F435586

General Info

Members Datasets Scaffolds Average Seq Length
404 206 802 477

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100251572|Ga0070683_1002515721
Length 511
Sequence MKISINNSLNSLSAETQASDNKKTNYSLMKKRIKIIGTVVLLSLGLNKSTIAQVGKPFIHDPSTITECEGKYYTFGTGGGGLISEDGWRWNGGGVRPGGGAAPDVVKIGDRYLVVYGATGGGLGGGHNGRILTMWNKTLDPKSPDFKYTEAVVVASSDGKEDNDAIDPGLLLDPTDGRLWLSYGTYFGFIRLVELDPKTGKRVEGNKAINIAIDCEATDLMYRDGWYYLLGTHGTCCDGANSTYNIVVGRSKKVTGPYLDNMGRDMIKGGGKMVLAASDRLLGPGHFGRVVIGDGVEKMSCHYEADLDQSGRSVLGIRPLLWKNGWPLAGEIFKEGTYEIESERRGYALELVVDFTRMPGGPRGFNRANDEPIKPVASQQLADVIKTWPTGNIGARIGDYMGRPHQKWTITAAPDTVGYLGGSYYKIVIAGTDRALAATADAEVTTVPTFTGAPEQLWRIDQLIDGTYRIMPKVVPNSGKKLALVSSGDSTPTLAEFDFNSDNSKWNFKAH

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
195 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
196 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
197 2818991444 Filimonas endophytica 3197 Isolate Unclassified
198 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
199 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
200 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
201 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
202 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
203 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
204 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
205 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
206 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 0.5
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100251572 3300005329 Bacteria 1681
2 JGI24736J21556_1000523 3300001904 Bacteria 7155
3 rootH1_10005922 3300003316 Bacteria 19957
4 rootH1_10017603 3300003316 Bacteria 25834
5 rootH2_10020059 3300003320 Unclassified 2941
6 rootH2_10055859 3300003320 Bacteria 26943
7 rootL2_10199803 3300003322 Bacteria 5029
8 rootL2_10229607 3300003322 Bacteria 2498
9 rootH1_10019484 3300003323 Bacteria 37264
10 rootH1_10035803 3300003323 Unclassified 3253
11 Ga0065712_10003886 3300005290 Bacteria 3475
12 Ga0065712_10020399 3300005290 Bacteria 2183
13 Ga0070658_10006373 3300005327 Bacteria 9562
14 Ga0070658_10049928 3300005327 Bacteria 3390
15 Ga0070658_10083676 3300005327 Unclassified 2623
16 Ga0070658_10174907 3300005327 Bacteria 1805
17 Ga0070658_10224512 3300005327 Bacteria 1589
18 Ga0070676_10004279 3300005328 Bacteria 7502
19 Ga0070683_100003502 3300005329 Bacteria 12764
20 Ga0070683_100026520 3300005329 Bacteria 5219
21 Ga0070683_100087425 3300005329 Bacteria 2923
22 Ga0070670_100005179 3300005331 Bacteria 10975
23 Ga0070670_100152886 3300005331 Bacteria 1997
24 Ga0068869_100005738 3300005334 Bacteria 7836
25 Ga0068868_100008133 3300005338 Bacteria 7503
26 Ga0068868_100115392 3300005338 Bacteria 2186
27 Ga0070660_100016083 3300005339 Bacteria 5422
28 Ga0070660_100021396 3300005339 Bacteria 4769
29 Ga0070660_100025120 3300005339 Bacteria 4427
30 Ga0070689_100027861 3300005340 Bacteria 4263
31 Ga0070689_100030083 3300005340 Unclassified 4118
32 Ga0070661_100004688 3300005344 Bacteria 9414
33 Ga0070661_100028193 3300005344 Bacteria 4048
34 Ga0070661_100033799 3300005344 Bacteria 3706
35 Ga0070671_100061828 3300005355 Bacteria 3119
36 Ga0070671_100154321 3300005355 Bacteria 1939
37 Ga0070674_100091079 3300005356 Bacteria 2201
38 Ga0070673_100000016 3300005364 Bacteria 114927
39 Ga0070673_100017134 3300005364 Bacteria 5143
40 Ga0070673_100049983 3300005364 Bacteria 3267
41 Ga0070659_100025186 3300005366 Bacteria 4567
42 Ga0070659_100041864 3300005366 Bacteria 3581
43 Ga0070667_100119414 3300005367 Bacteria 2292
44 Ga0070667_100178717 3300005367 Bacteria 1876
45 Ga0070714_100111506 3300005435 Bacteria 2423
46 Ga0070713_100003138 3300005436 Bacteria 10878
47 Ga0070663_100000576 3300005455 Bacteria 19619
48 Ga0070663_100010215 3300005455 Bacteria 5846
49 Ga0070662_100000479 3300005457 Bacteria 23707
50 Ga0070681_10040154 3300005458 Bacteria 4691
51 Ga0068867_100000962 3300005459 Bacteria 19626
52 Ga0068867_100008348 3300005459 Bacteria 7308
53 Ga0070685_10029194 3300005466 Bacteria 3062
54 Ga0070685_10108195 3300005466 Unclassified 1708
55 Ga0070698_100017592 3300005471 Bacteria 7533
56 Ga0070679_100057757 3300005530 Bacteria 3868
57 Ga0070679_100095177 3300005530 Bacteria 2966
58 Ga0068853_100001281 3300005539 Bacteria 18024
59 Ga0068853_100007517 3300005539 Bacteria 8723
60 Ga0068853_100078046 3300005539 Bacteria 2894
61 Ga0068853_100209319 3300005539 Bacteria 1777
62 Ga0068855_100000007 3300005563 Bacteria 273676
63 Ga0068855_100000035 3300005563 Bacteria 165487
64 Ga0068855_100000125 3300005563 Bacteria 96961
65 Ga0068855_100032817 3300005563 Bacteria 6198
66 Ga0068855_100145986 3300005563 Bacteria 2693
67 Ga0070664_100021816 3300005564 Bacteria 5279
68 Ga0070664_100039772 3300005564 Bacteria 3963
69 Ga0070664_100102830 3300005564 Bacteria 2486
70 Ga0068857_100047911 3300005577 Bacteria 3795
71 Ga0068857_100149655 3300005577 Bacteria 2114
72 Ga0068857_100169154 3300005577 Bacteria 1986
73 Ga0068854_100000092 3300005578 Bacteria 63516
74 Ga0068854_100013629 3300005578 Bacteria 5342
75 Ga0068854_100077358 3300005578 Bacteria 2448
76 Ga0068856_100000063 3300005614 Bacteria 99730
77 Ga0068856_100002132 3300005614 Bacteria 20518
78 Ga0068852_100028665 3300005616 Bacteria 4561
79 Ga0068852_100030909 3300005616 Bacteria 4413
80 Ga0068852_100040690 3300005616 Bacteria 3923
81 Ga0068859_100009722 3300005617 Bacteria 9712
82 Ga0068859_100056580 3300005617 Bacteria 3948
83 Ga0068864_100023383 3300005618 Bacteria 5189
84 Ga0068861_100030366 3300005719 Bacteria 3960
85 Ga0068863_100007353 3300005841 Bacteria 10779
86 Ga0068863_100031610 3300005841 Bacteria 5050
87 Ga0068863_100075192 3300005841 Bacteria 3196
88 Ga0068863_100076171 3300005841 Bacteria 3174
89 Ga0068858_100013656 3300005842 Bacteria 7664
90 Ga0097621_100027639 3300006237 Bacteria 4463
91 Ga0068865_100000026 3300006881 Bacteria 93349
92 Ga0068865_100023849 3300006881 Bacteria 4011
93 Ga0097620_100009722 3300006931 Bacteria 9712
94 Ga0097620_100056577 3300006931 Bacteria 3948
95 Ga0105240_10000025 3300009093 Bacteria 367124
96 Ga0105240_10001016 3300009093 Bacteria 50008
97 Ga0105240_10001737 3300009093 Bacteria 36795
98 Ga0105240_10002867 3300009093 Bacteria 27262
99 Ga0105240_10026091 3300009093 Bacteria 7671
100 Ga0105240_10062653 3300009093 Bacteria 4629
101 Ga0105240_10078148 3300009093 Bacteria 4076
102 Ga0105240_10094455 3300009093 Bacteria 3648
103 Ga0105240_10147555 3300009093 Bacteria 2805
104 Ga0111539_10227279 3300009094 Bacteria 2173
105 Ga0105245_10003035 3300009098 Bacteria 15050
106 Ga0105247_10009665 3300009101 Bacteria 5849
107 Ga0105247_10147979 3300009101 Bacteria 1545
108 Ga0105243_10000394 3300009148 Bacteria 46074
109 Ga0105241_10012337 3300009174 Bacteria 6267
110 Ga0105241_10127097 3300009174 Bacteria 2060
111 Ga0105242_10000137 3300009176 Bacteria 53136
112 Ga0105242_10008291 3300009176 Bacteria 7983
113 Ga0105237_10000130 3300009545 Bacteria 105282
114 Ga0105237_10001236 3300009545 Bacteria 34077
115 Ga0105237_10003126 3300009545 Bacteria 19922
116 Ga0105237_10009906 3300009545 Bacteria 10174
117 Ga0105237_10135902 3300009545 Bacteria 2453
118 Ga0105237_10179618 3300009545 Bacteria 2117
119 Ga0105238_10004413 3300009551 Bacteria 13951
120 Ga0105238_10006795 3300009551 Bacteria 11425
121 Ga0105238_10064176 3300009551 Bacteria 3673
122 Ga0105238_10066980 3300009551 Bacteria 3592
123 Ga0105249_10006774 3300009553 Bacteria 9982
124 Ga0105249_10012551 3300009553 Bacteria 7468
125 Ga0105249_10047304 3300009553 Bacteria 3919
126 Ga0105249_10086313 3300009553 Bacteria 2927
127 Ga0105239_10000004 3300010375 Bacteria 532483
128 Ga0105239_10000605 3300010375 Bacteria 51086
129 Ga0105239_10011594 3300010375 Bacteria 9833
130 Ga0105246_10001927 3300011119 Bacteria 12509
131 Ga0157373_10006307 3300013100 Bacteria 8861
132 Ga0157373_10010274 3300013100 Bacteria 6897
133 Ga0157373_10087157 3300013100 Bacteria 2200
134 Ga0157371_10001497 3300013102 Bacteria 24172
135 Ga0157371_10002301 3300013102 Bacteria 18394
136 Ga0157371_10005464 3300013102 Bacteria 10712
137 Ga0157371_10007442 3300013102 Bacteria 8865
138 Ga0157370_10001067 3300013104 Bacteria 34290
139 Ga0157370_10050650 3300013104 Bacteria 3969
140 Ga0157369_10000238 3300013105 Bacteria 76209
141 Ga0157369_10004653 3300013105 Bacteria 16126
142 Ga0157369_10014121 3300013105 Bacteria 9028
143 Ga0157374_10006730 3300013296 Bacteria 9768
144 Ga0157378_10000854 3300013297 Bacteria 28266
145 Ga0163162_10012970 3300013306 Bacteria 8133
146 Ga0163162_10022587 3300013306 Bacteria 6202
147 Ga0163162_10205962 3300013306 Bacteria 2096
148 Ga0157372_10000020 3300013307 Bacteria 208056
149 Ga0157372_10013483 3300013307 Bacteria 8736
150 Ga0157372_10015450 3300013307 Bacteria 8183
151 Ga0157372_10021230 3300013307 Bacteria 7015
152 Ga0157372_10141036 3300013307 Bacteria 2776
153 Ga0157375_10000503 3300013308 Bacteria 35295
154 Ga0157375_10071309 3300013308 Bacteria 3487
155 Ga0157375_10088794 3300013308 Bacteria 3146
156 Ga0163163_10057819 3300014325 Bacteria 3835
157 Ga0157380_10151588 3300014326 Bacteria 2005
158 Ga0157377_10009290 3300014745 Bacteria 4817
159 Ga0157379_10085224 3300014968 Unclassified 2831
160 Ga0163161_10094945 3300017792 Bacteria 2211
161 Ga0163161_10191478 3300017792 Bacteria 1573
162 Ga0209026_1002621 3300025250 Bacteria 6569
163 Ga0209026_1006398 3300025250 Bacteria 2893
164 Ga0209455_1003716 3300025272 Bacteria 5281
165 Ga0207647_10009891 3300025904 Bacteria 6755
166 Ga0207645_10008418 3300025907 Bacteria 7195
167 Ga0207705_10000383 3300025909 Bacteria 39578
168 Ga0207705_10000669 3300025909 Bacteria 28496
169 Ga0207705_10001068 3300025909 Bacteria 22281
170 Ga0207705_10012489 3300025909 Bacteria 6136
171 Ga0207654_10083334 3300025911 Bacteria 1930
172 Ga0207707_10056208 3300025912 Bacteria 3424
173 Ga0207695_10000025 3300025913 Bacteria 627211
174 Ga0207695_10002290 3300025913 Bacteria 28600
175 Ga0207695_10009245 3300025913 Bacteria 12214
176 Ga0207695_10023247 3300025913 Bacteria 7011
177 Ga0207695_10074901 3300025913 Bacteria 3445
178 Ga0207695_10081274 3300025913 Bacteria 3280
179 Ga0207671_10001177 3300025914 Bacteria 31119
180 Ga0207671_10003751 3300025914 Bacteria 14957
181 Ga0207671_10014831 3300025914 Bacteria 6138
182 Ga0207657_10000077 3300025919 Bacteria 92227
183 Ga0207657_10005036 3300025919 Bacteria 13864
184 Ga0207657_10013117 3300025919 Bacteria 8139
185 Ga0207649_10001205 3300025920 Bacteria 15596
186 Ga0207649_10017837 3300025920 Bacteria 4026
187 Ga0207649_10036468 3300025920 Bacteria 2962
188 Ga0207652_10000776 3300025921 Bacteria 30553
189 Ga0207652_10004689 3300025921 Bacteria 11085
190 Ga0207652_10011329 3300025921 Bacteria 7185
191 Ga0207681_10018016 3300025923 Bacteria 4443
192 Ga0207694_10008213 3300025924 Bacteria 7891
193 Ga0207694_10022742 3300025924 Bacteria 4755
194 Ga0207650_10000926 3300025925 Bacteria 22125
195 Ga0207687_10003505 3300025927 Bacteria 10555
196 Ga0207700_10145100 3300025928 Unclassified 1955
197 Ga0207644_10116596 3300025931 Bacteria 2027
198 Ga0207690_10015148 3300025932 Bacteria 4669
199 Ga0207690_10027257 3300025932 Bacteria 3610
200 Ga0207706_10000204 3300025933 Bacteria 65744
201 Ga0207686_10001220 3300025934 Bacteria 14932
202 Ga0207686_10004559 3300025934 Bacteria 7425
203 Ga0207686_10008098 3300025934 Bacteria 5668
204 Ga0207709_10000187 3300025935 Bacteria 82937
205 Ga0207670_10006497 3300025936 Bacteria 6488
206 Ga0207670_10019948 3300025936 Unclassified 4107
207 Ga0207704_10000006 3300025938 Bacteria 220005
208 Ga0207689_10001911 3300025942 Bacteria 19691
209 Ga0207661_10019718 3300025944 Bacteria 5033
210 Ga0207679_10042450 3300025945 Bacteria 3269
211 Ga0207679_10064430 3300025945 Bacteria 2739
212 Ga0207667_10000022 3300025949 Bacteria 369570
213 Ga0207667_10000038 3300025949 Bacteria 280720
214 Ga0207667_10000984 3300025949 Bacteria 36433
215 Ga0207667_10039034 3300025949 Bacteria 5062
216 Ga0207667_10080230 3300025949 Bacteria 3381
217 Ga0207651_10000001 3300025960 Bacteria 516823
218 Ga0207651_10056679 3300025960 Bacteria 2698
219 Ga0207712_10007576 3300025961 Bacteria 6860
220 Ga0207712_10035418 3300025961 Bacteria 3391
221 Ga0207668_10154343 3300025972 Bacteria 1782
222 Ga0207640_10000142 3300025981 Bacteria 52324
223 Ga0207640_10000219 3300025981 Bacteria 40135
224 Ga0207677_10000016 3300026023 Bacteria 153771
225 Ga0207677_10004445 3300026023 Bacteria 7526
226 Ga0207639_10005197 3300026041 Bacteria 8780
227 Ga0207639_10012823 3300026041 Bacteria 5848
228 Ga0207678_10003654 3300026067 Bacteria 13821
229 Ga0207678_10014796 3300026067 Bacteria 6865
230 Ga0207678_10105110 3300026067 Bacteria 2409
231 Ga0207702_10000508 3300026078 Bacteria 43847
232 Ga0207641_10000013 3300026088 Bacteria 341378
233 Ga0207641_10012744 3300026088 Bacteria 6894
234 Ga0207641_10025238 3300026088 Bacteria 4901
235 Ga0207641_10097331 3300026088 Bacteria 2586
236 Ga0207648_10000042 3300026089 Bacteria 114885
237 Ga0207648_10008386 3300026089 Bacteria 10015
238 Ga0207674_10025180 3300026116 Bacteria 6349
239 Ga0207675_100161036 3300026118 Bacteria 2140
240 Ga0207698_10002293 3300026142 Bacteria 11334
241 Ga0207698_10048761 3300026142 Bacteria 3218
242 Ga0207698_10090558 3300026142 Bacteria 2502
243 Ga0265337_1000099 3300028556 Bacteria 42527
244 Ga0265319_1000219 3300028563 Bacteria 42787
245 Ga0265334_10002323 3300028573 Bacteria 8950
246 Ga0265318_10001424 3300028577 Bacteria 14152
247 Ga0265322_10002800 3300028654 Bacteria 5326
248 Ga0265336_10000568 3300028666 Bacteria 20940
249 Ga0265336_10002559 3300028666 Bacteria 7441
250 Ga0265336_10003497 3300028666 Bacteria 6147
251 Ga0307515_10001422 3300028794 Bacteria 54180
252 Ga0265338_10000781 3300028800 Bacteria 53976
253 Ga0265338_10001890 3300028800 Bacteria 32781
254 Ga0265338_10012330 3300028800 Bacteria 9751
255 Ga0265338_10016725 3300028800 Bacteria 7948
256 Ga0265324_10003182 3300029957 Bacteria 7944
257 Ga0265330_10008733 3300031235 Bacteria 4857
258 Ga0265328_10033574 3300031239 Bacteria 1902
259 Ga0265320_10008459 3300031240 Bacteria 6298
260 Ga0265325_10000327 3300031241 Bacteria 33635
261 Ga0265329_10031247 3300031242 Bacteria 1731
262 Ga0265340_10014624 3300031247 Bacteria 4094
263 Ga0265339_10001000 3300031249 Bacteria 21539
264 Ga0265339_10001428 3300031249 Bacteria 17718
265 Ga0265331_10063888 3300031250 Bacteria 1733
266 Ga0265316_10006946 3300031344 Bacteria 10735
267 Ga0265316_10020991 3300031344 Bacteria 5543
268 Ga0265316_10026636 3300031344 Bacteria 4803
269 Ga0307509_10041004 3300031507 Bacteria 5030
270 Ga0265313_10002637 3300031595 Bacteria 15261
271 Ga0265313_10009761 3300031595 Bacteria 6185
272 Ga0265314_10000027 3300031711 Bacteria 278331
273 Ga0265314_10004734 3300031711 Bacteria 12483
274 Ga0265314_10004869 3300031711 Bacteria 12272
275 Ga0265314_10041107 3300031711 Bacteria 3312
276 Ga0265314_10052201 3300031711 Bacteria 2843
277 Ga0265342_10004255 3300031712 Bacteria 11340
278 Ga0265342_10011089 3300031712 Bacteria 6186
279 Ga0265342_10029047 3300031712 Bacteria 3437
280 Ga0316576_10001323 3300031727 Bacteria 13145
281 Ga0316576_10058813 3300031727 Bacteria 2812
282 Ga0316578_10015555 3300031728 Bacteria 4094
283 Ga0316578_10057790 3300031728 Bacteria 2280
284 Ga0307412_10000539 3300031911 Bacteria 22481
285 Ga0307412_10001523 3300031911 Bacteria 12824
286 Ga0307412_10020767 3300031911 Unclassified 4002
287 Ga0316574_0030033 3300035398 Unclassified 3288
288 Ga0373937_0146271 3300036401 Bacteria 2212
289 Ga0395899_0000002 3300037312 Bacteria 1324310
290 Ga0395899_0000136 3300037312 Bacteria 112112
291 Ga0395899_0000185 3300037312 Bacteria 91682
292 Ga0395899_0027460 3300037312 Bacteria 4292
293 Ga0395899_0036800 3300037312 Bacteria 3670
294 Ga0395900_0000410 3300037418 Bacteria 62004
295 Ga0395898_0006534 3300037466 Bacteria 12444
296 Ga0395898_0019297 3300037466 Bacteria 6941
297 Ga0395898_0029908 3300037466 Bacteria 5453
298 Ga0395905_0000203 3300037471 Bacteria 92320
299 Ga0395905_0013977 3300037471 Bacteria 7680
300 Ga0395905_0048319 3300037471 Bacteria 3988
301 Ga0395901_0000262 3300038443 Bacteria 65898
302 Ga0450923_001907 3300042125 Bacteria 2881
303 Ga0451577_0037617 3300042876 Bacteria 4356
304 Ga0451577_0144444 3300042876 Bacteria 2139
305 Ga0451577_0278934 3300042876 Bacteria 1514
306 Ga0466966_0017176 3300044684 Bacteria 4786
307 Ga0466961_0058971 3300044693 Bacteria 2441
308 Ga0453684_0000199 3300044712 Bacteria 264155
309 Ga0453684_0000529 3300044712 Bacteria 145936
310 Ga0453684_0001043 3300044712 Bacteria 88750
311 Ga0453684_0001256 3300044712 Bacteria 76375
312 Ga0453684_0002159 3300044712 Bacteria 49195
313 Ga0453684_0018832 3300044712 Bacteria 10563
314 Ga0453684_0027496 3300044712 Bacteria 8155
315 Ga0453684_0040087 3300044712 Bacteria 6368
316 Ga0453684_0096472 3300044712 Bacteria 3632
317 Ga0453684_0104514 3300044712 Bacteria 3457
318 Ga0453684_0139238 3300044712 Bacteria 2901
319 Ga0453684_0291891 3300044712 Bacteria 1856
320 Ga0466971_0001282 3300044719 Bacteria 10482
321 Ga0466959_0099221 3300045049 Bacteria 2085
322 Ga0451576_0000109 3300045051 Bacteria 210549
323 Ga0451576_0000264 3300045051 Bacteria 128283
324 Ga0451576_0001852 3300045051 Bacteria 34253
325 Ga0451576_0004415 3300045051 Bacteria 18299
326 Ga0451576_0009706 3300045051 Bacteria 11132
327 Ga0451576_0124906 3300045051 Bacteria 2681
328 Ga0451576_0135112 3300045051 Bacteria 2572
329 Ga0466958_0005260 3300045836 Bacteria 6935
330 Ga0466958_0052135 3300045836 Bacteria 2479
331 Ga0495651_0002889 3300046462 Bacteria 13297
332 Ga0495650_0000057 3300046471 Bacteria 303569
333 Ga0495585_0000461 3300046492 Bacteria 38870
334 Ga0495585_0000832 3300046492 Bacteria 26625
335 Ga0495596_0004881 3300046500 Bacteria 6434
336 Ga0495583_0025180 3300046506 Bacteria 2977
337 Ga0495583_0026688 3300046506 Bacteria 2859
338 Ga0495610_0000888 3300046512 Bacteria 27794
339 Ga0495616_0004310 3300046513 Bacteria 8988
340 Ga0495616_0015330 3300046513 Bacteria 4262
341 Ga0495630_0067718 3300046517 Bacteria 2684
342 Ga0495648_0009312 3300046524 Bacteria 7631
343 Ga0495652_0076850 3300046529 Bacteria 2769
344 Ga0495652_0078695 3300046529 Bacteria 2728
345 Ga0495587_0013946 3300046536 Bacteria 5047
346 Ga0495609_0003446 3300046538 Bacteria 9057
347 Ga0495633_0006361 3300046558 Bacteria 7020
348 Ga0495667_0007132 3300046559 Bacteria 7578
349 Ga0495668_0000003 3300046616 Bacteria 695023
350 Ga0495668_0000007 3300046616 Bacteria 552902
351 Ga0495625_0000003 3300046660 Bacteria 686847
352 Ga0495625_0000316 3300046660 Bacteria 73939
353 Ga0495625_0007009 3300046660 Bacteria 9924
354 Ga0495625_0165475 3300046660 Bacteria 1479
355 Ga0495661_0001280 3300046665 Bacteria 21554
356 Ga0495661_0009171 3300046665 Bacteria 6798
357 Ga0495599_0021849 3300046678 Bacteria 3994
358 Ga0495599_0038372 3300046678 Bacteria 3010
359 Ga0495623_0006764 3300046679 Bacteria 7462
360 Ga0495649_0000002 3300046694 Bacteria 1093458
361 Ga0495600_0059085 3300046809 Bacteria 2505
362 Ga0495660_0013608 3300046810 Bacteria 4717
363 Ga0495683_0027392 3300047323 Bacteria 2913
364 Ga0495687_000061 3300047443 Bacteria 176412
365 Ga0495675_0002913 3300047444 Bacteria 10279
366 Ga0495673_0016448 3300047469 Bacteria 3781
367 Ga0495684_0000399 3300047471 Bacteria 35508
368 Ga0495684_0069209 3300047471 Bacteria 2684
369 Ga0495686_0000699 3300047472 Bacteria 45297
370 Ga0495686_0001566 3300047472 Bacteria 24335
371 Ga0495686_0008762 3300047472 Bacteria 7377
372 Ga0495614_0032083 3300048089 Bacteria 2261
373 Ga0496117_0014553 3300048920 Bacteria 6770
374 Ga0496117_0041799 3300048920 Bacteria 3353
375 Ga0496118_0060492 3300048921 Bacteria 2812
376 Ga0496120_0009268 3300048923 Bacteria 7007
377 Ga0496121_0000114 3300048924 Bacteria 179427
378 Ga0496121_0136776 3300048924 Bacteria 1824
379 Ga0496122_0013187 3300048925 Bacteria 8118
380 Ga0496123_0005049 3300048926 Bacteria 13502
381 Ga0496123_0071831 3300048926 Bacteria 2156
382 Ga0496124_0001053 3300048927 Bacteria 43548
383 Ga0496124_0003751 3300048927 Bacteria 18305
384 Ga0496126_0226501 3300048929 Bacteria 1568
385 Ga0501034_0034463 3300049571 Bacteria 5132
386 Ga0501035_0082174 3300049822 Bacteria 2843
387 Ga0500622_0039574 3300053156 Unclassified 2458
388 Ga0466962_0005238 3300061719 Bacteria 6229
389 2600202458 2599185354 Bacteria 4398675
390 2600228845 2599185359 Bacteria 4772316
391 2753764250 2751185897 Bacteria 5322941
392 2819589367 2818991444 Bacteria 6968812
393 2819714681 2818991466 Bacteria 4748179
394 2919140478 2919138771 Bacteria 5281312
395 2919441589 2919437846 Bacteria 6199444
396 2928529187 2928526807 Bacteria 4760224
397 2928968728 2928968154 Bacteria 4633371
398 2946790979 2946787523 Bacteria 4366789
399 2990268725 2990265787 Bacteria 3943888
400 2993694568 2993693658 Bacteria 4040749
401 8056443930 8056440228 Bacteria 4946504
402 Ga0070683_100251572
403 JGI24736J21556_1000523
404 rootH1_10005922
405 rootH1_10017603
406 rootH2_10020059
407 rootH2_10055859
408 rootL2_10199803
409 rootL2_10229607
410 rootH1_10019484
411 rootH1_10035803
412 Ga0065712_10003886
413 Ga0065712_10020399
414 Ga0070658_10006373
415 Ga0070658_10049928
416 Ga0070658_10083676
417 Ga0070658_10174907
418 Ga0070658_10224512
419 Ga0070676_10004279
420 Ga0070683_100003502
421 Ga0070683_100026520
422 Ga0070683_100087425
423 Ga0070670_100005179
424 Ga0070670_100152886
425 Ga0068869_100005738
426 Ga0068868_100008133
427 Ga0068868_100115392
428 Ga0070660_100016083
429 Ga0070660_100021396
430 Ga0070660_100025120
431 Ga0070689_100027861
432 Ga0070689_100030083
433 Ga0070661_100004688
434 Ga0070661_100028193
435 Ga0070661_100033799
436 Ga0070671_100061828
437 Ga0070671_100154321
438 Ga0070674_100091079
439 Ga0070673_100000016
440 Ga0070673_100017134
441 Ga0070673_100049983
442 Ga0070659_100025186
443 Ga0070659_100041864
444 Ga0070667_100119414
445 Ga0070667_100178717
446 Ga0070714_100111506
447 Ga0070713_100003138
448 Ga0070663_100000576
449 Ga0070663_100010215
450 Ga0070662_100000479
451 Ga0070681_10040154
452 Ga0068867_100000962
453 Ga0068867_100008348
454 Ga0070685_10029194
455 Ga0070685_10108195
456 Ga0070698_100017592
457 Ga0070679_100057757
458 Ga0070679_100095177
459 Ga0068853_100001281
460 Ga0068853_100007517
461 Ga0068853_100078046
462 Ga0068853_100209319
463 Ga0068855_100000007
464 Ga0068855_100000035
465 Ga0068855_100000125
466 Ga0068855_100032817
467 Ga0068855_100145986
468 Ga0070664_100021816
469 Ga0070664_100039772
470 Ga0070664_100102830
471 Ga0068857_100047911
472 Ga0068857_100149655
473 Ga0068857_100169154
474 Ga0068854_100000092
475 Ga0068854_100013629
476 Ga0068854_100077358
477 Ga0068856_100000063
478 Ga0068856_100002132
479 Ga0068852_100028665
480 Ga0068852_100030909
481 Ga0068852_100040690
482 Ga0068859_100009722
483 Ga0068859_100056580
484 Ga0068864_100023383
485 Ga0068861_100030366
486 Ga0068863_100007353
487 Ga0068863_100031610
488 Ga0068863_100075192
489 Ga0068863_100076171
490 Ga0068858_100013656
491 Ga0097621_100027639
492 Ga0068865_100000026
493 Ga0068865_100023849
494 Ga0097620_100009722
495 Ga0097620_100056577
496 Ga0105240_10000025
497 Ga0105240_10001016
498 Ga0105240_10001737
499 Ga0105240_10002867
500 Ga0105240_10026091
501 Ga0105240_10062653
502 Ga0105240_10078148
503 Ga0105240_10094455
504 Ga0105240_10147555
505 Ga0111539_10227279
506 Ga0105245_10003035
507 Ga0105247_10009665
508 Ga0105247_10147979
509 Ga0105243_10000394
510 Ga0105241_10012337
511 Ga0105241_10127097
512 Ga0105242_10000137
513 Ga0105242_10008291
514 Ga0105237_10000130
515 Ga0105237_10001236
516 Ga0105237_10003126
517 Ga0105237_10009906
518 Ga0105237_10135902
519 Ga0105237_10179618
520 Ga0105238_10004413
521 Ga0105238_10006795
522 Ga0105238_10064176
523 Ga0105238_10066980
524 Ga0105249_10006774
525 Ga0105249_10012551
526 Ga0105249_10047304
527 Ga0105249_10086313
528 Ga0105239_10000004
529 Ga0105239_10000605
530 Ga0105239_10011594
531 Ga0105246_10001927
532 Ga0157373_10006307
533 Ga0157373_10010274
534 Ga0157373_10087157
535 Ga0157371_10001497
536 Ga0157371_10002301
537 Ga0157371_10005464
538 Ga0157371_10007442
539 Ga0157370_10001067
540 Ga0157370_10050650
541 Ga0157369_10000238
542 Ga0157369_10004653
543 Ga0157369_10014121
544 Ga0157374_10006730
545 Ga0157378_10000854
546 Ga0163162_10012970
547 Ga0163162_10022587
548 Ga0163162_10205962
549 Ga0157372_10000020
550 Ga0157372_10013483
551 Ga0157372_10015450
552 Ga0157372_10021230
553 Ga0157372_10141036
554 Ga0157375_10000503
555 Ga0157375_10071309
556 Ga0157375_10088794
557 Ga0163163_10057819
558 Ga0157380_10151588
559 Ga0157377_10009290
560 Ga0157379_10085224
561 Ga0163161_10094945
562 Ga0163161_10191478
563 Ga0209026_1002621
564 Ga0209026_1006398
565 Ga0209455_1003716
566 Ga0207647_10009891
567 Ga0207645_10008418
568 Ga0207705_10000383
569 Ga0207705_10000669
570 Ga0207705_10001068
571 Ga0207705_10012489
572 Ga0207654_10083334
573 Ga0207707_10056208
574 Ga0207695_10000025
575 Ga0207695_10002290
576 Ga0207695_10009245
577 Ga0207695_10023247
578 Ga0207695_10074901
579 Ga0207695_10081274
580 Ga0207671_10001177
581 Ga0207671_10003751
582 Ga0207671_10014831
583 Ga0207657_10000077
584 Ga0207657_10005036
585 Ga0207657_10013117
586 Ga0207649_10001205
587 Ga0207649_10017837
588 Ga0207649_10036468
589 Ga0207652_10000776
590 Ga0207652_10004689
591 Ga0207652_10011329
592 Ga0207681_10018016
593 Ga0207694_10008213
594 Ga0207694_10022742
595 Ga0207650_10000926
596 Ga0207687_10003505
597 Ga0207700_10145100
598 Ga0207644_10116596
599 Ga0207690_10015148
600 Ga0207690_10027257
601 Ga0207706_10000204
602 Ga0207686_10001220
603 Ga0207686_10004559
604 Ga0207686_10008098
605 Ga0207709_10000187
606 Ga0207670_10006497
607 Ga0207670_10019948
608 Ga0207704_10000006
609 Ga0207689_10001911
610 Ga0207661_10019718
611 Ga0207679_10042450
612 Ga0207679_10064430
613 Ga0207667_10000022
614 Ga0207667_10000038
615 Ga0207667_10000984
616 Ga0207667_10039034
617 Ga0207667_10080230
618 Ga0207651_10000001
619 Ga0207651_10056679
620 Ga0207712_10007576
621 Ga0207712_10035418
622 Ga0207668_10154343
623 Ga0207640_10000142
624 Ga0207640_10000219
625 Ga0207677_10000016
626 Ga0207677_10004445
627 Ga0207639_10005197
628 Ga0207639_10012823
629 Ga0207678_10003654
630 Ga0207678_10014796
631 Ga0207678_10105110
632 Ga0207702_10000508
633 Ga0207641_10000013
634 Ga0207641_10012744
635 Ga0207641_10025238
636 Ga0207641_10097331
637 Ga0207648_10000042
638 Ga0207648_10008386
639 Ga0207674_10025180
640 Ga0207675_100161036
641 Ga0207698_10002293
642 Ga0207698_10048761
643 Ga0207698_10090558
644 Ga0265337_1000099
645 Ga0265319_1000219
646 Ga0265334_10002323
647 Ga0265318_10001424
648 Ga0265322_10002800
649 Ga0265336_10000568
650 Ga0265336_10002559
651 Ga0265336_10003497
652 Ga0307515_10001422
653 Ga0265338_10000781
654 Ga0265338_10001890
655 Ga0265338_10012330
656 Ga0265338_10016725
657 Ga0265324_10003182
658 Ga0265330_10008733
659 Ga0265328_10033574
660 Ga0265320_10008459
661 Ga0265325_10000327
662 Ga0265329_10031247
663 Ga0265340_10014624
664 Ga0265339_10001000
665 Ga0265339_10001428
666 Ga0265331_10063888
667 Ga0265316_10006946
668 Ga0265316_10020991
669 Ga0265316_10026636
670 Ga0307509_10041004
671 Ga0265313_10002637
672 Ga0265313_10009761
673 Ga0265314_10000027
674 Ga0265314_10004734
675 Ga0265314_10004869
676 Ga0265314_10041107
677 Ga0265314_10052201
678 Ga0265342_10004255
679 Ga0265342_10011089
680 Ga0265342_10029047
681 Ga0316576_10001323
682 Ga0316576_10058813
683 Ga0316578_10015555
684 Ga0316578_10057790
685 Ga0307412_10000539
686 Ga0307412_10001523
687 Ga0307412_10020767
688 Ga0316574_0030033
689 Ga0373937_0146271
690 Ga0395899_0000002
691 Ga0395899_0000136
692 Ga0395899_0000185
693 Ga0395899_0027460
694 Ga0395899_0036800
695 Ga0395900_0000410
696 Ga0395898_0006534
697 Ga0395898_0019297
698 Ga0395898_0029908
699 Ga0395905_0000203
700 Ga0395905_0013977
701 Ga0395905_0048319
702 Ga0395901_0000262
703 Ga0450923_001907
704 Ga0451577_0037617
705 Ga0451577_0144444
706 Ga0451577_0278934
707 Ga0466966_0017176
708 Ga0466961_0058971
709 Ga0453684_0000199
710 Ga0453684_0000529
711 Ga0453684_0001043
712 Ga0453684_0001256
713 Ga0453684_0002159
714 Ga0453684_0018832
715 Ga0453684_0027496
716 Ga0453684_0040087
717 Ga0453684_0096472
718 Ga0453684_0104514
719 Ga0453684_0139238
720 Ga0453684_0291891
721 Ga0466971_0001282
722 Ga0466959_0099221
723 Ga0451576_0000109
724 Ga0451576_0000264
725 Ga0451576_0001852
726 Ga0451576_0004415
727 Ga0451576_0009706
728 Ga0451576_0124906
729 Ga0451576_0135112
730 Ga0466958_0005260
731 Ga0466958_0052135
732 Ga0495651_0002889
733 Ga0495650_0000057
734 Ga0495585_0000461
735 Ga0495585_0000832
736 Ga0495596_0004881
737 Ga0495583_0025180
738 Ga0495583_0026688
739 Ga0495610_0000888
740 Ga0495616_0004310
741 Ga0495616_0015330
742 Ga0495630_0067718
743 Ga0495648_0009312
744 Ga0495652_0076850
745 Ga0495652_0078695
746 Ga0495587_0013946
747 Ga0495609_0003446
748 Ga0495633_0006361
749 Ga0495667_0007132
750 Ga0495668_0000003
751 Ga0495668_0000007
752 Ga0495625_0000003
753 Ga0495625_0000316
754 Ga0495625_0007009
755 Ga0495625_0165475
756 Ga0495661_0001280
757 Ga0495661_0009171
758 Ga0495599_0021849
759 Ga0495599_0038372
760 Ga0495623_0006764
761 Ga0495649_0000002
762 Ga0495600_0059085
763 Ga0495660_0013608
764 Ga0495683_0027392
765 Ga0495687_000061
766 Ga0495675_0002913
767 Ga0495673_0016448
768 Ga0495684_0000399
769 Ga0495684_0069209
770 Ga0495686_0000699
771 Ga0495686_0001566
772 Ga0495686_0008762
773 Ga0495614_0032083
774 Ga0496117_0014553
775 Ga0496117_0041799
776 Ga0496118_0060492
777 Ga0496120_0009268
778 Ga0496121_0000114
779 Ga0496121_0136776
780 Ga0496122_0013187
781 Ga0496123_0005049
782 Ga0496123_0071831
783 Ga0496124_0001053
784 Ga0496124_0003751
785 Ga0496126_0226501
786 Ga0501034_0034463
787 Ga0501035_0082174
788 Ga0500622_0039574
789 Ga0466962_0005238
790 2600202458
791 2600228845
792 2753764250
793 2819589367
794 2819714681
795 2919140478
796 2919441589
797 2928529187
798 2928968728
799 2946790979
800 2990268725
801 2993694568
802 8056443930

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

74

327

0.85

PF14200

RicinB_lectin_2

Ricin-type beta-trefoil lectin domain-like

404

494

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d5y-assembly1.cif.gz_A high resolution crystal structure of 1,5-alpha-arabinanase catalytic mutant (abnbe201a) 0.924 20 296
3d60-assembly1.cif.gz_A crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (d27a) 0.9236 20 296
3d61-assembly1.cif.gz_A crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (abnbd147a) complexed to arabinobiose 0.9234 21 296
3cu9-assembly1.cif.gz_A high resolution crystal structure of 1,5-alpha-l-arabinanase from geobacillus stearothermophilus 0.9193 20 296
6a8i-assembly2.cif.gz_B crystal structure of endo-arabinanase abn-ts d147n mutant in complex with arabinohexaose 0.9162 20 299
ID Description Score Start End Superfamily
1wl7A00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9066 15 294 2.115.10.20
1gyeB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8921 26 296 2.115.10.20
4kcbB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8897 20 299 2.115.10.20
2e4mB01 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.8467 301 477 2.80.10.50
3o4cA00 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.8422 305 477 2.80.10.50
ID Description Score Start End GO Terms
AF-A0A398E345-F1-model_v4 Uncharacterized protein 0.9818 184 239
AF-K1TMW2-F1-model_v4 Secreted arabinase 0.9788 74 295 GO:0004553
GO:0005975
AF-A0A060CB18-F1-model_v4 Glyco_hydro_43 0.9763 181 240 GO:0004553
GO:0005975
AF-A0A359FTV8-F1-model_v4 Glycoside hydrolase 0.974 168 244 GO:0004553
GO:0005975
AF-K1TMW2-F1-model_v4 Secreted arabinase 0.9659 74 295 GO:0004553
GO:0005975

Map