | Ga0496118_0060492 | 3300048921 | Bacteria | 2812 |
| 376 | Ga0496120_0009268 | 3300048923 | Bacteria | 7007 |
| 377 | Ga0496121_0000114 | 3300048924 | Bacteria | 179427 |
| 378 | Ga0496121_0136776 | 3300048924 | Bacteria | 1824 |
| 379 | Ga0496122_0013187 | 3300048925 | Bacteria | 8118 |
| 380 | Ga0496123_0005049 | 3300048926 | Bacteria | 13502 |
| 381 | Ga0496123_0071831 | 3300048926 | Bacteria | 2156 |
| 382 | Ga0496124_0001053 | 3300048927 | Bacteria | 43548 |
| 383 | Ga0496124_0003751 | 3300048927 | Bacteria | 18305 |
| 384 | Ga0496126_0226501 | 3300048929 | Bacteria | 1568 |
| 385 | Ga0501034_0034463 | 3300049571 | Bacteria | 5132 |
| 386 | Ga0501035_0082174 | 3300049822 | Bacteria | 2843 |
| 387 | Ga0500622_0039574 | 3300053156 | Unclassified | 2458 |
| 388 | Ga0466962_0005238 | 3300061719 | Bacteria | 6229 |
| 389 | 2600202458 | 2599185354 | Bacteria | 4398675 |
| 390 | 2600228845 | 2599185359 | Bacteria | 4772316 |
| 391 | 2753764250 | 2751185897 | Bacteria | 5322941 |
| 392 | 2819589367 | 2818991444 | Bacteria | 6968812 |
| 393 | 2819714681 | 2818991466 | Bacteria | 4748179 |
| 394 | 2919140478 | 2919138771 | Bacteria | 5281312 |
| 395 | 2919441589 | 2919437846 | Bacteria | 6199444 |
| 396 | 2928529187 | 2928526807 | Bacteria | 4760224 |
| 397 | 2928968728 | 2928968154 | Bacteria | 4633371 |
| 398 | 2946790979 | 2946787523 | Bacteria | 4366789 |
| 399 | 2990268725 | 2990265787 | Bacteria | 3943888 |
| 400 | 2993694568 | 2993693658 | Bacteria | 4040749 |
| 401 | 8056443930 | 8056440228 | Bacteria | 4946504 |
| 402 | Ga0070683_100251572 | |||
| 403 | JGI24736J21556_1000523 | |||
| 404 | rootH1_10005922 | |||
| 405 | rootH1_10017603 | |||
| 406 | rootH2_10020059 | |||
| 407 | rootH2_10055859 | |||
| 408 | rootL2_10199803 | |||
| 409 | rootL2_10229607 | |||
| 410 | rootH1_10019484 | |||
| 411 | rootH1_10035803 | |||
| 412 | Ga0065712_10003886 | |||
| 413 | Ga0065712_10020399 | |||
| 414 | Ga0070658_10006373 | |||
| 415 | Ga0070658_10049928 | |||
| 416 | Ga0070658_10083676 | |||
| 417 | Ga0070658_10174907 | |||
| 418 | Ga0070658_10224512 | |||
| 419 | Ga0070676_10004279 | |||
| 420 | Ga0070683_100003502 | |||
| 421 | Ga0070683_100026520 | |||
| 422 | Ga0070683_100087425 | |||
| 423 | Ga0070670_100005179 | |||
| 424 | Ga0070670_100152886 | |||
| 425 | Ga0068869_100005738 | |||
| 426 | Ga0068868_100008133 | |||
| 427 | Ga0068868_100115392 | |||
| 428 | Ga0070660_100016083 | |||
| 429 | Ga0070660_100021396 | |||
| 430 | Ga0070660_100025120 | |||
| 431 | Ga0070689_100027861 | |||
| 432 | Ga0070689_100030083 | |||
| 433 | Ga0070661_100004688 | |||
| 434 | Ga0070661_100028193 | |||
| 435 | Ga0070661_100033799 | |||
| 436 | Ga0070671_100061828 | |||
| 437 | Ga0070671_100154321 | |||
| 438 | Ga0070674_100091079 | |||
| 439 | Ga0070673_100000016 | |||
| 440 | Ga0070673_100017134 | |||
| 441 | Ga0070673_100049983 | |||
| 442 | Ga0070659_100025186 | |||
| 443 | Ga0070659_100041864 | |||
| 444 | Ga0070667_100119414 | |||
| 445 | Ga0070667_100178717 | |||
| 446 | Ga0070714_100111506 | |||
| 447 | Ga0070713_100003138 | |||
| 448 | Ga0070663_100000576 | |||
| 449 | Ga0070663_100010215 | |||
| 450 | Ga0070662_100000479 | |||
| 451 | Ga0070681_10040154 | |||
| 452 | Ga0068867_100000962 | |||
| 453 | Ga0068867_100008348 | |||
| 454 | Ga0070685_10029194 | |||
| 455 | Ga0070685_10108195 | |||
| 456 | Ga0070698_100017592 | |||
| 457 | Ga0070679_100057757 | |||
| 458 | Ga0070679_100095177 | |||
| 459 | Ga0068853_100001281 | |||
| 460 | Ga0068853_100007517 | |||
| 461 | Ga0068853_100078046 | |||
| 462 | Ga0068853_100209319 | |||
| 463 | Ga0068855_100000007 | |||
| 464 | Ga0068855_100000035 | |||
| 465 | Ga0068855_100000125 | |||
| 466 | Ga0068855_100032817 | |||
| 467 | Ga0068855_100145986 | |||
| 468 | Ga0070664_100021816 | |||
| 469 | Ga0070664_100039772 | |||
| 470 | Ga0070664_100102830 | |||
| 471 | Ga0068857_100047911 | |||
| 472 | Ga0068857_100149655 | |||
| 473 | Ga0068857_100169154 | |||
| 474 | Ga0068854_100000092 | |||
| 475 | Ga0068854_100013629 | |||
| 476 | Ga0068854_100077358 | |||
| 477 | Ga0068856_100000063 | |||
| 478 | Ga0068856_100002132 | |||
| 479 | Ga0068852_100028665 | |||
| 480 | Ga0068852_100030909 | |||
| 481 | Ga0068852_100040690 | |||
| 482 | Ga0068859_100009722 | |||
| 483 | Ga0068859_100056580 | |||
| 484 | Ga0068864_100023383 | |||
| 485 | Ga0068861_100030366 | |||
| 486 | Ga0068863_100007353 | |||
| 487 | Ga0068863_100031610 | |||
| 488 | Ga0068863_100075192 | |||
| 489 | Ga0068863_100076171 | |||
| 490 | Ga0068858_100013656 | |||
| 491 | Ga0097621_100027639 | |||
| 492 | Ga0068865_100000026 | |||
| 493 | Ga0068865_100023849 | |||
| 494 | Ga0097620_100009722 | |||
| 495 | Ga0097620_100056577 | |||
| 496 | Ga0105240_10000025 | |||
| 497 | Ga0105240_10001016 | |||
| 498 | Ga0105240_10001737 | |||
| 499 | Ga0105240_10002867 | |||
| 500 | Ga0105240_10026091 | |||
| 501 | Ga0105240_10062653 | |||
| 502 | Ga0105240_10078148 | |||
| 503 | Ga0105240_10094455 | |||
| 504 | Ga0105240_10147555 | |||
| 505 | Ga0111539_10227279 | |||
| 506 | Ga0105245_10003035 | |||
| 507 | Ga0105247_10009665 | |||
| 508 | Ga0105247_10147979 | |||
| 509 | Ga0105243_10000394 | |||
| 510 | Ga0105241_10012337 | |||
| 511 | Ga0105241_10127097 | |||
| 512 | Ga0105242_10000137 | |||
| 513 | Ga0105242_10008291 | |||
| 514 | Ga0105237_10000130 | |||
| 515 | Ga0105237_10001236 | |||
| 516 | Ga0105237_10003126 | |||
| 517 | Ga0105237_10009906 | |||
| 518 | Ga0105237_10135902 | |||
| 519 | Ga0105237_10179618 | |||
| 520 | Ga0105238_10004413 | |||
| 521 | Ga0105238_10006795 | |||
| 522 | Ga0105238_10064176 | |||
| 523 | Ga0105238_10066980 | |||
| 524 | Ga0105249_10006774 | |||
| 525 | Ga0105249_10012551 | |||
| 526 | Ga0105249_10047304 | |||
| 527 | Ga0105249_10086313 | |||
| 528 | Ga0105239_10000004 | |||
| 529 | Ga0105239_10000605 | |||
| 530 | Ga0105239_10011594 | |||
| 531 | Ga0105246_10001927 | |||
| 532 | Ga0157373_10006307 | |||
| 533 | Ga0157373_10010274 | |||
| 534 | Ga0157373_10087157 | |||
| 535 | Ga0157371_10001497 | |||
| 536 | Ga0157371_10002301 | |||
| 537 | Ga0157371_10005464 | |||
| 538 | Ga0157371_10007442 | |||
| 539 | Ga0157370_10001067 | |||
| 540 | Ga0157370_10050650 | |||
| 541 | Ga0157369_10000238 | |||
| 542 | Ga0157369_10004653 | |||
| 543 | Ga0157369_10014121 | |||
| 544 | Ga0157374_10006730 | |||
| 545 | Ga0157378_10000854 | |||
| 546 | Ga0163162_10012970 | |||
| 547 | Ga0163162_10022587 | |||
| 548 | Ga0163162_10205962 | |||
| 549 | Ga0157372_10000020 | |||
| 550 | Ga0157372_10013483 | |||
| 551 | Ga0157372_10015450 | |||
| 552 | Ga0157372_10021230 | |||
| 553 | Ga0157372_10141036 | |||
| 554 | Ga0157375_10000503 | |||
| 555 | Ga0157375_10071309 | |||
| 556 | Ga0157375_10088794 | |||
| 557 | Ga0163163_10057819 | |||
| 558 | Ga0157380_10151588 | |||
| 559 | Ga0157377_10009290 | |||
| 560 | Ga0157379_10085224 | |||
| 561 | Ga0163161_10094945 | |||
| 562 | Ga0163161_10191478 | |||
| 563 | Ga0209026_1002621 | |||
| 564 | Ga0209026_1006398 | |||
| 565 | Ga0209455_1003716 | |||
| 566 | Ga0207647_10009891 | |||
| 567 | Ga0207645_10008418 | |||
| 568 | Ga0207705_10000383 | |||
| 569 | Ga0207705_10000669 | |||
| 570 | Ga0207705_10001068 | |||
| 571 | Ga0207705_10012489 | |||
| 572 | Ga0207654_10083334 | |||
| 573 | Ga0207707_10056208 | |||
| 574 | Ga0207695_10000025 | |||
| 575 | Ga0207695_10002290 | |||
| 576 | Ga0207695_10009245 | |||
| 577 | Ga0207695_10023247 | |||
| 578 | Ga0207695_10074901 | |||
| 579 | Ga0207695_10081274 | |||
| 580 | Ga0207671_10001177 | |||
| 581 | Ga0207671_10003751 | |||
| 582 | Ga0207671_10014831 | |||
| 583 | Ga0207657_10000077 | |||
| 584 | Ga0207657_10005036 | |||
| 585 | Ga0207657_10013117 | |||
| 586 | Ga0207649_10001205 | |||
| 587 | Ga0207649_10017837 | |||
| 588 | Ga0207649_10036468 | |||
| 589 | Ga0207652_10000776 | |||
| 590 | Ga0207652_10004689 | |||
| 591 | Ga0207652_10011329 | |||
| 592 | Ga0207681_10018016 | |||
| 593 | Ga0207694_10008213 | |||
| 594 | Ga0207694_10022742 | |||
| 595 | Ga0207650_10000926 | |||
| 596 | Ga0207687_10003505 | |||
| 597 | Ga0207700_10145100 | |||
| 598 | Ga0207644_10116596 | |||
| 599 | Ga0207690_10015148 | |||
| 600 | Ga0207690_10027257 | |||
| 601 | Ga0207706_10000204 | |||
| 602 | Ga0207686_10001220 | |||
| 603 | Ga0207686_10004559 | |||
| 604 | Ga0207686_10008098 | |||
| 605 | Ga0207709_10000187 | |||
| 606 | Ga0207670_10006497 | |||
| 607 | Ga0207670_10019948 | |||
| 608 | Ga0207704_10000006 | |||
| 609 | Ga0207689_10001911 | |||
| 610 | Ga0207661_10019718 | |||
| 611 | Ga0207679_10042450 | |||
| 612 | Ga0207679_10064430 | |||
| 613 | Ga0207667_10000022 | |||
| 614 | Ga0207667_10000038 | |||
| 615 | Ga0207667_10000984 | |||
| 616 | Ga0207667_10039034 | |||
| 617 | Ga0207667_10080230 | |||
| 618 | Ga0207651_10000001 | |||
| 619 | Ga0207651_10056679 | |||
| 620 | Ga0207712_10007576 | |||
| 621 | Ga0207712_10035418 | |||
| 622 | Ga0207668_10154343 | |||
| 623 | Ga0207640_10000142 | |||
| 624 | Ga0207640_10000219 | |||
| 625 | Ga0207677_10000016 | |||
| 626 | Ga0207677_10004445 | |||
| 627 | Ga0207639_10005197 | |||
| 628 | Ga0207639_10012823 | |||
| 629 | Ga0207678_10003654 | |||
| 630 | Ga0207678_10014796 | |||
| 631 | Ga0207678_10105110 | |||
| 632 | Ga0207702_10000508 | |||
| 633 | Ga0207641_10000013 | |||
| 634 | Ga0207641_10012744 | |||
| 635 | Ga0207641_10025238 | |||
| 636 | Ga0207641_10097331 | |||
| 637 | Ga0207648_10000042 | |||
| 638 | Ga0207648_10008386 | |||
| 639 | Ga0207674_10025180 | |||
| 640 | Ga0207675_100161036 | |||
| 641 | Ga0207698_10002293 | |||
| 642 | Ga0207698_10048761 | |||
| 643 | Ga0207698_10090558 | |||
| 644 | Ga0265337_1000099 | |||
| 645 | Ga0265319_1000219 | |||
| 646 | Ga0265334_10002323 | |||
| 647 | Ga0265318_10001424 | |||
| 648 | Ga0265322_10002800 | |||
| 649 | Ga0265336_10000568 | |||
| 650 | Ga0265336_10002559 | |||
| 651 | Ga0265336_10003497 | |||
| 652 | Ga0307515_10001422 | |||
| 653 | Ga0265338_10000781 | |||
| 654 | Ga0265338_10001890 | |||
| 655 | Ga0265338_10012330 | |||
| 656 | Ga0265338_10016725 | |||
| 657 | Ga0265324_10003182 | |||
| 658 | Ga0265330_10008733 | |||
| 659 | Ga0265328_10033574 | |||
| 660 | Ga0265320_10008459 | |||
| 661 | Ga0265325_10000327 | |||
| 662 | Ga0265329_10031247 | |||
| 663 | Ga0265340_10014624 | |||
| 664 | Ga0265339_10001000 | |||
| 665 | Ga0265339_10001428 | |||
| 666 | Ga0265331_10063888 | |||
| 667 | Ga0265316_10006946 | |||
| 668 | Ga0265316_10020991 | |||
| 669 | Ga0265316_10026636 | |||
| 670 | Ga0307509_10041004 | |||
| 671 | Ga0265313_10002637 | |||
| 672 | Ga0265313_10009761 | |||
| 673 | Ga0265314_10000027 | |||
| 674 | Ga0265314_10004734 | |||
| 675 | Ga0265314_10004869 | |||
| 676 | Ga0265314_10041107 | |||
| 677 | Ga0265314_10052201 | |||
| 678 | Ga0265342_10004255 | |||
| 679 | Ga0265342_10011089 | |||
| 680 | Ga0265342_10029047 | |||
| 681 | Ga0316576_10001323 | |||
| 682 | Ga0316576_10058813 | |||
| 683 | Ga0316578_10015555 | |||
| 684 | Ga0316578_10057790 | |||
| 685 | Ga0307412_10000539 | |||
| 686 | Ga0307412_10001523 | |||
| 687 | Ga0307412_10020767 | |||
| 688 | Ga0316574_0030033 | |||
| 689 | Ga0373937_0146271 | |||
| 690 | Ga0395899_0000002 | |||
| 691 | Ga0395899_0000136 | |||
| 692 | Ga0395899_0000185 | |||
| 693 | Ga0395899_0027460 | |||
| 694 | Ga0395899_0036800 | |||
| 695 | Ga0395900_0000410 | |||
| 696 | Ga0395898_0006534 | |||
| 697 | Ga0395898_0019297 | |||
| 698 | Ga0395898_0029908 | |||
| 699 | Ga0395905_0000203 | |||
| 700 | Ga0395905_0013977 | |||
| 701 | Ga0395905_0048319 | |||
| 702 | Ga0395901_0000262 | |||
| 703 | Ga0450923_001907 | |||
| 704 | Ga0451577_0037617 | |||
| 705 | Ga0451577_0144444 | |||
| 706 | Ga0451577_0278934 | |||
| 707 | Ga0466966_0017176 | |||
| 708 | Ga0466961_0058971 | |||
| 709 | Ga0453684_0000199 | |||
| 710 | Ga0453684_0000529 | |||
| 711 | Ga0453684_0001043 | |||
| 712 | Ga0453684_0001256 | |||
| 713 | Ga0453684_0002159 | |||
| 714 | Ga0453684_0018832 | |||
| 715 | Ga0453684_0027496 | |||
| 716 | Ga0453684_0040087 | |||
| 717 | Ga0453684_0096472 | |||
| 718 | Ga0453684_0104514 | |||
| 719 | Ga0453684_0139238 | |||
| 720 | Ga0453684_0291891 | |||
| 721 | Ga0466971_0001282 | |||
| 722 | Ga0466959_0099221 | |||
| 723 | Ga0451576_0000109 | |||
| 724 | Ga0451576_0000264 | |||
| 725 | Ga0451576_0001852 | |||
| 726 | Ga0451576_0004415 | |||
| 727 | Ga0451576_0009706 | |||
| 728 | Ga0451576_0124906 | |||
| 729 | Ga0451576_0135112 | |||
| 730 | Ga0466958_0005260 | |||
| 731 | Ga0466958_0052135 | |||
| 732 | Ga0495651_0002889 | |||
| 733 | Ga0495650_0000057 | |||
| 734 | Ga0495585_0000461 | |||
| 735 | Ga0495585_0000832 | |||
| 736 | Ga0495596_0004881 | |||
| 737 | Ga0495583_0025180 | |||
| 738 | Ga0495583_0026688 | |||
| 739 | Ga0495610_0000888 | |||
| 740 | Ga0495616_0004310 | |||
| 741 | Ga0495616_0015330 | |||
| 742 | Ga0495630_0067718 | |||
| 743 | Ga0495648_0009312 | |||
| 744 | Ga0495652_0076850 | |||
| 745 | Ga0495652_0078695 | |||
| 746 | Ga0495587_0013946 | |||
| 747 | Ga0495609_0003446 | |||
| 748 | Ga0495633_0006361 | |||
| 749 | Ga0495667_0007132 | |||
| 750 | Ga0495668_0000003 | |||
| 751 | Ga0495668_0000007 | |||
| 752 | Ga0495625_0000003 | |||
| 753 | Ga0495625_0000316 | |||
| 754 | Ga0495625_0007009 | |||
| 755 | Ga0495625_0165475 | |||
| 756 | Ga0495661_0001280 | |||
| 757 | Ga0495661_0009171 | |||
| 758 | Ga0495599_0021849 | |||
| 759 | Ga0495599_0038372 | |||
| 760 | Ga0495623_0006764 | |||
| 761 | Ga0495649_0000002 | |||
| 762 | Ga0495600_0059085 | |||
| 763 | Ga0495660_0013608 | |||
| 764 | Ga0495683_0027392 | |||
| 765 | Ga0495687_000061 | |||
| 766 | Ga0495675_0002913 | |||
| 767 | Ga0495673_0016448 | |||
| 768 | Ga0495684_0000399 | |||
| 769 | Ga0495684_0069209 | |||
| 770 | Ga0495686_0000699 | |||
| 771 | Ga0495686_0001566 | |||
| 772 | Ga0495686_0008762 | |||
| 773 | Ga0495614_0032083 | |||
| 774 | Ga0496117_0014553 | |||
| 775 | Ga0496117_0041799 | |||
| 776 | Ga0496118_0060492 | |||
| 777 | Ga0496120_0009268 | |||
| 778 | Ga0496121_0000114 | |||
| 779 | Ga0496121_0136776 | |||
| 780 | Ga0496122_0013187 | |||
| 781 | Ga0496123_0005049 | |||
| 782 | Ga0496123_0071831 | |||
| 783 | Ga0496124_0001053 | |||
| 784 | Ga0496124_0003751 | |||
| 785 | Ga0496126_0226501 | |||
| 786 | Ga0501034_0034463 | |||
| 787 | Ga0501035_0082174 | |||
| 788 | Ga0500622_0039574 | |||
| 789 | Ga0466962_0005238 | |||
| 790 | 2600202458 | |||
| 791 | 2600228845 | |||
| 792 | 2753764250 | |||
| 793 | 2819589367 | |||
| 794 | 2819714681 | |||
| 795 | 2919140478 | |||
| 796 | 2919441589 | |||
| 797 | 2928529187 | |||
| 798 | 2928968728 | |||
| 799 | 2946790979 | |||
| 800 | 2990268725 | |||
| 801 | 2993694568 | |||
| 802 | 8056443930 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d5y-assembly1.cif.gz_A | high resolution crystal structure of 1,5-alpha-arabinanase catalytic mutant (abnbe201a) | 0.924 | 20 | 296 |
| 3d60-assembly1.cif.gz_A | crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (d27a) | 0.9236 | 20 | 296 |
| 3d61-assembly1.cif.gz_A | crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (abnbd147a) complexed to arabinobiose | 0.9234 | 21 | 296 |
| 3cu9-assembly1.cif.gz_A | high resolution crystal structure of 1,5-alpha-l-arabinanase from geobacillus stearothermophilus | 0.9193 | 20 | 296 |
| 6a8i-assembly2.cif.gz_B | crystal structure of endo-arabinanase abn-ts d147n mutant in complex with arabinohexaose | 0.9162 | 20 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wl7A00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9066 | 15 | 294 | 2.115.10.20 |
| 1gyeB00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8921 | 26 | 296 | 2.115.10.20 |
| 4kcbB00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8897 | 20 | 299 | 2.115.10.20 |
| 2e4mB01 | Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); | 0.8467 | 301 | 477 | 2.80.10.50 |
| 3o4cA00 | Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); | 0.8422 | 305 | 477 | 2.80.10.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A398E345-F1-model_v4 | Uncharacterized protein | 0.9818 | 184 | 239 |
|
| AF-K1TMW2-F1-model_v4 | Secreted arabinase | 0.9788 | 74 | 295 |
GO:0004553
GO:0005975 |
| AF-A0A060CB18-F1-model_v4 | Glyco_hydro_43 | 0.9763 | 181 | 240 |
GO:0004553
GO:0005975 |
| AF-A0A359FTV8-F1-model_v4 | Glycoside hydrolase | 0.974 | 168 | 244 |
GO:0004553
GO:0005975 |
| AF-K1TMW2-F1-model_v4 | Secreted arabinase | 0.9659 | 74 | 295 |
GO:0004553
GO:0005975 |