F435641

General Info

Members Datasets Scaffolds Average Seq Length
404 222 808 294

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10286453|Ga0105240_102864531
Length 332
Sequence LAVCSLRITLYILIFAENKLLGDCHDIELTLPTENCQLIMIQLLTPTYWKDYELIDCGDFEKLERFGNVILIRPEPQAVWSKGLSNAEWQRLHHIKFKGRSATSGEWLKKNPNTPDRWHIEYKNPEASIKFRLALTSFKHLGIFPEQAVNWDYITQSIKKFKTPQPKVLNLFAYTGGASLIARAAGADTTHVDSIKQVVTWANENQEISSLTDIRWVVEDALKFVKRELKRGKKYNGIILDPPAYGHGPNGEKWKLEDNINEMMGDVIQLLDPDEHFLILNTYSLGFSSVIIENLLKSAFPQVQNLETGELYLQATAGSKLPLGVFGKFFKG

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
184 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
185 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
186 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
187 2738541283 Pedobacter sp. OK701 Isolate Unclassified
188 2738541284 Pedobacter sp. YR016 Isolate Unclassified
189 2738541302 Pedobacter sp. CF074 Isolate Unclassified
190 2738543023 Pedobacter sp. OK628 Isolate Unclassified
191 2739367651 Pedobacter sp. OK291 Isolate Unclassified
192 2739367656 Pedobacter sp. CF523 Isolate Unclassified
193 2739367663 Pedobacter sp. YR510 Isolate Unclassified
194 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
195 2818991437 Pedobacter terrae 518 Isolate Unclassified
196 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
197 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
198 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
199 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
200 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
201 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
202 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
203 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
204 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
205 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
206 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
207 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
208 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
209 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
210 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
211 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
212 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
213 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
214 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
215 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
216 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
217 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
218 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
219 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
220 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
221 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
222 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.1
Metatranscriptomes 0
Isolates 9.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.65
Nodule 0
Rhizoplane 0.74
Rhizosphere 81.19
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10286453 3300009093 Bacteria 1890
2 SwRhRL2b_contig_3789038 2162886007 Bacteria 3332
3 JGI24736J21556_1002488 3300001904 Bacteria 3258
4 JGI24740J21852_10011173 3300001979 Bacteria 3427
5 JGI24739J22299_10001227 3300001989 Bacteria 9632
6 JGI24739J22299_10002824 3300001989 Bacteria 6670
7 JGI24737J22298_10002567 3300001990 Bacteria 6448
8 JGI24737J22298_10008757 3300001990 Bacteria 3379
9 JGI24735J21928_10000003 3300002067 Bacteria 385983
10 JGI25162J39368_1000039 3300002737 Bacteria 175976
11 JGI25162J39368_1002622 3300002737 Bacteria 6696
12 JGI25164J39214_1001675 3300002772 Bacteria 4541
13 JGI25152J39213_1000047 3300002773 Bacteria 84434
14 JGI25150J39212_1000001 3300002774 Bacteria 1318726
15 JGI25151J46595_10000001 3300003187 Bacteria 887211
16 JGI25165J46597_1001826 3300003214 Bacteria 8909
17 JGI25153J46596_10000001 3300003215 Bacteria 748985
18 rootH2_10000336 3300003320 Bacteria 69852
19 rootH2_10123056 3300003320 Bacteria 2535
20 rootL2_10102219 3300003322 Bacteria 3540
21 rootL2_10163997 3300003322 Bacteria 1758
22 rootH1_10008659 3300003323 Bacteria 16671
23 rootH1_10034267 3300003323 Bacteria 1817
24 rootH1_10174601 3300003323 Bacteria 1370
25 Ga0055536_1000004 3300003781 Bacteria 411108
26 Ga0055530_10003996 3300003791 Bacteria 7940
27 Ga0065165_1000715 3300005262 Bacteria 46870
28 Ga0065714_10002286 3300005288 Bacteria 28187
29 Ga0065714_10003259 3300005288 Bacteria 10519
30 Ga0065714_10006425 3300005288 Bacteria 3295
31 Ga0065714_10074519 3300005288 Bacteria 3026
32 Ga0065704_10000436 3300005289 Bacteria 20960
33 Ga0070658_10000099 3300005327 Bacteria 76585
34 Ga0070658_10058876 3300005327 Bacteria 3128
35 Ga0070658_10144543 3300005327 Bacteria 1988
36 Ga0070680_100033575 3300005336 Bacteria 4137
37 Ga0068868_100001905 3300005338 Bacteria 14329
38 Ga0070660_100014336 3300005339 Bacteria 5708
39 Ga0070671_100009005 3300005355 Bacteria 8010
40 Ga0070673_100014409 3300005364 Bacteria 5506
41 Ga0070688_100047203 3300005365 Bacteria 2670
42 Ga0070659_100001401 3300005366 Bacteria 17380
43 Ga0070659_100172916 3300005366 Bacteria 1770
44 Ga0070713_100250864 3300005436 Bacteria 1614
45 Ga0070663_100054821 3300005455 Bacteria 2851
46 Ga0070678_100003083 3300005456 Bacteria 9238
47 Ga0070662_100000013 3300005457 Bacteria 125019
48 Ga0070681_10002372 3300005458 Bacteria 17198
49 Ga0068867_100001318 3300005459 Bacteria 17186
50 Ga0070685_10004706 3300005466 Bacteria 6905
51 Ga0070679_100039718 3300005530 Bacteria 4678
52 Ga0068853_100014320 3300005539 Bacteria 6491
53 Ga0068853_100039664 3300005539 Bacteria 4017
54 Ga0068853_100041738 3300005539 Bacteria 3920
55 Ga0070665_100000010 3300005548 Bacteria 529545
56 Ga0068855_100000014 3300005563 Bacteria 232720
57 Ga0068855_100000127 3300005563 Bacteria 96826
58 Ga0068855_100034029 3300005563 Bacteria 6079
59 Ga0068856_100001917 3300005614 Bacteria 21679
60 Ga0068856_100010745 3300005614 Bacteria 8895
61 Ga0068856_100030071 3300005614 Bacteria 5309
62 Ga0068856_100054659 3300005614 Bacteria 3939
63 Ga0068856_100100186 3300005614 Bacteria 2889
64 Ga0068852_100042998 3300005616 Bacteria 3829
65 Ga0068866_10052692 3300005718 Bacteria 2077
66 Ga0068858_100276586 3300005842 Bacteria 1598
67 Ga0075366_10000284 3300006195 Bacteria 22680
68 Ga0075366_10026110 3300006195 Bacteria 3419
69 Ga0075366_10150505 3300006195 Bacteria 1409
70 Ga0097621_100007297 3300006237 Bacteria 7898
71 Ga0068871_100000477 3300006358 Bacteria 27401
72 Ga0068865_100000079 3300006881 Bacteria 51370
73 Ga0105244_10032583 3300009036 Bacteria 2756
74 Ga0105240_10000128 3300009093 Bacteria 156107
75 Ga0105240_10007930 3300009093 Bacteria 15316
76 Ga0105240_10081602 3300009093 Bacteria 3973
77 Ga0105240_10082772 3300009093 Bacteria 3941
78 Ga0105243_10000036 3300009148 Bacteria 176192
79 Ga0105241_10005949 3300009174 Bacteria 8994
80 Ga0105241_10007148 3300009174 Bacteria 8216
81 Ga0105241_10014382 3300009174 Bacteria 5795
82 Ga0105241_10083858 3300009174 Bacteria 2501
83 Ga0105241_10360869 3300009174 Bacteria 1264
84 Ga0105242_10015090 3300009176 Bacteria 5995
85 Ga0105237_10001875 3300009545 Bacteria 26830
86 Ga0105237_10003686 3300009545 Bacteria 18055
87 Ga0105237_10003998 3300009545 Bacteria 17241
88 Ga0105237_10027871 3300009545 Bacteria 5756
89 Ga0105237_10079767 3300009545 Bacteria 3263
90 Ga0105238_10001237 3300009551 Bacteria 25698
91 Ga0105238_10239122 3300009551 Bacteria 1793
92 Ga0105239_10000011 3300010375 Bacteria 337500
93 Ga0105239_10000086 3300010375 Bacteria 129798
94 Ga0105239_10000447 3300010375 Bacteria 60232
95 Ga0105239_10004132 3300010375 Bacteria 17427
96 Ga0105239_10008771 3300010375 Bacteria 11445
97 Ga0105239_10010414 3300010375 Bacteria 10403
98 Ga0105239_10065597 3300010375 Bacteria 3987
99 Ga0105239_10090909 3300010375 Bacteria 3368
100 Ga0105246_10053908 3300011119 Bacteria 2769
101 Ga0157373_10000115 3300013100 Bacteria 63326
102 Ga0157373_10000521 3300013100 Bacteria 30194
103 Ga0157373_10004093 3300013100 Bacteria 10985
104 Ga0157373_10040273 3300013100 Bacteria 3344
105 Ga0157373_10146167 3300013100 Bacteria 1663
106 Ga0157373_10330197 3300013100 Bacteria 1086
107 Ga0157371_10000041 3300013102 Bacteria 203957
108 Ga0157371_10001176 3300013102 Bacteria 28083
109 Ga0157371_10002327 3300013102 Bacteria 18239
110 Ga0157371_10004214 3300013102 Bacteria 12657
111 Ga0157371_10017985 3300013102 Bacteria 5237
112 Ga0157371_10028294 3300013102 Bacteria 4060
113 Ga0157371_10036703 3300013102 Bacteria 3509
114 Ga0157371_10114853 3300013102 Bacteria 1912
115 Ga0157371_10161184 3300013102 Bacteria 1602
116 Ga0157370_10003392 3300013104 Bacteria 18728
117 Ga0157370_10007957 3300013104 Bacteria 11483
118 Ga0157370_10023860 3300013104 Bacteria 6066
119 Ga0157370_10036615 3300013104 Bacteria 4760
120 Ga0157370_10055920 3300013104 Bacteria 3757
121 Ga0157370_10078097 3300013104 Bacteria 3117
122 Ga0157369_10000016 3300013105 Bacteria 257827
123 Ga0157369_10005273 3300013105 Bacteria 15070
124 Ga0157369_10046298 3300013105 Bacteria 4727
125 Ga0157369_10063780 3300013105 Bacteria 3969
126 Ga0157369_10142118 3300013105 Bacteria 2539
127 Ga0157369_10510538 3300013105 Bacteria 1243
128 Ga0157374_10001922 3300013296 Bacteria 17417
129 Ga0157374_10003676 3300013296 Bacteria 12891
130 Ga0157378_10035588 3300013297 Bacteria 4405
131 Ga0163162_10000005 3300013306 Bacteria 447195
132 Ga0163162_10000165 3300013306 Bacteria 60772
133 Ga0163162_10002294 3300013306 Bacteria 17960
134 Ga0163162_10008472 3300013306 Bacteria 10032
135 Ga0157372_10000026 3300013307 Bacteria 195407
136 Ga0157372_10001115 3300013307 Bacteria 29190
137 Ga0157372_10001320 3300013307 Bacteria 26848
138 Ga0157372_10002074 3300013307 Bacteria 21765
139 Ga0157372_10014112 3300013307 Bacteria 8533
140 Ga0157372_10016992 3300013307 Bacteria 7811
141 Ga0157372_10407244 3300013307 Bacteria 1585
142 Ga0157372_10413222 3300013307 Bacteria 1572
143 Ga0157375_10371105 3300013308 Bacteria 1597
144 Ga0182008_10000014 3300014497 Bacteria 263844
145 Ga0182008_10001372 3300014497 Bacteria 16489
146 Ga0182008_10002752 3300014497 Bacteria 10905
147 Ga0182008_10004470 3300014497 Bacteria 8174
148 Ga0182008_10004660 3300014497 Bacteria 7974
149 Ga0157377_10004017 3300014745 Bacteria 6709
150 Ga0182006_1000801 3300015261 Bacteria 21143
151 Ga0182006_1001602 3300015261 Bacteria 13393
152 Ga0182006_1001859 3300015261 Bacteria 12106
153 Ga0182006_1035527 3300015261 Bacteria 1986
154 Ga0182007_10000002 3300015262 Bacteria 564661
155 Ga0182007_10002401 3300015262 Bacteria 9354
156 Ga0182007_10005319 3300015262 Bacteria 5672
157 Ga0183373_1004 3300015682 Bacteria 537398
158 Ga0163161_10000347 3300017792 Bacteria 39178
159 Ga0163161_10000845 3300017792 Bacteria 23886
160 Ga0163161_10005117 3300017792 Bacteria 9125
161 Ga0163161_10005674 3300017792 Bacteria 8651
162 Ga0163161_10032425 3300017792 Bacteria 3730
163 Ga0163161_10136555 3300017792 Bacteria 1854
164 Ga0163161_10326644 3300017792 Bacteria 1214
165 Ga0207427_100131 3300025231 Bacteria 93947
166 Ga0209437_100048 3300025233 Bacteria 405107
167 Ga0209437_100135 3300025233 Bacteria 176455
168 Ga0207425_1000002 3300025245 Bacteria 1362590
169 Ga0209026_1000478 3300025250 Bacteria 30162
170 Ga0209026_1001313 3300025250 Bacteria 11198
171 Ga0209026_1002843 3300025250 Bacteria 6117
172 Ga0209129_1000002 3300025258 Bacteria 1359086
173 Ga0209129_1015212 3300025258 Bacteria 1596
174 Ga0209233_1000029 3300025261 Bacteria 641642
175 Ga0209233_1005713 3300025261 Bacteria 4100
176 Ga0209233_1015807 3300025261 Bacteria 2092
177 Ga0209455_1007233 3300025272 Bacteria 3161
178 Ga0209676_1000009 3300025292 Bacteria 981719
179 Ga0209025_1000004 3300025294 Bacteria 1361782
180 Ga0209758_1000006 3300025297 Bacteria 1359562
181 Ga0209050_1000048 3300025298 Bacteria 371553
182 Ga0209051_1060446 3300025303 Bacteria 1196
183 Ga0207655_1029330 3300025728 Bacteria 2577
184 Ga0207647_10000044 3300025904 Bacteria 90491
185 Ga0207647_10000431 3300025904 Bacteria 34359
186 Ga0207647_10043356 3300025904 Bacteria 2816
187 Ga0207645_10000558 3300025907 Bacteria 30976
188 Ga0207705_10000142 3300025909 Bacteria 76788
189 Ga0207705_10018485 3300025909 Bacteria 4984
190 Ga0207654_10003270 3300025911 Bacteria 8192
191 Ga0207654_10232381 3300025911 Bacteria 1229
192 Ga0207695_10000179 3300025913 Bacteria 185564
193 Ga0207695_10038900 3300025913 Bacteria 5115
194 Ga0207695_10199164 3300025913 Bacteria 1918
195 Ga0207695_10599176 3300025913 Bacteria 983
196 Ga0207671_10000651 3300025914 Bacteria 45376
197 Ga0207671_10002678 3300025914 Bacteria 18677
198 Ga0207671_10003211 3300025914 Bacteria 16463
199 Ga0207671_10014510 3300025914 Bacteria 6222
200 Ga0207671_10028752 3300025914 Bacteria 4153
201 Ga0207671_10038905 3300025914 Bacteria 3524
202 Ga0207671_10048646 3300025914 Bacteria 3138
203 Ga0207660_10025385 3300025917 Bacteria 4021
204 Ga0207657_10059179 3300025919 Bacteria 3294
205 Ga0207657_10247306 3300025919 Bacteria 1422
206 Ga0207652_10010229 3300025921 Bacteria 7549
207 Ga0207652_10046158 3300025921 Unclassified 3716
208 Ga0207694_10201970 3300025924 Bacteria 1617
209 Ga0207694_10283504 3300025924 Bacteria 1361
210 Ga0207690_10004483 3300025932 Bacteria 8245
211 Ga0207690_10015256 3300025932 Bacteria 4652
212 Ga0207690_10166439 3300025932 Bacteria 1648
213 Ga0207706_10000173 3300025933 Bacteria 71958
214 Ga0207686_10015420 3300025934 Bacteria 4272
215 Ga0207709_10000007 3300025935 Bacteria 752025
216 Ga0207670_10198532 3300025936 Bacteria 1523
217 Ga0207669_10057573 3300025937 Bacteria 2367
218 Ga0207704_10001338 3300025938 Bacteria 10993
219 Ga0207667_10000049 3300025949 Bacteria 235027
220 Ga0207667_10013565 3300025949 Bacteria 9315
221 Ga0207667_10020070 3300025949 Bacteria 7441
222 Ga0207667_10035329 3300025949 Bacteria 5362
223 Ga0207667_10093959 3300025949 Bacteria 3097
224 Ga0207667_10316112 3300025949 Bacteria 1595
225 Ga0207651_10053344 3300025960 Bacteria 2763
226 Ga0207677_10004495 3300026023 Bacteria 7499
227 Ga0207703_10246945 3300026035 Bacteria 1607
228 Ga0207639_10004556 3300026041 Bacteria 9333
229 Ga0207639_10388996 3300026041 Bacteria 1254
230 Ga0207678_10088566 3300026067 Bacteria 2645
231 Ga0207702_10001296 3300026078 Bacteria 25030
232 Ga0207702_10042414 3300026078 Bacteria 3816
233 Ga0207702_10050460 3300026078 Bacteria 3513
234 Ga0207702_10071103 3300026078 Bacteria 2995
235 Ga0207702_10135558 3300026078 Unclassified 2221
236 Ga0207702_10173842 3300026078 Bacteria 1978
237 Ga0207648_10002973 3300026089 Bacteria 17907
238 Ga0207674_10266410 3300026116 Bacteria 1661
239 Ga0207683_10009309 3300026121 Bacteria 8369
240 Ga0207698_10221455 3300026142 Bacteria 1710
241 Ga0268266_10000032 3300028379 Bacteria 395079
242 Ga0265337_1043919 3300028556 Bacteria 1276
243 Ga0265323_10000396 3300028653 Bacteria 25100
244 Ga0307517_10000640 3300028786 Bacteria 59989
245 Ga0307515_10003374 3300028794 Bacteria 33668
246 Ga0265338_10000989 3300028800 Bacteria 47912
247 Ga0265338_10013462 3300028800 Bacteria 9235
248 Ga0316183_1052705 3300030742 Bacteria 4356
249 Ga0316181_1256224 3300030744 Bacteria 4456
250 Ga0316182_1348770 3300030745 Bacteria 2908
251 Ga0265327_10006259 3300031251 Bacteria 9586
252 Ga0265327_10126597 3300031251 Bacteria 1205
253 Ga0265316_10000307 3300031344 Bacteria 54686
254 Ga0265316_10013610 3300031344 Bacteria 7218
255 Ga0307408_100000714 3300031548 Bacteria 26984
256 Ga0307408_100003290 3300031548 Bacteria 11117
257 Ga0307408_100003441 3300031548 Bacteria 10830
258 Ga0307405_10000006 3300031731 Bacteria 361477
259 Ga0307405_10231579 3300031731 Bacteria 1362
260 Ga0307407_10000075 3300031903 Bacteria 35183
261 Ga0307412_10000068 3300031911 Bacteria 113739
262 Ga0307412_10006713 3300031911 Bacteria 6523
263 Ga0307412_10028366 3300031911 Bacteria 3501
264 Ga0307416_100000002 3300032002 Bacteria 509907
265 Ga0307414_10001617 3300032004 Bacteria 11716
266 Ga0307414_10002566 3300032004 Bacteria 9554
267 Ga0307414_10014391 3300032004 Bacteria 4742
268 Ga0307414_10036948 3300032004 Bacteria 3266
269 Ga0307414_10084936 3300032004 Bacteria 2330
270 Ga0307414_10090024 3300032004 Bacteria 2276
271 Ga0307411_10024593 3300032005 Bacteria 3593
272 Ga0307507_10000034 3300033179 Bacteria 188697
273 Ga0307510_10008975 3300033180 Bacteria 11903
274 Ga0395899_0000011 3300037312 Bacteria 521331
275 Ga0395899_0000055 3300037312 Bacteria 220579
276 Ga0395899_0000303 3300037312 Bacteria 63241
277 Ga0395899_0001931 3300037312 Bacteria 17070
278 Ga0395899_0112284 3300037312 Bacteria 1958
279 Ga0395900_0000173 3300037418 Bacteria 103767
280 Ga0395900_0001236 3300037418 Bacteria 31409
281 Ga0395900_0040803 3300037418 Bacteria 4784
282 Ga0395900_0524250 3300037418 Unclassified 1132
283 Ga0395900_0528442 3300037418 Bacteria 1127
284 Ga0395898_0020480 3300037466 Bacteria 6717
285 Ga0395898_0025595 3300037466 Bacteria 5944
286 Ga0395905_0000001 3300037471 Bacteria 2037079
287 Ga0395905_0000049 3300037471 Bacteria 230719
288 Ga0395905_0000641 3300037471 Bacteria 46724
289 Ga0395905_0000779 3300037471 Bacteria 41889
290 Ga0395901_0000294 3300038443 Bacteria 61869
291 Ga0395901_0002154 3300038443 Bacteria 20114
292 Ga0395901_0032891 3300038443 Bacteria 5350
293 Ga0395901_0247485 3300038443 Bacteria 1858
294 Ga0436361_0154863 3300039447 Bacteria 1807
295 Ga0451795_0195139 3300041456 Bacteria 1399
296 Ga0451795_1274708 3300041456 Bacteria 2078
297 Ga0451577_0002121 3300042876 Bacteria 24379
298 Ga0466961_0065374 3300044693 Bacteria 2311
299 Ga0453684_0002170 3300044712 Bacteria 49036
300 Ga0453684_0009912 3300044712 Bacteria 16444
301 Ga0453684_0036648 3300044712 Bacteria 6754
302 Ga0453684_0527489 3300044712 Unclassified 1304
303 Ga0466959_0023961 3300045049 Bacteria 4519
304 Ga0451576_0000003 3300045051 Bacteria 1550573
305 Ga0495627_019553 3300046453 Bacteria 2269
306 Ga0495627_054238 3300046453 Bacteria 1199
307 Ga0495650_0000023 3300046471 Bacteria 527763
308 Ga0495585_0000476 3300046492 Bacteria 38316
309 Ga0495606_0000654 3300046507 Bacteria 54570
310 Ga0495606_0007518 3300046507 Bacteria 9722
311 Ga0495606_0011077 3300046507 Bacteria 7393
312 Ga0495610_0000099 3300046512 Bacteria 101553
313 Ga0495610_0002884 3300046512 Bacteria 13921
314 Ga0495610_0014026 3300046512 Bacteria 4732
315 Ga0495616_0002030 3300046513 Bacteria 13617
316 Ga0495631_0006507 3300046518 Bacteria 6028
317 Ga0495631_0066973 3300046518 Bacteria 1554
318 Ga0495637_0047636 3300046520 Bacteria 1808
319 Ga0495637_0077427 3300046520 Bacteria 1331
320 Ga0495644_0009710 3300046523 Bacteria 3704
321 Ga0495648_0017947 3300046524 Bacteria 5034
322 Ga0495652_0145161 3300046529 Bacteria 1861
323 Ga0495652_0281961 3300046529 Bacteria 1216
324 Ga0495654_0055466 3300046530 Bacteria 1918
325 Ga0495609_0024707 3300046538 Bacteria 2755
326 Ga0495633_0000072 3300046558 Bacteria 131197
327 Ga0495633_0001658 3300046558 Bacteria 16787
328 Ga0495633_0034976 3300046558 Bacteria 2414
329 Ga0495668_0000165 3300046616 Bacteria 98016
330 Ga0495625_0000308 3300046660 Bacteria 74661
331 Ga0495625_0001492 3300046660 Bacteria 28147
332 Ga0495625_0008279 3300046660 Bacteria 8886
333 Ga0495625_0015637 3300046660 Bacteria 6001
334 Ga0495625_0076797 3300046660 Bacteria 2335
335 Ga0495661_0005393 3300046665 Bacteria 9090
336 Ga0495671_0024038 3300046692 Bacteria 3179
337 Ga0495649_0000105 3300046694 Bacteria 74750
338 Ga0495649_0022176 3300046694 Bacteria 3553
339 Ga0495660_0039154 3300046810 Bacteria 2633
340 Ga0495687_003058 3300047443 Bacteria 12553
341 Ga0495687_011296 3300047443 Bacteria 4814
342 Ga0495687_049620 3300047443 Bacteria 1793
343 Ga0495681_0055156 3300047470 Bacteria 1854
344 Ga0495686_0000419 3300047472 Bacteria 66923
345 Ga0495686_0002676 3300047472 Bacteria 16402
346 Ga0495686_0026750 3300047472 Bacteria 3774
347 Ga0495686_0036952 3300047472 Bacteria 3132
348 Ga0495686_0106248 3300047472 Bacteria 1688
349 Ga0496116_0002245 3300048919 Bacteria 20539
350 Ga0496117_0002421 3300048920 Bacteria 23637
351 Ga0496122_0047693 3300048925 Bacteria 3305
352 Ga0495678_026901 3300049459 Bacteria 2447
353 Ga0501033_0171166 3300049570 Bacteria 1560
354 Ga0501223_001257 3300049663 Bacteria 5923
355 nmdc:mga0k408_1577_c1 3300050493 Bacteria 12314
356 nmdc:mga0k408_349_c1 3300050493 Bacteria 23383
357 Ga0500635_0000648 3300053080 Bacteria 8892
358 Ga0500651_0000210 3300053093 Bacteria 36797
359 Ga0500608_031302 3300053122 Bacteria 2524
360 Ga0500618_000005 3300053125 Bacteria 253092
361 Ga0500618_009939 3300053125 Bacteria 2575
362 Ga0500568_0039821 3300053139 Bacteria 1895
363 Ga0500622_0000654 3300053156 Bacteria 30848
364 Ga0500624_000465 3300053157 Bacteria 12081
365 2522550968 2522125168 Bacteria 7376607
366 2586208107 2585427687 Bacteria 5544917
367 2599479419 2599185184 Bacteria 6430550
368 2722730509 2721755487 Bacteria 6357185
369 2738756852 2738541283 Bacteria 7222293
370 2738760096 2738541284 Bacteria 5199923
371 2738856555 2738541302 Bacteria 5944758
372 2739304973 2738543023 Bacteria 6767879
373 2739588102 2739367651 Bacteria 6359826
374 2739616199 2739367656 Bacteria 5152243
375 2739646858 2739367663 Bacteria 5040914
376 2776612075 2775506987 Bacteria 5373360
377 2819545996 2818991437 Bacteria 5805520
378 2842724102 2842722452 Bacteria 6263924
379 2842908358 2842903701 Bacteria 6986368
380 2842912168 2842909656 Bacteria 6185908
381 2849282418 2849281842 Bacteria 6065644
382 2852625806 2852623160 Bacteria 4376875
383 2852631743 2852627209 Bacteria 5896285
384 2857631298 2857627736 Bacteria 5625397
385 2884935668 2884933994 Bacteria 4535041
386 2890738205 2890737413 Bacteria 4269751
387 2896321064 2896317667 Bacteria 4606601
388 2896346336 2896344016 Bacteria 3811746
389 2898713948 2898713307 Bacteria 4110805
390 2902052373 2902048731 Bacteria 4976191
391 2904446258 2904445276 Bacteria 5310396
392 2904785499 2904780799 Bacteria 5840761
393 2919182046 2919177583 Bacteria 5641607
394 2919191411 2919186247 Bacteria 6244071
395 2919437982 2919437846 Bacteria 6199444
396 2928082275 2928078545 Bacteria 6534839
397 2928149148 2928147474 Bacteria 6512076
398 2932084990 2932082852 Bacteria 6563563
399 2939669670 2939664404 Bacteria 6364494
400 2945999081 2945997725 Bacteria 6404843
401 2954021533 2954016120 Bacteria 6446024
402 2977235800 2977232053 Bacteria 5485925
403 3003234760 3003233435 Bacteria 4458031
404 8055589999 8055588893 Bacteria 3619545
405 Ga0105240_10286453
406 SwRhRL2b_contig_3789038
407 JGI24736J21556_1002488
408 JGI24740J21852_10011173
409 JGI24739J22299_10001227
410 JGI24739J22299_10002824
411 JGI24737J22298_10002567
412 JGI24737J22298_10008757
413 JGI24735J21928_10000003
414 JGI25162J39368_1000039
415 JGI25162J39368_1002622
416 JGI25164J39214_1001675
417 JGI25152J39213_1000047
418 JGI25150J39212_1000001
419 JGI25151J46595_10000001
420 JGI25165J46597_1001826
421 JGI25153J46596_10000001
422 rootH2_10000336
423 rootH2_10123056
424 rootL2_10102219
425 rootL2_10163997
426 rootH1_10008659
427 rootH1_10034267
428 rootH1_10174601
429 Ga0055536_1000004
430 Ga0055530_10003996
431 Ga0065165_1000715
432 Ga0065714_10002286
433 Ga0065714_10003259
434 Ga0065714_10006425
435 Ga0065714_10074519
436 Ga0065704_10000436
437 Ga0070658_10000099
438 Ga0070658_10058876
439 Ga0070658_10144543
440 Ga0070680_100033575
441 Ga0068868_100001905
442 Ga0070660_100014336
443 Ga0070671_100009005
444 Ga0070673_100014409
445 Ga0070688_100047203
446 Ga0070659_100001401
447 Ga0070659_100172916
448 Ga0070713_100250864
449 Ga0070663_100054821
450 Ga0070678_100003083
451 Ga0070662_100000013
452 Ga0070681_10002372
453 Ga0068867_100001318
454 Ga0070685_10004706
455 Ga0070679_100039718
456 Ga0068853_100014320
457 Ga0068853_100039664
458 Ga0068853_100041738
459 Ga0070665_100000010
460 Ga0068855_100000014
461 Ga0068855_100000127
462 Ga0068855_100034029
463 Ga0068856_100001917
464 Ga0068856_100010745
465 Ga0068856_100030071
466 Ga0068856_100054659
467 Ga0068856_100100186
468 Ga0068852_100042998
469 Ga0068866_10052692
470 Ga0068858_100276586
471 Ga0075366_10000284
472 Ga0075366_10026110
473 Ga0075366_10150505
474 Ga0097621_100007297
475 Ga0068871_100000477
476 Ga0068865_100000079
477 Ga0105244_10032583
478 Ga0105240_10000128
479 Ga0105240_10007930
480 Ga0105240_10081602
481 Ga0105240_10082772
482 Ga0105243_10000036
483 Ga0105241_10005949
484 Ga0105241_10007148
485 Ga0105241_10014382
486 Ga0105241_10083858
487 Ga0105241_10360869
488 Ga0105242_10015090
489 Ga0105237_10001875
490 Ga0105237_10003686
491 Ga0105237_10003998
492 Ga0105237_10027871
493 Ga0105237_10079767
494 Ga0105238_10001237
495 Ga0105238_10239122
496 Ga0105239_10000011
497 Ga0105239_10000086
498 Ga0105239_10000447
499 Ga0105239_10004132
500 Ga0105239_10008771
501 Ga0105239_10010414
502 Ga0105239_10065597
503 Ga0105239_10090909
504 Ga0105246_10053908
505 Ga0157373_10000115
506 Ga0157373_10000521
507 Ga0157373_10004093
508 Ga0157373_10040273
509 Ga0157373_10146167
510 Ga0157373_10330197
511 Ga0157371_10000041
512 Ga0157371_10001176
513 Ga0157371_10002327
514 Ga0157371_10004214
515 Ga0157371_10017985
516 Ga0157371_10028294
517 Ga0157371_10036703
518 Ga0157371_10114853
519 Ga0157371_10161184
520 Ga0157370_10003392
521 Ga0157370_10007957
522 Ga0157370_10023860
523 Ga0157370_10036615
524 Ga0157370_10055920
525 Ga0157370_10078097
526 Ga0157369_10000016
527 Ga0157369_10005273
528 Ga0157369_10046298
529 Ga0157369_10063780
530 Ga0157369_10142118
531 Ga0157369_10510538
532 Ga0157374_10001922
533 Ga0157374_10003676
534 Ga0157378_10035588
535 Ga0163162_10000005
536 Ga0163162_10000165
537 Ga0163162_10002294
538 Ga0163162_10008472
539 Ga0157372_10000026
540 Ga0157372_10001115
541 Ga0157372_10001320
542 Ga0157372_10002074
543 Ga0157372_10014112
544 Ga0157372_10016992
545 Ga0157372_10407244
546 Ga0157372_10413222
547 Ga0157375_10371105
548 Ga0182008_10000014
549 Ga0182008_10001372
550 Ga0182008_10002752
551 Ga0182008_10004470
552 Ga0182008_10004660
553 Ga0157377_10004017
554 Ga0182006_1000801
555 Ga0182006_1001602
556 Ga0182006_1001859
557 Ga0182006_1035527
558 Ga0182007_10000002
559 Ga0182007_10002401
560 Ga0182007_10005319
561 Ga0183373_1004
562 Ga0163161_10000347
563 Ga0163161_10000845
564 Ga0163161_10005117
565 Ga0163161_10005674
566 Ga0163161_10032425
567 Ga0163161_10136555
568 Ga0163161_10326644
569 Ga0207427_100131
570 Ga0209437_100048
571 Ga0209437_100135
572 Ga0207425_1000002
573 Ga0209026_1000478
574 Ga0209026_1001313
575 Ga0209026_1002843
576 Ga0209129_1000002
577 Ga0209129_1015212
578 Ga0209233_1000029
579 Ga0209233_1005713
580 Ga0209233_1015807
581 Ga0209455_1007233
582 Ga0209676_1000009
583 Ga0209025_1000004
584 Ga0209758_1000006
585 Ga0209050_1000048
586 Ga0209051_1060446
587 Ga0207655_1029330
588 Ga0207647_10000044
589 Ga0207647_10000431
590 Ga0207647_10043356
591 Ga0207645_10000558
592 Ga0207705_10000142
593 Ga0207705_10018485
594 Ga0207654_10003270
595 Ga0207654_10232381
596 Ga0207695_10000179
597 Ga0207695_10038900
598 Ga0207695_10199164
599 Ga0207695_10599176
600 Ga0207671_10000651
601 Ga0207671_10002678
602 Ga0207671_10003211
603 Ga0207671_10014510
604 Ga0207671_10028752
605 Ga0207671_10038905
606 Ga0207671_10048646
607 Ga0207660_10025385
608 Ga0207657_10059179
609 Ga0207657_10247306
610 Ga0207652_10010229
611 Ga0207652_10046158
612 Ga0207694_10201970
613 Ga0207694_10283504
614 Ga0207690_10004483
615 Ga0207690_10015256
616 Ga0207690_10166439
617 Ga0207706_10000173
618 Ga0207686_10015420
619 Ga0207709_10000007
620 Ga0207670_10198532
621 Ga0207669_10057573
622 Ga0207704_10001338
623 Ga0207667_10000049
624 Ga0207667_10013565
625 Ga0207667_10020070
626 Ga0207667_10035329
627 Ga0207667_10093959
628 Ga0207667_10316112
629 Ga0207651_10053344
630 Ga0207677_10004495
631 Ga0207703_10246945
632 Ga0207639_10004556
633 Ga0207639_10388996
634 Ga0207678_10088566
635 Ga0207702_10001296
636 Ga0207702_10042414
637 Ga0207702_10050460
638 Ga0207702_10071103
639 Ga0207702_10135558
640 Ga0207702_10173842
641 Ga0207648_10002973
642 Ga0207674_10266410
643 Ga0207683_10009309
644 Ga0207698_10221455
645 Ga0268266_10000032
646 Ga0265337_1043919
647 Ga0265323_10000396
648 Ga0307517_10000640
649 Ga0307515_10003374
650 Ga0265338_10000989
651 Ga0265338_10013462
652 Ga0316183_1052705
653 Ga0316181_1256224
654 Ga0316182_1348770
655 Ga0265327_10006259
656 Ga0265327_10126597
657 Ga0265316_10000307
658 Ga0265316_10013610
659 Ga0307408_100000714
660 Ga0307408_100003290
661 Ga0307408_100003441
662 Ga0307405_10000006
663 Ga0307405_10231579
664 Ga0307407_10000075
665 Ga0307412_10000068
666 Ga0307412_10006713
667 Ga0307412_10028366
668 Ga0307416_100000002
669 Ga0307414_10001617
670 Ga0307414_10002566
671 Ga0307414_10014391
672 Ga0307414_10036948
673 Ga0307414_10084936
674 Ga0307414_10090024
675 Ga0307411_10024593
676 Ga0307507_10000034
677 Ga0307510_10008975
678 Ga0395899_0000011
679 Ga0395899_0000055
680 Ga0395899_0000303
681 Ga0395899_0001931
682 Ga0395899_0112284
683 Ga0395900_0000173
684 Ga0395900_0001236
685 Ga0395900_0040803
686 Ga0395900_0524250
687 Ga0395900_0528442
688 Ga0395898_0020480
689 Ga0395898_0025595
690 Ga0395905_0000001
691 Ga0395905_0000049
692 Ga0395905_0000641
693 Ga0395905_0000779
694 Ga0395901_0000294
695 Ga0395901_0002154
696 Ga0395901_0032891
697 Ga0395901_0247485
698 Ga0436361_0154863
699 Ga0451795_0195139
700 Ga0451795_1274708
701 Ga0451577_0002121
702 Ga0466961_0065374
703 Ga0453684_0002170
704 Ga0453684_0009912
705 Ga0453684_0036648
706 Ga0453684_0527489
707 Ga0466959_0023961
708 Ga0451576_0000003
709 Ga0495627_019553
710 Ga0495627_054238
711 Ga0495650_0000023
712 Ga0495585_0000476
713 Ga0495606_0000654
714 Ga0495606_0007518
715 Ga0495606_0011077
716 Ga0495610_0000099
717 Ga0495610_0002884
718 Ga0495610_0014026
719 Ga0495616_0002030
720 Ga0495631_0006507
721 Ga0495631_0066973
722 Ga0495637_0047636
723 Ga0495637_0077427
724 Ga0495644_0009710
725 Ga0495648_0017947
726 Ga0495652_0145161
727 Ga0495652_0281961
728 Ga0495654_0055466
729 Ga0495609_0024707
730 Ga0495633_0000072
731 Ga0495633_0001658
732 Ga0495633_0034976
733 Ga0495668_0000165
734 Ga0495625_0000308
735 Ga0495625_0001492
736 Ga0495625_0008279
737 Ga0495625_0015637
738 Ga0495625_0076797
739 Ga0495661_0005393
740 Ga0495671_0024038
741 Ga0495649_0000105
742 Ga0495649_0022176
743 Ga0495660_0039154
744 Ga0495687_003058
745 Ga0495687_011296
746 Ga0495687_049620
747 Ga0495681_0055156
748 Ga0495686_0000419
749 Ga0495686_0002676
750 Ga0495686_0026750
751 Ga0495686_0036952
752 Ga0495686_0106248
753 Ga0496116_0002245
754 Ga0496117_0002421
755 Ga0496122_0047693
756 Ga0495678_026901
757 Ga0501033_0171166
758 Ga0501223_001257
759 nmdc:mga0k408_1577_c1
760 nmdc:mga0k408_349_c1
761 Ga0500635_0000648
762 Ga0500651_0000210
763 Ga0500608_031302
764 Ga0500618_000005
765 Ga0500618_009939
766 Ga0500568_0039821
767 Ga0500622_0000654
768 Ga0500624_000465
769 2522550968
770 2586208107
771 2599479419
772 2722730509
773 2738756852
774 2738760096
775 2738856555
776 2739304973
777 2739588102
778 2739616199
779 2739646858
780 2776612075
781 2819545996
782 2842724102
783 2842908358
784 2842912168
785 2849282418
786 2852625806
787 2852631743
788 2857631298
789 2884935668
790 2890738205
791 2896321064
792 2896346336
793 2898713948
794 2902052373
795 2904446258
796 2904785499
797 2919182046
798 2919191411
799 2919437982
800 2928082275
801 2928149148
802 2932084990
803 2939669670
804 2945999081
805 2954021533
806 2977235800
807 3003234760
808 8055589999

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

78

308

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2igt-assembly1.cif.gz_A crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.9022 3 290
2igt-assembly1.cif.gz_B crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.898 3 290
2igt-assembly1.cif.gz_C crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.8945 3 290
2igt-assembly1.cif.gz_A crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.8816 3 290
2igt-assembly1.cif.gz_B crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens 0.8775 3 290
ID Description Score Start End Superfamily
2igtB02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9013 11 76 2.60.40.1180
2igtC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.886 76 290 3.40.50.150
2igtB02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8751 11 76 2.60.40.1180
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8604 125 193 3.40.50.150
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8593 127 177 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3C0S4M0-F1-model_v4 Oxidoreductase 0.9818 104 293 GO:0008168
GO:0032259
AF-A0A4V1SMX7-F1-model_v4 deleted 0.9807 1 166
AF-A0A519XIT6-F1-model_v4 Oxidoreductase 0.9801 1 198
AF-A0A519XIT6-F1-model_v4 Oxidoreductase 0.9752 1 198
AF-A0A4V1SMX7-F1-model_v4 deleted 0.9749 1 166

Map