F435641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 222 | 808 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10286453|Ga0105240_102864531 |
| Length | 332 |
| Sequence | LAVCSLRITLYILIFAENKLLGDCHDIELTLPTENCQLIMIQLLTPTYWKDYELIDCGDFEKLERFGNVILIRPEPQAVWSKGLSNAEWQRLHHIKFKGRSATSGEWLKKNPNTPDRWHIEYKNPEASIKFRLALTSFKHLGIFPEQAVNWDYITQSIKKFKTPQPKVLNLFAYTGGASLIARAAGADTTHVDSIKQVVTWANENQEISSLTDIRWVVEDALKFVKRELKRGKKYNGIILDPPAYGHGPNGEKWKLEDNINEMMGDVIQLLDPDEHFLILNTYSLGFSSVIIENLLKSAFPQVQNLETGELYLQATAGSKLPLGVFGKFFKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 121 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 122 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 176 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 181 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 182 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 183 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 184 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 185 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 186 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 187 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 188 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 189 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 190 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 191 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 192 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 193 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 194 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 195 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 196 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 197 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 198 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 199 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 200 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 201 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 202 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 203 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 204 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 205 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 206 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 207 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 208 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 209 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 210 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 211 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 212 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 213 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 214 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 215 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 216 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 217 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 218 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 219 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 220 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 221 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 222 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.1 |
| Metatranscriptomes | 0 |
| Isolates | 9.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.65 |
| Nodule | 0 |
| Rhizoplane | 0.74 |
| Rhizosphere | 81.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10286453 | 3300009093 | Bacteria | 1890 |
| 2 | SwRhRL2b_contig_3789038 | 2162886007 | Bacteria | 3332 |
| 3 | JGI24736J21556_1002488 | 3300001904 | Bacteria | 3258 |
| 4 | JGI24740J21852_10011173 | 3300001979 | Bacteria | 3427 |
| 5 | JGI24739J22299_10001227 | 3300001989 | Bacteria | 9632 |
| 6 | JGI24739J22299_10002824 | 3300001989 | Bacteria | 6670 |
| 7 | JGI24737J22298_10002567 | 3300001990 | Bacteria | 6448 |
| 8 | JGI24737J22298_10008757 | 3300001990 | Bacteria | 3379 |
| 9 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 10 | JGI25162J39368_1000039 | 3300002737 | Bacteria | 175976 |
| 11 | JGI25162J39368_1002622 | 3300002737 | Bacteria | 6696 |
| 12 | JGI25164J39214_1001675 | 3300002772 | Bacteria | 4541 |
| 13 | JGI25152J39213_1000047 | 3300002773 | Bacteria | 84434 |
| 14 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 15 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 16 | JGI25165J46597_1001826 | 3300003214 | Bacteria | 8909 |
| 17 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 18 | rootH2_10000336 | 3300003320 | Bacteria | 69852 |
| 19 | rootH2_10123056 | 3300003320 | Bacteria | 2535 |
| 20 | rootL2_10102219 | 3300003322 | Bacteria | 3540 |
| 21 | rootL2_10163997 | 3300003322 | Bacteria | 1758 |
| 22 | rootH1_10008659 | 3300003323 | Bacteria | 16671 |
| 23 | rootH1_10034267 | 3300003323 | Bacteria | 1817 |
| 24 | rootH1_10174601 | 3300003323 | Bacteria | 1370 |
| 25 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 26 | Ga0055530_10003996 | 3300003791 | Bacteria | 7940 |
| 27 | Ga0065165_1000715 | 3300005262 | Bacteria | 46870 |
| 28 | Ga0065714_10002286 | 3300005288 | Bacteria | 28187 |
| 29 | Ga0065714_10003259 | 3300005288 | Bacteria | 10519 |
| 30 | Ga0065714_10006425 | 3300005288 | Bacteria | 3295 |
| 31 | Ga0065714_10074519 | 3300005288 | Bacteria | 3026 |
| 32 | Ga0065704_10000436 | 3300005289 | Bacteria | 20960 |
| 33 | Ga0070658_10000099 | 3300005327 | Bacteria | 76585 |
| 34 | Ga0070658_10058876 | 3300005327 | Bacteria | 3128 |
| 35 | Ga0070658_10144543 | 3300005327 | Bacteria | 1988 |
| 36 | Ga0070680_100033575 | 3300005336 | Bacteria | 4137 |
| 37 | Ga0068868_100001905 | 3300005338 | Bacteria | 14329 |
| 38 | Ga0070660_100014336 | 3300005339 | Bacteria | 5708 |
| 39 | Ga0070671_100009005 | 3300005355 | Bacteria | 8010 |
| 40 | Ga0070673_100014409 | 3300005364 | Bacteria | 5506 |
| 41 | Ga0070688_100047203 | 3300005365 | Bacteria | 2670 |
| 42 | Ga0070659_100001401 | 3300005366 | Bacteria | 17380 |
| 43 | Ga0070659_100172916 | 3300005366 | Bacteria | 1770 |
| 44 | Ga0070713_100250864 | 3300005436 | Bacteria | 1614 |
| 45 | Ga0070663_100054821 | 3300005455 | Bacteria | 2851 |
| 46 | Ga0070678_100003083 | 3300005456 | Bacteria | 9238 |
| 47 | Ga0070662_100000013 | 3300005457 | Bacteria | 125019 |
| 48 | Ga0070681_10002372 | 3300005458 | Bacteria | 17198 |
| 49 | Ga0068867_100001318 | 3300005459 | Bacteria | 17186 |
| 50 | Ga0070685_10004706 | 3300005466 | Bacteria | 6905 |
| 51 | Ga0070679_100039718 | 3300005530 | Bacteria | 4678 |
| 52 | Ga0068853_100014320 | 3300005539 | Bacteria | 6491 |
| 53 | Ga0068853_100039664 | 3300005539 | Bacteria | 4017 |
| 54 | Ga0068853_100041738 | 3300005539 | Bacteria | 3920 |
| 55 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 56 | Ga0068855_100000014 | 3300005563 | Bacteria | 232720 |
| 57 | Ga0068855_100000127 | 3300005563 | Bacteria | 96826 |
| 58 | Ga0068855_100034029 | 3300005563 | Bacteria | 6079 |
| 59 | Ga0068856_100001917 | 3300005614 | Bacteria | 21679 |
| 60 | Ga0068856_100010745 | 3300005614 | Bacteria | 8895 |
| 61 | Ga0068856_100030071 | 3300005614 | Bacteria | 5309 |
| 62 | Ga0068856_100054659 | 3300005614 | Bacteria | 3939 |
| 63 | Ga0068856_100100186 | 3300005614 | Bacteria | 2889 |
| 64 | Ga0068852_100042998 | 3300005616 | Bacteria | 3829 |
| 65 | Ga0068866_10052692 | 3300005718 | Bacteria | 2077 |
| 66 | Ga0068858_100276586 | 3300005842 | Bacteria | 1598 |
| 67 | Ga0075366_10000284 | 3300006195 | Bacteria | 22680 |
| 68 | Ga0075366_10026110 | 3300006195 | Bacteria | 3419 |
| 69 | Ga0075366_10150505 | 3300006195 | Bacteria | 1409 |
| 70 | Ga0097621_100007297 | 3300006237 | Bacteria | 7898 |
| 71 | Ga0068871_100000477 | 3300006358 | Bacteria | 27401 |
| 72 | Ga0068865_100000079 | 3300006881 | Bacteria | 51370 |
| 73 | Ga0105244_10032583 | 3300009036 | Bacteria | 2756 |
| 74 | Ga0105240_10000128 | 3300009093 | Bacteria | 156107 |
| 75 | Ga0105240_10007930 | 3300009093 | Bacteria | 15316 |
| 76 | Ga0105240_10081602 | 3300009093 | Bacteria | 3973 |
| 77 | Ga0105240_10082772 | 3300009093 | Bacteria | 3941 |
| 78 | Ga0105243_10000036 | 3300009148 | Bacteria | 176192 |
| 79 | Ga0105241_10005949 | 3300009174 | Bacteria | 8994 |
| 80 | Ga0105241_10007148 | 3300009174 | Bacteria | 8216 |
| 81 | Ga0105241_10014382 | 3300009174 | Bacteria | 5795 |
| 82 | Ga0105241_10083858 | 3300009174 | Bacteria | 2501 |
| 83 | Ga0105241_10360869 | 3300009174 | Bacteria | 1264 |
| 84 | Ga0105242_10015090 | 3300009176 | Bacteria | 5995 |
| 85 | Ga0105237_10001875 | 3300009545 | Bacteria | 26830 |
| 86 | Ga0105237_10003686 | 3300009545 | Bacteria | 18055 |
| 87 | Ga0105237_10003998 | 3300009545 | Bacteria | 17241 |
| 88 | Ga0105237_10027871 | 3300009545 | Bacteria | 5756 |
| 89 | Ga0105237_10079767 | 3300009545 | Bacteria | 3263 |
| 90 | Ga0105238_10001237 | 3300009551 | Bacteria | 25698 |
| 91 | Ga0105238_10239122 | 3300009551 | Bacteria | 1793 |
| 92 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 93 | Ga0105239_10000086 | 3300010375 | Bacteria | 129798 |
| 94 | Ga0105239_10000447 | 3300010375 | Bacteria | 60232 |
| 95 | Ga0105239_10004132 | 3300010375 | Bacteria | 17427 |
| 96 | Ga0105239_10008771 | 3300010375 | Bacteria | 11445 |
| 97 | Ga0105239_10010414 | 3300010375 | Bacteria | 10403 |
| 98 | Ga0105239_10065597 | 3300010375 | Bacteria | 3987 |
| 99 | Ga0105239_10090909 | 3300010375 | Bacteria | 3368 |
| 100 | Ga0105246_10053908 | 3300011119 | Bacteria | 2769 |
| 101 | Ga0157373_10000115 | 3300013100 | Bacteria | 63326 |
| 102 | Ga0157373_10000521 | 3300013100 | Bacteria | 30194 |
| 103 | Ga0157373_10004093 | 3300013100 | Bacteria | 10985 |
| 104 | Ga0157373_10040273 | 3300013100 | Bacteria | 3344 |
| 105 | Ga0157373_10146167 | 3300013100 | Bacteria | 1663 |
| 106 | Ga0157373_10330197 | 3300013100 | Bacteria | 1086 |
| 107 | Ga0157371_10000041 | 3300013102 | Bacteria | 203957 |
| 108 | Ga0157371_10001176 | 3300013102 | Bacteria | 28083 |
| 109 | Ga0157371_10002327 | 3300013102 | Bacteria | 18239 |
| 110 | Ga0157371_10004214 | 3300013102 | Bacteria | 12657 |
| 111 | Ga0157371_10017985 | 3300013102 | Bacteria | 5237 |
| 112 | Ga0157371_10028294 | 3300013102 | Bacteria | 4060 |
| 113 | Ga0157371_10036703 | 3300013102 | Bacteria | 3509 |
| 114 | Ga0157371_10114853 | 3300013102 | Bacteria | 1912 |
| 115 | Ga0157371_10161184 | 3300013102 | Bacteria | 1602 |
| 116 | Ga0157370_10003392 | 3300013104 | Bacteria | 18728 |
| 117 | Ga0157370_10007957 | 3300013104 | Bacteria | 11483 |
| 118 | Ga0157370_10023860 | 3300013104 | Bacteria | 6066 |
| 119 | Ga0157370_10036615 | 3300013104 | Bacteria | 4760 |
| 120 | Ga0157370_10055920 | 3300013104 | Bacteria | 3757 |
| 121 | Ga0157370_10078097 | 3300013104 | Bacteria | 3117 |
| 122 | Ga0157369_10000016 | 3300013105 | Bacteria | 257827 |
| 123 | Ga0157369_10005273 | 3300013105 | Bacteria | 15070 |
| 124 | Ga0157369_10046298 | 3300013105 | Bacteria | 4727 |
| 125 | Ga0157369_10063780 | 3300013105 | Bacteria | 3969 |
| 126 | Ga0157369_10142118 | 3300013105 | Bacteria | 2539 |
| 127 | Ga0157369_10510538 | 3300013105 | Bacteria | 1243 |
| 128 | Ga0157374_10001922 | 3300013296 | Bacteria | 17417 |
| 129 | Ga0157374_10003676 | 3300013296 | Bacteria | 12891 |
| 130 | Ga0157378_10035588 | 3300013297 | Bacteria | 4405 |
| 131 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 132 | Ga0163162_10000165 | 3300013306 | Bacteria | 60772 |
| 133 | Ga0163162_10002294 | 3300013306 | Bacteria | 17960 |
| 134 | Ga0163162_10008472 | 3300013306 | Bacteria | 10032 |
| 135 | Ga0157372_10000026 | 3300013307 | Bacteria | 195407 |
| 136 | Ga0157372_10001115 | 3300013307 | Bacteria | 29190 |
| 137 | Ga0157372_10001320 | 3300013307 | Bacteria | 26848 |
| 138 | Ga0157372_10002074 | 3300013307 | Bacteria | 21765 |
| 139 | Ga0157372_10014112 | 3300013307 | Bacteria | 8533 |
| 140 | Ga0157372_10016992 | 3300013307 | Bacteria | 7811 |
| 141 | Ga0157372_10407244 | 3300013307 | Bacteria | 1585 |
| 142 | Ga0157372_10413222 | 3300013307 | Bacteria | 1572 |
| 143 | Ga0157375_10371105 | 3300013308 | Bacteria | 1597 |
| 144 | Ga0182008_10000014 | 3300014497 | Bacteria | 263844 |
| 145 | Ga0182008_10001372 | 3300014497 | Bacteria | 16489 |
| 146 | Ga0182008_10002752 | 3300014497 | Bacteria | 10905 |
| 147 | Ga0182008_10004470 | 3300014497 | Bacteria | 8174 |
| 148 | Ga0182008_10004660 | 3300014497 | Bacteria | 7974 |
| 149 | Ga0157377_10004017 | 3300014745 | Bacteria | 6709 |
| 150 | Ga0182006_1000801 | 3300015261 | Bacteria | 21143 |
| 151 | Ga0182006_1001602 | 3300015261 | Bacteria | 13393 |
| 152 | Ga0182006_1001859 | 3300015261 | Bacteria | 12106 |
| 153 | Ga0182006_1035527 | 3300015261 | Bacteria | 1986 |
| 154 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 155 | Ga0182007_10002401 | 3300015262 | Bacteria | 9354 |
| 156 | Ga0182007_10005319 | 3300015262 | Bacteria | 5672 |
| 157 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 158 | Ga0163161_10000347 | 3300017792 | Bacteria | 39178 |
| 159 | Ga0163161_10000845 | 3300017792 | Bacteria | 23886 |
| 160 | Ga0163161_10005117 | 3300017792 | Bacteria | 9125 |
| 161 | Ga0163161_10005674 | 3300017792 | Bacteria | 8651 |
| 162 | Ga0163161_10032425 | 3300017792 | Bacteria | 3730 |
| 163 | Ga0163161_10136555 | 3300017792 | Bacteria | 1854 |
| 164 | Ga0163161_10326644 | 3300017792 | Bacteria | 1214 |
| 165 | Ga0207427_100131 | 3300025231 | Bacteria | 93947 |
| 166 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 167 | Ga0209437_100135 | 3300025233 | Bacteria | 176455 |
| 168 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 169 | Ga0209026_1000478 | 3300025250 | Bacteria | 30162 |
| 170 | Ga0209026_1001313 | 3300025250 | Bacteria | 11198 |
| 171 | Ga0209026_1002843 | 3300025250 | Bacteria | 6117 |
| 172 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 173 | Ga0209129_1015212 | 3300025258 | Bacteria | 1596 |
| 174 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 175 | Ga0209233_1005713 | 3300025261 | Bacteria | 4100 |
| 176 | Ga0209233_1015807 | 3300025261 | Bacteria | 2092 |
| 177 | Ga0209455_1007233 | 3300025272 | Bacteria | 3161 |
| 178 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 179 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 180 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 181 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 182 | Ga0209051_1060446 | 3300025303 | Bacteria | 1196 |
| 183 | Ga0207655_1029330 | 3300025728 | Bacteria | 2577 |
| 184 | Ga0207647_10000044 | 3300025904 | Bacteria | 90491 |
| 185 | Ga0207647_10000431 | 3300025904 | Bacteria | 34359 |
| 186 | Ga0207647_10043356 | 3300025904 | Bacteria | 2816 |
| 187 | Ga0207645_10000558 | 3300025907 | Bacteria | 30976 |
| 188 | Ga0207705_10000142 | 3300025909 | Bacteria | 76788 |
| 189 | Ga0207705_10018485 | 3300025909 | Bacteria | 4984 |
| 190 | Ga0207654_10003270 | 3300025911 | Bacteria | 8192 |
| 191 | Ga0207654_10232381 | 3300025911 | Bacteria | 1229 |
| 192 | Ga0207695_10000179 | 3300025913 | Bacteria | 185564 |
| 193 | Ga0207695_10038900 | 3300025913 | Bacteria | 5115 |
| 194 | Ga0207695_10199164 | 3300025913 | Bacteria | 1918 |
| 195 | Ga0207695_10599176 | 3300025913 | Bacteria | 983 |
| 196 | Ga0207671_10000651 | 3300025914 | Bacteria | 45376 |
| 197 | Ga0207671_10002678 | 3300025914 | Bacteria | 18677 |
| 198 | Ga0207671_10003211 | 3300025914 | Bacteria | 16463 |
| 199 | Ga0207671_10014510 | 3300025914 | Bacteria | 6222 |
| 200 | Ga0207671_10028752 | 3300025914 | Bacteria | 4153 |
| 201 | Ga0207671_10038905 | 3300025914 | Bacteria | 3524 |
| 202 | Ga0207671_10048646 | 3300025914 | Bacteria | 3138 |
| 203 | Ga0207660_10025385 | 3300025917 | Bacteria | 4021 |
| 204 | Ga0207657_10059179 | 3300025919 | Bacteria | 3294 |
| 205 | Ga0207657_10247306 | 3300025919 | Bacteria | 1422 |
| 206 | Ga0207652_10010229 | 3300025921 | Bacteria | 7549 |
| 207 | Ga0207652_10046158 | 3300025921 | Unclassified | 3716 |
| 208 | Ga0207694_10201970 | 3300025924 | Bacteria | 1617 |
| 209 | Ga0207694_10283504 | 3300025924 | Bacteria | 1361 |
| 210 | Ga0207690_10004483 | 3300025932 | Bacteria | 8245 |
| 211 | Ga0207690_10015256 | 3300025932 | Bacteria | 4652 |
| 212 | Ga0207690_10166439 | 3300025932 | Bacteria | 1648 |
| 213 | Ga0207706_10000173 | 3300025933 | Bacteria | 71958 |
| 214 | Ga0207686_10015420 | 3300025934 | Bacteria | 4272 |
| 215 | Ga0207709_10000007 | 3300025935 | Bacteria | 752025 |
| 216 | Ga0207670_10198532 | 3300025936 | Bacteria | 1523 |
| 217 | Ga0207669_10057573 | 3300025937 | Bacteria | 2367 |
| 218 | Ga0207704_10001338 | 3300025938 | Bacteria | 10993 |
| 219 | Ga0207667_10000049 | 3300025949 | Bacteria | 235027 |
| 220 | Ga0207667_10013565 | 3300025949 | Bacteria | 9315 |
| 221 | Ga0207667_10020070 | 3300025949 | Bacteria | 7441 |
| 222 | Ga0207667_10035329 | 3300025949 | Bacteria | 5362 |
| 223 | Ga0207667_10093959 | 3300025949 | Bacteria | 3097 |
| 224 | Ga0207667_10316112 | 3300025949 | Bacteria | 1595 |
| 225 | Ga0207651_10053344 | 3300025960 | Bacteria | 2763 |
| 226 | Ga0207677_10004495 | 3300026023 | Bacteria | 7499 |
| 227 | Ga0207703_10246945 | 3300026035 | Bacteria | 1607 |
| 228 | Ga0207639_10004556 | 3300026041 | Bacteria | 9333 |
| 229 | Ga0207639_10388996 | 3300026041 | Bacteria | 1254 |
| 230 | Ga0207678_10088566 | 3300026067 | Bacteria | 2645 |
| 231 | Ga0207702_10001296 | 3300026078 | Bacteria | 25030 |
| 232 | Ga0207702_10042414 | 3300026078 | Bacteria | 3816 |
| 233 | Ga0207702_10050460 | 3300026078 | Bacteria | 3513 |
| 234 | Ga0207702_10071103 | 3300026078 | Bacteria | 2995 |
| 235 | Ga0207702_10135558 | 3300026078 | Unclassified | 2221 |
| 236 | Ga0207702_10173842 | 3300026078 | Bacteria | 1978 |
| 237 | Ga0207648_10002973 | 3300026089 | Bacteria | 17907 |
| 238 | Ga0207674_10266410 | 3300026116 | Bacteria | 1661 |
| 239 | Ga0207683_10009309 | 3300026121 | Bacteria | 8369 |
| 240 | Ga0207698_10221455 | 3300026142 | Bacteria | 1710 |
| 241 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 242 | Ga0265337_1043919 | 3300028556 | Bacteria | 1276 |
| 243 | Ga0265323_10000396 | 3300028653 | Bacteria | 25100 |
| 244 | Ga0307517_10000640 | 3300028786 | Bacteria | 59989 |
| 245 | Ga0307515_10003374 | 3300028794 | Bacteria | 33668 |
| 246 | Ga0265338_10000989 | 3300028800 | Bacteria | 47912 |
| 247 | Ga0265338_10013462 | 3300028800 | Bacteria | 9235 |
| 248 | Ga0316183_1052705 | 3300030742 | Bacteria | 4356 |
| 249 | Ga0316181_1256224 | 3300030744 | Bacteria | 4456 |
| 250 | Ga0316182_1348770 | 3300030745 | Bacteria | 2908 |
| 251 | Ga0265327_10006259 | 3300031251 | Bacteria | 9586 |
| 252 | Ga0265327_10126597 | 3300031251 | Bacteria | 1205 |
| 253 | Ga0265316_10000307 | 3300031344 | Bacteria | 54686 |
| 254 | Ga0265316_10013610 | 3300031344 | Bacteria | 7218 |
| 255 | Ga0307408_100000714 | 3300031548 | Bacteria | 26984 |
| 256 | Ga0307408_100003290 | 3300031548 | Bacteria | 11117 |
| 257 | Ga0307408_100003441 | 3300031548 | Bacteria | 10830 |
| 258 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 259 | Ga0307405_10231579 | 3300031731 | Bacteria | 1362 |
| 260 | Ga0307407_10000075 | 3300031903 | Bacteria | 35183 |
| 261 | Ga0307412_10000068 | 3300031911 | Bacteria | 113739 |
| 262 | Ga0307412_10006713 | 3300031911 | Bacteria | 6523 |
| 263 | Ga0307412_10028366 | 3300031911 | Bacteria | 3501 |
| 264 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 265 | Ga0307414_10001617 | 3300032004 | Bacteria | 11716 |
| 266 | Ga0307414_10002566 | 3300032004 | Bacteria | 9554 |
| 267 | Ga0307414_10014391 | 3300032004 | Bacteria | 4742 |
| 268 | Ga0307414_10036948 | 3300032004 | Bacteria | 3266 |
| 269 | Ga0307414_10084936 | 3300032004 | Bacteria | 2330 |
| 270 | Ga0307414_10090024 | 3300032004 | Bacteria | 2276 |
| 271 | Ga0307411_10024593 | 3300032005 | Bacteria | 3593 |
| 272 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 273 | Ga0307510_10008975 | 3300033180 | Bacteria | 11903 |
| 274 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 275 | Ga0395899_0000055 | 3300037312 | Bacteria | 220579 |
| 276 | Ga0395899_0000303 | 3300037312 | Bacteria | 63241 |
| 277 | Ga0395899_0001931 | 3300037312 | Bacteria | 17070 |
| 278 | Ga0395899_0112284 | 3300037312 | Bacteria | 1958 |
| 279 | Ga0395900_0000173 | 3300037418 | Bacteria | 103767 |
| 280 | Ga0395900_0001236 | 3300037418 | Bacteria | 31409 |
| 281 | Ga0395900_0040803 | 3300037418 | Bacteria | 4784 |
| 282 | Ga0395900_0524250 | 3300037418 | Unclassified | 1132 |
| 283 | Ga0395900_0528442 | 3300037418 | Bacteria | 1127 |
| 284 | Ga0395898_0020480 | 3300037466 | Bacteria | 6717 |
| 285 | Ga0395898_0025595 | 3300037466 | Bacteria | 5944 |
| 286 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 287 | Ga0395905_0000049 | 3300037471 | Bacteria | 230719 |
| 288 | Ga0395905_0000641 | 3300037471 | Bacteria | 46724 |
| 289 | Ga0395905_0000779 | 3300037471 | Bacteria | 41889 |
| 290 | Ga0395901_0000294 | 3300038443 | Bacteria | 61869 |
| 291 | Ga0395901_0002154 | 3300038443 | Bacteria | 20114 |
| 292 | Ga0395901_0032891 | 3300038443 | Bacteria | 5350 |
| 293 | Ga0395901_0247485 | 3300038443 | Bacteria | 1858 |
| 294 | Ga0436361_0154863 | 3300039447 | Bacteria | 1807 |
| 295 | Ga0451795_0195139 | 3300041456 | Bacteria | 1399 |
| 296 | Ga0451795_1274708 | 3300041456 | Bacteria | 2078 |
| 297 | Ga0451577_0002121 | 3300042876 | Bacteria | 24379 |
| 298 | Ga0466961_0065374 | 3300044693 | Bacteria | 2311 |
| 299 | Ga0453684_0002170 | 3300044712 | Bacteria | 49036 |
| 300 | Ga0453684_0009912 | 3300044712 | Bacteria | 16444 |
| 301 | Ga0453684_0036648 | 3300044712 | Bacteria | 6754 |
| 302 | Ga0453684_0527489 | 3300044712 | Unclassified | 1304 |
| 303 | Ga0466959_0023961 | 3300045049 | Bacteria | 4519 |
| 304 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 305 | Ga0495627_019553 | 3300046453 | Bacteria | 2269 |
| 306 | Ga0495627_054238 | 3300046453 | Bacteria | 1199 |
| 307 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 308 | Ga0495585_0000476 | 3300046492 | Bacteria | 38316 |
| 309 | Ga0495606_0000654 | 3300046507 | Bacteria | 54570 |
| 310 | Ga0495606_0007518 | 3300046507 | Bacteria | 9722 |
| 311 | Ga0495606_0011077 | 3300046507 | Bacteria | 7393 |
| 312 | Ga0495610_0000099 | 3300046512 | Bacteria | 101553 |
| 313 | Ga0495610_0002884 | 3300046512 | Bacteria | 13921 |
| 314 | Ga0495610_0014026 | 3300046512 | Bacteria | 4732 |
| 315 | Ga0495616_0002030 | 3300046513 | Bacteria | 13617 |
| 316 | Ga0495631_0006507 | 3300046518 | Bacteria | 6028 |
| 317 | Ga0495631_0066973 | 3300046518 | Bacteria | 1554 |
| 318 | Ga0495637_0047636 | 3300046520 | Bacteria | 1808 |
| 319 | Ga0495637_0077427 | 3300046520 | Bacteria | 1331 |
| 320 | Ga0495644_0009710 | 3300046523 | Bacteria | 3704 |
| 321 | Ga0495648_0017947 | 3300046524 | Bacteria | 5034 |
| 322 | Ga0495652_0145161 | 3300046529 | Bacteria | 1861 |
| 323 | Ga0495652_0281961 | 3300046529 | Bacteria | 1216 |
| 324 | Ga0495654_0055466 | 3300046530 | Bacteria | 1918 |
| 325 | Ga0495609_0024707 | 3300046538 | Bacteria | 2755 |
| 326 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 327 | Ga0495633_0001658 | 3300046558 | Bacteria | 16787 |
| 328 | Ga0495633_0034976 | 3300046558 | Bacteria | 2414 |
| 329 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 330 | Ga0495625_0000308 | 3300046660 | Bacteria | 74661 |
| 331 | Ga0495625_0001492 | 3300046660 | Bacteria | 28147 |
| 332 | Ga0495625_0008279 | 3300046660 | Bacteria | 8886 |
| 333 | Ga0495625_0015637 | 3300046660 | Bacteria | 6001 |
| 334 | Ga0495625_0076797 | 3300046660 | Bacteria | 2335 |
| 335 | Ga0495661_0005393 | 3300046665 | Bacteria | 9090 |
| 336 | Ga0495671_0024038 | 3300046692 | Bacteria | 3179 |
| 337 | Ga0495649_0000105 | 3300046694 | Bacteria | 74750 |
| 338 | Ga0495649_0022176 | 3300046694 | Bacteria | 3553 |
| 339 | Ga0495660_0039154 | 3300046810 | Bacteria | 2633 |
| 340 | Ga0495687_003058 | 3300047443 | Bacteria | 12553 |
| 341 | Ga0495687_011296 | 3300047443 | Bacteria | 4814 |
| 342 | Ga0495687_049620 | 3300047443 | Bacteria | 1793 |
| 343 | Ga0495681_0055156 | 3300047470 | Bacteria | 1854 |
| 344 | Ga0495686_0000419 | 3300047472 | Bacteria | 66923 |
| 345 | Ga0495686_0002676 | 3300047472 | Bacteria | 16402 |
| 346 | Ga0495686_0026750 | 3300047472 | Bacteria | 3774 |
| 347 | Ga0495686_0036952 | 3300047472 | Bacteria | 3132 |
| 348 | Ga0495686_0106248 | 3300047472 | Bacteria | 1688 |
| 349 | Ga0496116_0002245 | 3300048919 | Bacteria | 20539 |
| 350 | Ga0496117_0002421 | 3300048920 | Bacteria | 23637 |
| 351 | Ga0496122_0047693 | 3300048925 | Bacteria | 3305 |
| 352 | Ga0495678_026901 | 3300049459 | Bacteria | 2447 |
| 353 | Ga0501033_0171166 | 3300049570 | Bacteria | 1560 |
| 354 | Ga0501223_001257 | 3300049663 | Bacteria | 5923 |
| 355 | nmdc:mga0k408_1577_c1 | 3300050493 | Bacteria | 12314 |
| 356 | nmdc:mga0k408_349_c1 | 3300050493 | Bacteria | 23383 |
| 357 | Ga0500635_0000648 | 3300053080 | Bacteria | 8892 |
| 358 | Ga0500651_0000210 | 3300053093 | Bacteria | 36797 |
| 359 | Ga0500608_031302 | 3300053122 | Bacteria | 2524 |
| 360 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 361 | Ga0500618_009939 | 3300053125 | Bacteria | 2575 |
| 362 | Ga0500568_0039821 | 3300053139 | Bacteria | 1895 |
| 363 | Ga0500622_0000654 | 3300053156 | Bacteria | 30848 |
| 364 | Ga0500624_000465 | 3300053157 | Bacteria | 12081 |
| 365 | 2522550968 | 2522125168 | Bacteria | 7376607 |
| 366 | 2586208107 | 2585427687 | Bacteria | 5544917 |
| 367 | 2599479419 | 2599185184 | Bacteria | 6430550 |
| 368 | 2722730509 | 2721755487 | Bacteria | 6357185 |
| 369 | 2738756852 | 2738541283 | Bacteria | 7222293 |
| 370 | 2738760096 | 2738541284 | Bacteria | 5199923 |
| 371 | 2738856555 | 2738541302 | Bacteria | 5944758 |
| 372 | 2739304973 | 2738543023 | Bacteria | 6767879 |
| 373 | 2739588102 | 2739367651 | Bacteria | 6359826 |
| 374 | 2739616199 | 2739367656 | Bacteria | 5152243 |
| 375 | 2739646858 | 2739367663 | Bacteria | 5040914 |
| 376 | 2776612075 | 2775506987 | Bacteria | 5373360 |
| 377 | 2819545996 | 2818991437 | Bacteria | 5805520 |
| 378 | 2842724102 | 2842722452 | Bacteria | 6263924 |
| 379 | 2842908358 | 2842903701 | Bacteria | 6986368 |
| 380 | 2842912168 | 2842909656 | Bacteria | 6185908 |
| 381 | 2849282418 | 2849281842 | Bacteria | 6065644 |
| 382 | 2852625806 | 2852623160 | Bacteria | 4376875 |
| 383 | 2852631743 | 2852627209 | Bacteria | 5896285 |
| 384 | 2857631298 | 2857627736 | Bacteria | 5625397 |
| 385 | 2884935668 | 2884933994 | Bacteria | 4535041 |
| 386 | 2890738205 | 2890737413 | Bacteria | 4269751 |
| 387 | 2896321064 | 2896317667 | Bacteria | 4606601 |
| 388 | 2896346336 | 2896344016 | Bacteria | 3811746 |
| 389 | 2898713948 | 2898713307 | Bacteria | 4110805 |
| 390 | 2902052373 | 2902048731 | Bacteria | 4976191 |
| 391 | 2904446258 | 2904445276 | Bacteria | 5310396 |
| 392 | 2904785499 | 2904780799 | Bacteria | 5840761 |
| 393 | 2919182046 | 2919177583 | Bacteria | 5641607 |
| 394 | 2919191411 | 2919186247 | Bacteria | 6244071 |
| 395 | 2919437982 | 2919437846 | Bacteria | 6199444 |
| 396 | 2928082275 | 2928078545 | Bacteria | 6534839 |
| 397 | 2928149148 | 2928147474 | Bacteria | 6512076 |
| 398 | 2932084990 | 2932082852 | Bacteria | 6563563 |
| 399 | 2939669670 | 2939664404 | Bacteria | 6364494 |
| 400 | 2945999081 | 2945997725 | Bacteria | 6404843 |
| 401 | 2954021533 | 2954016120 | Bacteria | 6446024 |
| 402 | 2977235800 | 2977232053 | Bacteria | 5485925 |
| 403 | 3003234760 | 3003233435 | Bacteria | 4458031 |
| 404 | 8055589999 | 8055588893 | Bacteria | 3619545 |
| 405 | Ga0105240_10286453 | |||
| 406 | SwRhRL2b_contig_3789038 | |||
| 407 | JGI24736J21556_1002488 | |||
| 408 | JGI24740J21852_10011173 | |||
| 409 | JGI24739J22299_10001227 | |||
| 410 | JGI24739J22299_10002824 | |||
| 411 | JGI24737J22298_10002567 | |||
| 412 | JGI24737J22298_10008757 | |||
| 413 | JGI24735J21928_10000003 | |||
| 414 | JGI25162J39368_1000039 | |||
| 415 | JGI25162J39368_1002622 | |||
| 416 | JGI25164J39214_1001675 | |||
| 417 | JGI25152J39213_1000047 | |||
| 418 | JGI25150J39212_1000001 | |||
| 419 | JGI25151J46595_10000001 | |||
| 420 | JGI25165J46597_1001826 | |||
| 421 | JGI25153J46596_10000001 | |||
| 422 | rootH2_10000336 | |||
| 423 | rootH2_10123056 | |||
| 424 | rootL2_10102219 | |||
| 425 | rootL2_10163997 | |||
| 426 | rootH1_10008659 | |||
| 427 | rootH1_10034267 | |||
| 428 | rootH1_10174601 | |||
| 429 | Ga0055536_1000004 | |||
| 430 | Ga0055530_10003996 | |||
| 431 | Ga0065165_1000715 | |||
| 432 | Ga0065714_10002286 | |||
| 433 | Ga0065714_10003259 | |||
| 434 | Ga0065714_10006425 | |||
| 435 | Ga0065714_10074519 | |||
| 436 | Ga0065704_10000436 | |||
| 437 | Ga0070658_10000099 | |||
| 438 | Ga0070658_10058876 | |||
| 439 | Ga0070658_10144543 | |||
| 440 | Ga0070680_100033575 | |||
| 441 | Ga0068868_100001905 | |||
| 442 | Ga0070660_100014336 | |||
| 443 | Ga0070671_100009005 | |||
| 444 | Ga0070673_100014409 | |||
| 445 | Ga0070688_100047203 | |||
| 446 | Ga0070659_100001401 | |||
| 447 | Ga0070659_100172916 | |||
| 448 | Ga0070713_100250864 | |||
| 449 | Ga0070663_100054821 | |||
| 450 | Ga0070678_100003083 | |||
| 451 | Ga0070662_100000013 | |||
| 452 | Ga0070681_10002372 | |||
| 453 | Ga0068867_100001318 | |||
| 454 | Ga0070685_10004706 | |||
| 455 | Ga0070679_100039718 | |||
| 456 | Ga0068853_100014320 | |||
| 457 | Ga0068853_100039664 | |||
| 458 | Ga0068853_100041738 | |||
| 459 | Ga0070665_100000010 | |||
| 460 | Ga0068855_100000014 | |||
| 461 | Ga0068855_100000127 | |||
| 462 | Ga0068855_100034029 | |||
| 463 | Ga0068856_100001917 | |||
| 464 | Ga0068856_100010745 | |||
| 465 | Ga0068856_100030071 | |||
| 466 | Ga0068856_100054659 | |||
| 467 | Ga0068856_100100186 | |||
| 468 | Ga0068852_100042998 | |||
| 469 | Ga0068866_10052692 | |||
| 470 | Ga0068858_100276586 | |||
| 471 | Ga0075366_10000284 | |||
| 472 | Ga0075366_10026110 | |||
| 473 | Ga0075366_10150505 | |||
| 474 | Ga0097621_100007297 | |||
| 475 | Ga0068871_100000477 | |||
| 476 | Ga0068865_100000079 | |||
| 477 | Ga0105244_10032583 | |||
| 478 | Ga0105240_10000128 | |||
| 479 | Ga0105240_10007930 | |||
| 480 | Ga0105240_10081602 | |||
| 481 | Ga0105240_10082772 | |||
| 482 | Ga0105243_10000036 | |||
| 483 | Ga0105241_10005949 | |||
| 484 | Ga0105241_10007148 | |||
| 485 | Ga0105241_10014382 | |||
| 486 | Ga0105241_10083858 | |||
| 487 | Ga0105241_10360869 | |||
| 488 | Ga0105242_10015090 | |||
| 489 | Ga0105237_10001875 | |||
| 490 | Ga0105237_10003686 | |||
| 491 | Ga0105237_10003998 | |||
| 492 | Ga0105237_10027871 | |||
| 493 | Ga0105237_10079767 | |||
| 494 | Ga0105238_10001237 | |||
| 495 | Ga0105238_10239122 | |||
| 496 | Ga0105239_10000011 | |||
| 497 | Ga0105239_10000086 | |||
| 498 | Ga0105239_10000447 | |||
| 499 | Ga0105239_10004132 | |||
| 500 | Ga0105239_10008771 | |||
| 501 | Ga0105239_10010414 | |||
| 502 | Ga0105239_10065597 | |||
| 503 | Ga0105239_10090909 | |||
| 504 | Ga0105246_10053908 | |||
| 505 | Ga0157373_10000115 | |||
| 506 | Ga0157373_10000521 | |||
| 507 | Ga0157373_10004093 | |||
| 508 | Ga0157373_10040273 | |||
| 509 | Ga0157373_10146167 | |||
| 510 | Ga0157373_10330197 | |||
| 511 | Ga0157371_10000041 | |||
| 512 | Ga0157371_10001176 | |||
| 513 | Ga0157371_10002327 | |||
| 514 | Ga0157371_10004214 | |||
| 515 | Ga0157371_10017985 | |||
| 516 | Ga0157371_10028294 | |||
| 517 | Ga0157371_10036703 | |||
| 518 | Ga0157371_10114853 | |||
| 519 | Ga0157371_10161184 | |||
| 520 | Ga0157370_10003392 | |||
| 521 | Ga0157370_10007957 | |||
| 522 | Ga0157370_10023860 | |||
| 523 | Ga0157370_10036615 | |||
| 524 | Ga0157370_10055920 | |||
| 525 | Ga0157370_10078097 | |||
| 526 | Ga0157369_10000016 | |||
| 527 | Ga0157369_10005273 | |||
| 528 | Ga0157369_10046298 | |||
| 529 | Ga0157369_10063780 | |||
| 530 | Ga0157369_10142118 | |||
| 531 | Ga0157369_10510538 | |||
| 532 | Ga0157374_10001922 | |||
| 533 | Ga0157374_10003676 | |||
| 534 | Ga0157378_10035588 | |||
| 535 | Ga0163162_10000005 | |||
| 536 | Ga0163162_10000165 | |||
| 537 | Ga0163162_10002294 | |||
| 538 | Ga0163162_10008472 | |||
| 539 | Ga0157372_10000026 | |||
| 540 | Ga0157372_10001115 | |||
| 541 | Ga0157372_10001320 | |||
| 542 | Ga0157372_10002074 | |||
| 543 | Ga0157372_10014112 | |||
| 544 | Ga0157372_10016992 | |||
| 545 | Ga0157372_10407244 | |||
| 546 | Ga0157372_10413222 | |||
| 547 | Ga0157375_10371105 | |||
| 548 | Ga0182008_10000014 | |||
| 549 | Ga0182008_10001372 | |||
| 550 | Ga0182008_10002752 | |||
| 551 | Ga0182008_10004470 | |||
| 552 | Ga0182008_10004660 | |||
| 553 | Ga0157377_10004017 | |||
| 554 | Ga0182006_1000801 | |||
| 555 | Ga0182006_1001602 | |||
| 556 | Ga0182006_1001859 | |||
| 557 | Ga0182006_1035527 | |||
| 558 | Ga0182007_10000002 | |||
| 559 | Ga0182007_10002401 | |||
| 560 | Ga0182007_10005319 | |||
| 561 | Ga0183373_1004 | |||
| 562 | Ga0163161_10000347 | |||
| 563 | Ga0163161_10000845 | |||
| 564 | Ga0163161_10005117 | |||
| 565 | Ga0163161_10005674 | |||
| 566 | Ga0163161_10032425 | |||
| 567 | Ga0163161_10136555 | |||
| 568 | Ga0163161_10326644 | |||
| 569 | Ga0207427_100131 | |||
| 570 | Ga0209437_100048 | |||
| 571 | Ga0209437_100135 | |||
| 572 | Ga0207425_1000002 | |||
| 573 | Ga0209026_1000478 | |||
| 574 | Ga0209026_1001313 | |||
| 575 | Ga0209026_1002843 | |||
| 576 | Ga0209129_1000002 | |||
| 577 | Ga0209129_1015212 | |||
| 578 | Ga0209233_1000029 | |||
| 579 | Ga0209233_1005713 | |||
| 580 | Ga0209233_1015807 | |||
| 581 | Ga0209455_1007233 | |||
| 582 | Ga0209676_1000009 | |||
| 583 | Ga0209025_1000004 | |||
| 584 | Ga0209758_1000006 | |||
| 585 | Ga0209050_1000048 | |||
| 586 | Ga0209051_1060446 | |||
| 587 | Ga0207655_1029330 | |||
| 588 | Ga0207647_10000044 | |||
| 589 | Ga0207647_10000431 | |||
| 590 | Ga0207647_10043356 | |||
| 591 | Ga0207645_10000558 | |||
| 592 | Ga0207705_10000142 | |||
| 593 | Ga0207705_10018485 | |||
| 594 | Ga0207654_10003270 | |||
| 595 | Ga0207654_10232381 | |||
| 596 | Ga0207695_10000179 | |||
| 597 | Ga0207695_10038900 | |||
| 598 | Ga0207695_10199164 | |||
| 599 | Ga0207695_10599176 | |||
| 600 | Ga0207671_10000651 | |||
| 601 | Ga0207671_10002678 | |||
| 602 | Ga0207671_10003211 | |||
| 603 | Ga0207671_10014510 | |||
| 604 | Ga0207671_10028752 | |||
| 605 | Ga0207671_10038905 | |||
| 606 | Ga0207671_10048646 | |||
| 607 | Ga0207660_10025385 | |||
| 608 | Ga0207657_10059179 | |||
| 609 | Ga0207657_10247306 | |||
| 610 | Ga0207652_10010229 | |||
| 611 | Ga0207652_10046158 | |||
| 612 | Ga0207694_10201970 | |||
| 613 | Ga0207694_10283504 | |||
| 614 | Ga0207690_10004483 | |||
| 615 | Ga0207690_10015256 | |||
| 616 | Ga0207690_10166439 | |||
| 617 | Ga0207706_10000173 | |||
| 618 | Ga0207686_10015420 | |||
| 619 | Ga0207709_10000007 | |||
| 620 | Ga0207670_10198532 | |||
| 621 | Ga0207669_10057573 | |||
| 622 | Ga0207704_10001338 | |||
| 623 | Ga0207667_10000049 | |||
| 624 | Ga0207667_10013565 | |||
| 625 | Ga0207667_10020070 | |||
| 626 | Ga0207667_10035329 | |||
| 627 | Ga0207667_10093959 | |||
| 628 | Ga0207667_10316112 | |||
| 629 | Ga0207651_10053344 | |||
| 630 | Ga0207677_10004495 | |||
| 631 | Ga0207703_10246945 | |||
| 632 | Ga0207639_10004556 | |||
| 633 | Ga0207639_10388996 | |||
| 634 | Ga0207678_10088566 | |||
| 635 | Ga0207702_10001296 | |||
| 636 | Ga0207702_10042414 | |||
| 637 | Ga0207702_10050460 | |||
| 638 | Ga0207702_10071103 | |||
| 639 | Ga0207702_10135558 | |||
| 640 | Ga0207702_10173842 | |||
| 641 | Ga0207648_10002973 | |||
| 642 | Ga0207674_10266410 | |||
| 643 | Ga0207683_10009309 | |||
| 644 | Ga0207698_10221455 | |||
| 645 | Ga0268266_10000032 | |||
| 646 | Ga0265337_1043919 | |||
| 647 | Ga0265323_10000396 | |||
| 648 | Ga0307517_10000640 | |||
| 649 | Ga0307515_10003374 | |||
| 650 | Ga0265338_10000989 | |||
| 651 | Ga0265338_10013462 | |||
| 652 | Ga0316183_1052705 | |||
| 653 | Ga0316181_1256224 | |||
| 654 | Ga0316182_1348770 | |||
| 655 | Ga0265327_10006259 | |||
| 656 | Ga0265327_10126597 | |||
| 657 | Ga0265316_10000307 | |||
| 658 | Ga0265316_10013610 | |||
| 659 | Ga0307408_100000714 | |||
| 660 | Ga0307408_100003290 | |||
| 661 | Ga0307408_100003441 | |||
| 662 | Ga0307405_10000006 | |||
| 663 | Ga0307405_10231579 | |||
| 664 | Ga0307407_10000075 | |||
| 665 | Ga0307412_10000068 | |||
| 666 | Ga0307412_10006713 | |||
| 667 | Ga0307412_10028366 | |||
| 668 | Ga0307416_100000002 | |||
| 669 | Ga0307414_10001617 | |||
| 670 | Ga0307414_10002566 | |||
| 671 | Ga0307414_10014391 | |||
| 672 | Ga0307414_10036948 | |||
| 673 | Ga0307414_10084936 | |||
| 674 | Ga0307414_10090024 | |||
| 675 | Ga0307411_10024593 | |||
| 676 | Ga0307507_10000034 | |||
| 677 | Ga0307510_10008975 | |||
| 678 | Ga0395899_0000011 | |||
| 679 | Ga0395899_0000055 | |||
| 680 | Ga0395899_0000303 | |||
| 681 | Ga0395899_0001931 | |||
| 682 | Ga0395899_0112284 | |||
| 683 | Ga0395900_0000173 | |||
| 684 | Ga0395900_0001236 | |||
| 685 | Ga0395900_0040803 | |||
| 686 | Ga0395900_0524250 | |||
| 687 | Ga0395900_0528442 | |||
| 688 | Ga0395898_0020480 | |||
| 689 | Ga0395898_0025595 | |||
| 690 | Ga0395905_0000001 | |||
| 691 | Ga0395905_0000049 | |||
| 692 | Ga0395905_0000641 | |||
| 693 | Ga0395905_0000779 | |||
| 694 | Ga0395901_0000294 | |||
| 695 | Ga0395901_0002154 | |||
| 696 | Ga0395901_0032891 | |||
| 697 | Ga0395901_0247485 | |||
| 698 | Ga0436361_0154863 | |||
| 699 | Ga0451795_0195139 | |||
| 700 | Ga0451795_1274708 | |||
| 701 | Ga0451577_0002121 | |||
| 702 | Ga0466961_0065374 | |||
| 703 | Ga0453684_0002170 | |||
| 704 | Ga0453684_0009912 | |||
| 705 | Ga0453684_0036648 | |||
| 706 | Ga0453684_0527489 | |||
| 707 | Ga0466959_0023961 | |||
| 708 | Ga0451576_0000003 | |||
| 709 | Ga0495627_019553 | |||
| 710 | Ga0495627_054238 | |||
| 711 | Ga0495650_0000023 | |||
| 712 | Ga0495585_0000476 | |||
| 713 | Ga0495606_0000654 | |||
| 714 | Ga0495606_0007518 | |||
| 715 | Ga0495606_0011077 | |||
| 716 | Ga0495610_0000099 | |||
| 717 | Ga0495610_0002884 | |||
| 718 | Ga0495610_0014026 | |||
| 719 | Ga0495616_0002030 | |||
| 720 | Ga0495631_0006507 | |||
| 721 | Ga0495631_0066973 | |||
| 722 | Ga0495637_0047636 | |||
| 723 | Ga0495637_0077427 | |||
| 724 | Ga0495644_0009710 | |||
| 725 | Ga0495648_0017947 | |||
| 726 | Ga0495652_0145161 | |||
| 727 | Ga0495652_0281961 | |||
| 728 | Ga0495654_0055466 | |||
| 729 | Ga0495609_0024707 | |||
| 730 | Ga0495633_0000072 | |||
| 731 | Ga0495633_0001658 | |||
| 732 | Ga0495633_0034976 | |||
| 733 | Ga0495668_0000165 | |||
| 734 | Ga0495625_0000308 | |||
| 735 | Ga0495625_0001492 | |||
| 736 | Ga0495625_0008279 | |||
| 737 | Ga0495625_0015637 | |||
| 738 | Ga0495625_0076797 | |||
| 739 | Ga0495661_0005393 | |||
| 740 | Ga0495671_0024038 | |||
| 741 | Ga0495649_0000105 | |||
| 742 | Ga0495649_0022176 | |||
| 743 | Ga0495660_0039154 | |||
| 744 | Ga0495687_003058 | |||
| 745 | Ga0495687_011296 | |||
| 746 | Ga0495687_049620 | |||
| 747 | Ga0495681_0055156 | |||
| 748 | Ga0495686_0000419 | |||
| 749 | Ga0495686_0002676 | |||
| 750 | Ga0495686_0026750 | |||
| 751 | Ga0495686_0036952 | |||
| 752 | Ga0495686_0106248 | |||
| 753 | Ga0496116_0002245 | |||
| 754 | Ga0496117_0002421 | |||
| 755 | Ga0496122_0047693 | |||
| 756 | Ga0495678_026901 | |||
| 757 | Ga0501033_0171166 | |||
| 758 | Ga0501223_001257 | |||
| 759 | nmdc:mga0k408_1577_c1 | |||
| 760 | nmdc:mga0k408_349_c1 | |||
| 761 | Ga0500635_0000648 | |||
| 762 | Ga0500651_0000210 | |||
| 763 | Ga0500608_031302 | |||
| 764 | Ga0500618_000005 | |||
| 765 | Ga0500618_009939 | |||
| 766 | Ga0500568_0039821 | |||
| 767 | Ga0500622_0000654 | |||
| 768 | Ga0500624_000465 | |||
| 769 | 2522550968 | |||
| 770 | 2586208107 | |||
| 771 | 2599479419 | |||
| 772 | 2722730509 | |||
| 773 | 2738756852 | |||
| 774 | 2738760096 | |||
| 775 | 2738856555 | |||
| 776 | 2739304973 | |||
| 777 | 2739588102 | |||
| 778 | 2739616199 | |||
| 779 | 2739646858 | |||
| 780 | 2776612075 | |||
| 781 | 2819545996 | |||
| 782 | 2842724102 | |||
| 783 | 2842908358 | |||
| 784 | 2842912168 | |||
| 785 | 2849282418 | |||
| 786 | 2852625806 | |||
| 787 | 2852631743 | |||
| 788 | 2857631298 | |||
| 789 | 2884935668 | |||
| 790 | 2890738205 | |||
| 791 | 2896321064 | |||
| 792 | 2896346336 | |||
| 793 | 2898713948 | |||
| 794 | 2902052373 | |||
| 795 | 2904446258 | |||
| 796 | 2904785499 | |||
| 797 | 2919182046 | |||
| 798 | 2919191411 | |||
| 799 | 2919437982 | |||
| 800 | 2928082275 | |||
| 801 | 2928149148 | |||
| 802 | 2932084990 | |||
| 803 | 2939669670 | |||
| 804 | 2945999081 | |||
| 805 | 2954021533 | |||
| 806 | 2977235800 | |||
| 807 | 3003234760 | |||
| 808 | 8055589999 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2igt-assembly1.cif.gz_A | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.9022 | 3 | 290 |
| 2igt-assembly1.cif.gz_B | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.898 | 3 | 290 |
| 2igt-assembly1.cif.gz_C | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.8945 | 3 | 290 |
| 2igt-assembly1.cif.gz_A | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.8816 | 3 | 290 |
| 2igt-assembly1.cif.gz_B | crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens | 0.8775 | 3 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2igtB02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.9013 | 11 | 76 | 2.60.40.1180 |
| 2igtC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.886 | 76 | 290 | 3.40.50.150 |
| 2igtB02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8751 | 11 | 76 | 2.60.40.1180 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8604 | 125 | 193 | 3.40.50.150 |
| af_Q8ILX8_228_372_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8593 | 127 | 177 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0S4M0-F1-model_v4 | Oxidoreductase | 0.9818 | 104 | 293 |
GO:0008168
GO:0032259 |
| AF-A0A4V1SMX7-F1-model_v4 | deleted | 0.9807 | 1 | 166 |
|
| AF-A0A519XIT6-F1-model_v4 | Oxidoreductase | 0.9801 | 1 | 198 |
|
| AF-A0A519XIT6-F1-model_v4 | Oxidoreductase | 0.9752 | 1 | 198 |
|
| AF-A0A4V1SMX7-F1-model_v4 | deleted | 0.9749 | 1 | 166 |
|