F435674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 123 | 403 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10469143|Ga0157376_104691432 |
| Length | 260 |
| Sequence | MPKYLLQVRYTGEGLQGVMRDGGSARRAAAEEVAKQVGGSIESFVFAFGDVDAYVICDFPDNKAAATLAMTGTASATALDQFKSFVAGTKSARGEFTQTQVRTSGKPGKTSSGTFVFSRPGKFIWTYQKPYEQLLQADGDTLYLYDKDLNQVTTRKLGGALGSSPAAILFGSNDLEKNFTLAEAGTHDGLEWLQATPKAKDTTFEQIGIGLKDGVPQAMELKDNFGQTVLLKFTSFQRNPALGAQTFKFEVPKGAEVVNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 7 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 8 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 9 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 10 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 11 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 12 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 13 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 14 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 17 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 18 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 19 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 20 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 21 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 22 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 23 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 24 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 25 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 26 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 30 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 31 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 33 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 34 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 35 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 38 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 107 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 108 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 109 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 110 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 111 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 112 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 113 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 114 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 115 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 116 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 117 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 118 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.74 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.99 |
| Nodule | 0 |
| Rhizoplane | 4.21 |
| Rhizosphere | 92.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000186 | 3300002704 | Bacteria | 26654 |
| 2 | JGI25156J39149_1013802 | 3300002705 | Bacteria | 1696 |
| 3 | JGI25154J39366_1000504 | 3300002738 | Bacteria | 19901 |
| 4 | Ga0065165_1005668 | 3300005262 | Bacteria | 6893 |
| 5 | Ga0105240_10011207 | 3300009093 | Bacteria | 12509 |
| 6 | Ga0105241_10031859 | 3300009174 | Bacteria | 3948 |
| 7 | Ga0157376_10469143 | 3300014969 | Bacteria | 1231 |
| 8 | Ga0209435_100200 | 3300025206 | Bacteria | 17454 |
| 9 | Ga0207425_1000173 | 3300025245 | Bacteria | 52861 |
| 10 | Ga0209759_1000520 | 3300025256 | Bacteria | 41628 |
| 11 | Ga0209025_1005905 | 3300025294 | Bacteria | 9770 |
| 12 | Ga0209758_1000449 | 3300025297 | Bacteria | 68833 |
| 13 | Ga0207654_10015828 | 3300025911 | Bacteria | 3920 |
| 14 | Ga0207695_10061667 | 3300025913 | Bacteria | 3875 |
| 15 | Ga0316182_1439499 | 3300030745 | Bacteria | 859 |
| 16 | Ga0307516_10397074 | 3300031730 | Bacteria | 1039 |
| 17 | Ga0395899_0000378 | 3300037312 | Bacteria | 53364 |
| 18 | Ga0395899_0007222 | 3300037312 | Bacteria | 8598 |
| 19 | Ga0395899_0011225 | 3300037312 | Bacteria | 6863 |
| 20 | Ga0395899_0013403 | 3300037312 | Bacteria | 6272 |
| 21 | Ga0395900_0100455 | 3300037418 | Bacteria | 2972 |
| 22 | Ga0395898_0890294 | 3300037466 | Bacteria | 828 |
| 23 | Ga0395905_0108061 | 3300037471 | Bacteria | 2611 |
| 24 | Ga0395905_0210785 | 3300037471 | Bacteria | 1820 |
| 25 | Ga0395905_0493104 | 3300037471 | Bacteria | 1125 |
| 26 | Ga0395905_0526542 | 3300037471 | Bacteria | 1082 |
| 27 | Ga0395905_0761797 | 3300037471 | Bacteria | 871 |
| 28 | Ga0395901_0019285 | 3300038443 | Bacteria | 6972 |
| 29 | Ga0395901_0211091 | 3300038443 | Bacteria | 2032 |
| 30 | Ga0395901_0402559 | 3300038443 | Bacteria | 1406 |
| 31 | Ga0395901_0941881 | 3300038443 | Bacteria | 843 |
| 32 | Ga0450904_001511 | 3300042139 | Bacteria | 3205 |
| 33 | Ga0466972_0085221 | 3300044658 | Bacteria | 1502 |
| 34 | Ga0466966_0008752 | 3300044684 | Bacteria | 6701 |
| 35 | Ga0495617_000009 | 3300046452 | Bacteria | 312936 |
| 36 | Ga0495617_000743 | 3300046452 | Bacteria | 16044 |
| 37 | Ga0495617_002134 | 3300046452 | Bacteria | 8136 |
| 38 | Ga0495627_000226 | 3300046453 | Bacteria | 59863 |
| 39 | Ga0495627_004448 | 3300046453 | Bacteria | 5864 |
| 40 | Ga0495603_0018897 | 3300046455 | Bacteria | 4171 |
| 41 | Ga0495603_0177594 | 3300046455 | Bacteria | 1232 |
| 42 | Ga0495603_0185234 | 3300046455 | Bacteria | 1204 |
| 43 | Ga0495590_0000054 | 3300046457 | Bacteria | 100477 |
| 44 | Ga0495590_0108335 | 3300046457 | Bacteria | 990 |
| 45 | Ga0495591_005672 | 3300046458 | Bacteria | 5715 |
| 46 | Ga0495629_0047979 | 3300046459 | Bacteria | 2994 |
| 47 | Ga0495638_0198470 | 3300046460 | Bacteria | 1134 |
| 48 | Ga0495653_0028287 | 3300046463 | Bacteria | 4482 |
| 49 | Ga0495653_0028904 | 3300046463 | Bacteria | 4431 |
| 50 | Ga0495653_0092534 | 3300046463 | Bacteria | 2207 |
| 51 | Ga0495650_0000171 | 3300046471 | Bacteria | 142895 |
| 52 | Ga0495580_0027791 | 3300046472 | Bacteria | 4114 |
| 53 | Ga0495580_0109384 | 3300046472 | Bacteria | 1919 |
| 54 | Ga0495580_0230951 | 3300046472 | Bacteria | 1270 |
| 55 | Ga0495582_0005898 | 3300046473 | Bacteria | 6826 |
| 56 | Ga0495582_0021530 | 3300046473 | Bacteria | 3529 |
| 57 | Ga0495582_0056040 | 3300046473 | Bacteria | 2172 |
| 58 | Ga0495605_0000022 | 3300046474 | Bacteria | 248321 |
| 59 | Ga0495605_0000226 | 3300046474 | Bacteria | 69648 |
| 60 | Ga0495605_0012454 | 3300046474 | Bacteria | 4718 |
| 61 | Ga0495605_0024093 | 3300046474 | Bacteria | 3189 |
| 62 | Ga0495605_0028898 | 3300046474 | Bacteria | 2858 |
| 63 | Ga0495605_0039968 | 3300046474 | Bacteria | 2346 |
| 64 | Ga0495605_0077397 | 3300046474 | Bacteria | 1560 |
| 65 | Ga0495605_0181672 | 3300046474 | Bacteria | 924 |
| 66 | Ga0495584_0007186 | 3300046491 | Bacteria | 5814 |
| 67 | Ga0495584_0012148 | 3300046491 | Bacteria | 4400 |
| 68 | Ga0495584_0024896 | 3300046491 | Bacteria | 3034 |
| 69 | Ga0495584_0028477 | 3300046491 | Bacteria | 2831 |
| 70 | Ga0495584_0029808 | 3300046491 | Bacteria | 2765 |
| 71 | Ga0495584_0041320 | 3300046491 | Bacteria | 2328 |
| 72 | Ga0495584_0046972 | 3300046491 | Bacteria | 2177 |
| 73 | Ga0495584_0048846 | 3300046491 | Bacteria | 2132 |
| 74 | Ga0495584_0083101 | 3300046491 | Bacteria | 1612 |
| 75 | Ga0495584_0147181 | 3300046491 | Bacteria | 1196 |
| 76 | Ga0495584_0194642 | 3300046491 | Bacteria | 1030 |
| 77 | Ga0495585_0000010 | 3300046492 | Bacteria | 229958 |
| 78 | Ga0495585_0000909 | 3300046492 | Bacteria | 25085 |
| 79 | Ga0495585_0002720 | 3300046492 | Bacteria | 12361 |
| 80 | Ga0495585_0036536 | 3300046492 | Bacteria | 2769 |
| 81 | Ga0495585_0041517 | 3300046492 | Bacteria | 2579 |
| 82 | Ga0495585_0063831 | 3300046492 | Bacteria | 2020 |
| 83 | Ga0495585_0091317 | 3300046492 | Bacteria | 1639 |
| 84 | Ga0495585_0091811 | 3300046492 | Bacteria | 1634 |
| 85 | Ga0495585_0092959 | 3300046492 | Bacteria | 1622 |
| 86 | Ga0495585_0120606 | 3300046492 | Bacteria | 1387 |
| 87 | Ga0495585_0148742 | 3300046492 | Bacteria | 1222 |
| 88 | Ga0495585_0172600 | 3300046492 | Bacteria | 1116 |
| 89 | Ga0495594_0006627 | 3300046499 | Bacteria | 5958 |
| 90 | Ga0495594_0016932 | 3300046499 | Bacteria | 3846 |
| 91 | Ga0495594_0021078 | 3300046499 | Bacteria | 3477 |
| 92 | Ga0495594_0145972 | 3300046499 | Bacteria | 1342 |
| 93 | Ga0495594_0154214 | 3300046499 | Bacteria | 1304 |
| 94 | Ga0495596_0000023 | 3300046500 | Bacteria | 110071 |
| 95 | Ga0495596_0001321 | 3300046500 | Bacteria | 14274 |
| 96 | Ga0495596_0001392 | 3300046500 | Bacteria | 13894 |
| 97 | Ga0495596_0003202 | 3300046500 | Bacteria | 8419 |
| 98 | Ga0495596_0003783 | 3300046500 | Bacteria | 7554 |
| 99 | Ga0495596_0010183 | 3300046500 | Bacteria | 4105 |
| 100 | Ga0495596_0024574 | 3300046500 | Bacteria | 2438 |
| 101 | Ga0495596_0037366 | 3300046500 | Bacteria | 1920 |
| 102 | Ga0495596_0040321 | 3300046500 | Bacteria | 1843 |
| 103 | Ga0495596_0093337 | 3300046500 | Bacteria | 1168 |
| 104 | Ga0495596_0119419 | 3300046500 | Bacteria | 1023 |
| 105 | Ga0495607_0002485 | 3300046501 | Bacteria | 14951 |
| 106 | Ga0495607_0008004 | 3300046501 | Bacteria | 7261 |
| 107 | Ga0495607_0018331 | 3300046501 | Bacteria | 4465 |
| 108 | Ga0495607_0023472 | 3300046501 | Bacteria | 3861 |
| 109 | Ga0495607_0083136 | 3300046501 | Bacteria | 1754 |
| 110 | Ga0495583_0000386 | 3300046506 | Bacteria | 67832 |
| 111 | Ga0495583_0000482 | 3300046506 | Bacteria | 58319 |
| 112 | Ga0495583_0001015 | 3300046506 | Bacteria | 32043 |
| 113 | Ga0495583_0003442 | 3300046506 | Bacteria | 12047 |
| 114 | Ga0495583_0014380 | 3300046506 | Bacteria | 4370 |
| 115 | Ga0495583_0042349 | 3300046506 | Bacteria | 2127 |
| 116 | Ga0495583_0044056 | 3300046506 | Bacteria | 2074 |
| 117 | Ga0495583_0046082 | 3300046506 | Bacteria | 2012 |
| 118 | Ga0495583_0071289 | 3300046506 | Bacteria | 1526 |
| 119 | Ga0495606_0000039 | 3300046507 | Bacteria | 224632 |
| 120 | Ga0495606_0001106 | 3300046507 | Bacteria | 38587 |
| 121 | Ga0495606_0019535 | 3300046507 | Bacteria | 5035 |
| 122 | Ga0495606_0063854 | 3300046507 | Bacteria | 2345 |
| 123 | Ga0495606_0077174 | 3300046507 | Bacteria | 2080 |
| 124 | Ga0495606_0081373 | 3300046507 | Bacteria | 2013 |
| 125 | Ga0495606_0108546 | 3300046507 | Bacteria | 1677 |
| 126 | Ga0495606_0155534 | 3300046507 | Bacteria | 1338 |
| 127 | Ga0495606_0202434 | 3300046507 | Bacteria | 1130 |
| 128 | Ga0495606_0258177 | 3300046507 | Bacteria | 963 |
| 129 | Ga0495610_0003876 | 3300046512 | Bacteria | 11362 |
| 130 | Ga0495610_0007702 | 3300046512 | Bacteria | 7106 |
| 131 | Ga0495616_0000374 | 3300046513 | Bacteria | 34798 |
| 132 | Ga0495616_0000560 | 3300046513 | Bacteria | 28175 |
| 133 | Ga0495616_0001569 | 3300046513 | Bacteria | 15741 |
| 134 | Ga0495616_0002627 | 3300046513 | Bacteria | 11826 |
| 135 | Ga0495616_0013905 | 3300046513 | Bacteria | 4522 |
| 136 | Ga0495616_0021120 | 3300046513 | Bacteria | 3530 |
| 137 | Ga0495616_0022169 | 3300046513 | Bacteria | 3431 |
| 138 | Ga0495616_0171948 | 3300046513 | Bacteria | 968 |
| 139 | Ga0495616_0212952 | 3300046513 | Bacteria | 844 |
| 140 | Ga0495620_0002294 | 3300046515 | Bacteria | 11073 |
| 141 | Ga0495630_0168449 | 3300046517 | Bacteria | 1668 |
| 142 | Ga0495630_0302892 | 3300046517 | Bacteria | 1221 |
| 143 | Ga0495631_0000168 | 3300046518 | Bacteria | 44535 |
| 144 | Ga0495631_0003158 | 3300046518 | Bacteria | 9064 |
| 145 | Ga0495631_0005612 | 3300046518 | Bacteria | 6552 |
| 146 | Ga0495631_0007454 | 3300046518 | Bacteria | 5559 |
| 147 | Ga0495631_0015801 | 3300046518 | Bacteria | 3609 |
| 148 | Ga0495631_0015875 | 3300046518 | Bacteria | 3598 |
| 149 | Ga0495631_0055284 | 3300046518 | Bacteria | 1729 |
| 150 | Ga0495631_0067639 | 3300046518 | Bacteria | 1545 |
| 151 | Ga0495631_0071464 | 3300046518 | Bacteria | 1499 |
| 152 | Ga0495631_0199081 | 3300046518 | Bacteria | 856 |
| 153 | Ga0495632_0000245 | 3300046519 | Bacteria | 53759 |
| 154 | Ga0495632_0009037 | 3300046519 | Bacteria | 6039 |
| 155 | Ga0495632_0018925 | 3300046519 | Bacteria | 3761 |
| 156 | Ga0495632_0032431 | 3300046519 | Bacteria | 2691 |
| 157 | Ga0495632_0043078 | 3300046519 | Bacteria | 2258 |
| 158 | Ga0495632_0112908 | 3300046519 | Bacteria | 1274 |
| 159 | Ga0495637_0000012 | 3300046520 | Bacteria | 273124 |
| 160 | Ga0495637_0057378 | 3300046520 | Bacteria | 1608 |
| 161 | Ga0495637_0058147 | 3300046520 | Bacteria | 1594 |
| 162 | Ga0495643_0000247 | 3300046522 | Bacteria | 79969 |
| 163 | Ga0495643_0016364 | 3300046522 | Bacteria | 4355 |
| 164 | Ga0495643_0020056 | 3300046522 | Bacteria | 3861 |
| 165 | Ga0495643_0104952 | 3300046522 | Bacteria | 1443 |
| 166 | Ga0495644_0028957 | 3300046523 | Bacteria | 2094 |
| 167 | Ga0495644_0039940 | 3300046523 | Bacteria | 1769 |
| 168 | Ga0495644_0065127 | 3300046523 | Bacteria | 1369 |
| 169 | Ga0495648_0000003 | 3300046524 | Bacteria | 386817 |
| 170 | Ga0495648_0002211 | 3300046524 | Bacteria | 18215 |
| 171 | Ga0495648_0021627 | 3300046524 | Bacteria | 4451 |
| 172 | Ga0495648_0062939 | 3300046524 | Bacteria | 2194 |
| 173 | Ga0495648_0063401 | 3300046524 | Bacteria | 2182 |
| 174 | Ga0495648_0066417 | 3300046524 | Bacteria | 2114 |
| 175 | Ga0495648_0079098 | 3300046524 | Bacteria | 1878 |
| 176 | Ga0495648_0173562 | 3300046524 | Bacteria | 1102 |
| 177 | Ga0495663_0009171 | 3300046525 | Bacteria | 2743 |
| 178 | Ga0495663_0026897 | 3300046525 | Bacteria | 1686 |
| 179 | Ga0495666_0004887 | 3300046526 | Bacteria | 6776 |
| 180 | Ga0495666_0010165 | 3300046526 | Bacteria | 4694 |
| 181 | Ga0495666_0014365 | 3300046526 | Bacteria | 3943 |
| 182 | Ga0495666_0038566 | 3300046526 | Bacteria | 2323 |
| 183 | Ga0495642_0004510 | 3300046528 | Bacteria | 5406 |
| 184 | Ga0495642_0016335 | 3300046528 | Bacteria | 2892 |
| 185 | Ga0495642_0030580 | 3300046528 | Bacteria | 2154 |
| 186 | Ga0495642_0032827 | 3300046528 | Bacteria | 2084 |
| 187 | Ga0495654_0012120 | 3300046530 | Bacteria | 4640 |
| 188 | Ga0495665_0016990 | 3300046531 | Bacteria | 3915 |
| 189 | Ga0495665_0040324 | 3300046531 | Bacteria | 2486 |
| 190 | Ga0495640_0194811 | 3300046533 | Bacteria | 1287 |
| 191 | Ga0495586_0089780 | 3300046535 | Bacteria | 1696 |
| 192 | Ga0495586_0122930 | 3300046535 | Bacteria | 1450 |
| 193 | Ga0495586_0175730 | 3300046535 | Bacteria | 1210 |
| 194 | Ga0495587_0120711 | 3300046536 | Bacteria | 1501 |
| 195 | Ga0495609_0008421 | 3300046538 | Bacteria | 5053 |
| 196 | Ga0495609_0009516 | 3300046538 | Bacteria | 4701 |
| 197 | Ga0495609_0015096 | 3300046538 | Bacteria | 3619 |
| 198 | Ga0495609_0019310 | 3300046538 | Bacteria | 3155 |
| 199 | Ga0495609_0020346 | 3300046538 | Bacteria | 3067 |
| 200 | Ga0495609_0052198 | 3300046538 | Bacteria | 1819 |
| 201 | Ga0495609_0112857 | 3300046538 | Bacteria | 1172 |
| 202 | Ga0495609_0139489 | 3300046538 | Bacteria | 1035 |
| 203 | Ga0495609_0255956 | 3300046538 | Bacteria | 720 |
| 204 | Ga0495597_0000619 | 3300046542 | Bacteria | 29010 |
| 205 | Ga0495597_0007720 | 3300046542 | Bacteria | 5438 |
| 206 | Ga0495597_0007930 | 3300046542 | Bacteria | 5351 |
| 207 | Ga0495597_0021601 | 3300046542 | Bacteria | 2991 |
| 208 | Ga0495597_0031142 | 3300046542 | Bacteria | 2429 |
| 209 | Ga0495597_0036688 | 3300046542 | Bacteria | 2205 |
| 210 | Ga0495597_0037394 | 3300046542 | Bacteria | 2179 |
| 211 | Ga0495597_0095159 | 3300046542 | Bacteria | 1260 |
| 212 | Ga0495597_0245027 | 3300046542 | Bacteria | 706 |
| 213 | Ga0495622_0012429 | 3300046557 | Bacteria | 3941 |
| 214 | Ga0495622_0063310 | 3300046557 | Bacteria | 1711 |
| 215 | Ga0495622_0087070 | 3300046557 | Bacteria | 1436 |
| 216 | Ga0495622_0177089 | 3300046557 | Bacteria | 957 |
| 217 | Ga0495633_0000031 | 3300046558 | Bacteria | 196727 |
| 218 | Ga0495633_0004197 | 3300046558 | Bacteria | 9239 |
| 219 | Ga0495633_0008579 | 3300046558 | Bacteria | 5743 |
| 220 | Ga0495633_0023703 | 3300046558 | Bacteria | 3038 |
| 221 | Ga0495633_0025451 | 3300046558 | Bacteria | 2913 |
| 222 | Ga0495633_0027208 | 3300046558 | Bacteria | 2796 |
| 223 | Ga0495633_0031320 | 3300046558 | Bacteria | 2579 |
| 224 | Ga0495656_0015185 | 3300046615 | Bacteria | 2903 |
| 225 | Ga0495656_0171307 | 3300046615 | Bacteria | 1062 |
| 226 | Ga0495656_0185722 | 3300046615 | Bacteria | 1024 |
| 227 | Ga0495668_0000088 | 3300046616 | Bacteria | 151503 |
| 228 | Ga0495668_0000346 | 3300046616 | Bacteria | 61788 |
| 229 | Ga0495668_0002491 | 3300046616 | Bacteria | 15069 |
| 230 | Ga0495668_0084403 | 3300046616 | Bacteria | 1741 |
| 231 | Ga0495668_0160471 | 3300046616 | Bacteria | 1231 |
| 232 | Ga0495634_0137079 | 3300046642 | Bacteria | 1556 |
| 233 | Ga0495611_0003553 | 3300046648 | Bacteria | 6851 |
| 234 | Ga0495611_0005966 | 3300046648 | Bacteria | 5196 |
| 235 | Ga0495611_0009366 | 3300046648 | Bacteria | 4139 |
| 236 | Ga0495611_0012224 | 3300046648 | Bacteria | 3649 |
| 237 | Ga0495611_0016926 | 3300046648 | Bacteria | 3117 |
| 238 | Ga0495625_0232498 | 3300046660 | Bacteria | 1203 |
| 239 | Ga0495635_0417508 | 3300046663 | Bacteria | 890 |
| 240 | Ga0495659_0116171 | 3300046664 | Bacteria | 1049 |
| 241 | Ga0495661_0001941 | 3300046665 | Bacteria | 16429 |
| 242 | Ga0495661_0012786 | 3300046665 | Bacteria | 5663 |
| 243 | Ga0495661_0016044 | 3300046665 | Bacteria | 4975 |
| 244 | Ga0495661_0021478 | 3300046665 | Bacteria | 4208 |
| 245 | Ga0495661_0038369 | 3300046665 | Bacteria | 2984 |
| 246 | Ga0495661_0050930 | 3300046665 | Bacteria | 2503 |
| 247 | Ga0495661_0054858 | 3300046665 | Bacteria | 2391 |
| 248 | Ga0495661_0059872 | 3300046665 | Bacteria | 2264 |
| 249 | Ga0495661_0065619 | 3300046665 | Bacteria | 2138 |
| 250 | Ga0495661_0083336 | 3300046665 | Bacteria | 1838 |
| 251 | Ga0495661_0109230 | 3300046665 | Bacteria | 1544 |
| 252 | Ga0495661_0153647 | 3300046665 | Bacteria | 1241 |
| 253 | Ga0495661_0164442 | 3300046665 | Bacteria | 1188 |
| 254 | Ga0495588_0039045 | 3300046674 | Bacteria | 2417 |
| 255 | Ga0495588_0053876 | 3300046674 | Bacteria | 2074 |
| 256 | Ga0495588_0122582 | 3300046674 | Bacteria | 1370 |
| 257 | Ga0495588_0170585 | 3300046674 | Bacteria | 1150 |
| 258 | Ga0495623_0168502 | 3300046679 | Bacteria | 1281 |
| 259 | Ga0495669_0000194 | 3300046684 | Bacteria | 37638 |
| 260 | Ga0495669_0001648 | 3300046684 | Bacteria | 9170 |
| 261 | Ga0495669_0008045 | 3300046684 | Bacteria | 4424 |
| 262 | Ga0495669_0026350 | 3300046684 | Bacteria | 2540 |
| 263 | Ga0495669_0037092 | 3300046684 | Bacteria | 2156 |
| 264 | Ga0495669_0061437 | 3300046684 | Bacteria | 1700 |
| 265 | Ga0495669_0124042 | 3300046684 | Bacteria | 1212 |
| 266 | Ga0495613_0179168 | 3300046689 | Bacteria | 1501 |
| 267 | Ga0495613_0187660 | 3300046689 | Bacteria | 1462 |
| 268 | Ga0495613_0270875 | 3300046689 | Bacteria | 1181 |
| 269 | Ga0495670_0006999 | 3300046691 | Bacteria | 5555 |
| 270 | Ga0495670_0009478 | 3300046691 | Bacteria | 4785 |
| 271 | Ga0495670_0015671 | 3300046691 | Bacteria | 3725 |
| 272 | Ga0495670_0018940 | 3300046691 | Bacteria | 3391 |
| 273 | Ga0495670_0037573 | 3300046691 | Bacteria | 2413 |
| 274 | Ga0495670_0041510 | 3300046691 | Bacteria | 2295 |
| 275 | Ga0495670_0041914 | 3300046691 | Bacteria | 2284 |
| 276 | Ga0495670_0046737 | 3300046691 | Bacteria | 2162 |
| 277 | Ga0495670_0301740 | 3300046691 | Bacteria | 858 |
| 278 | Ga0495671_0001102 | 3300046692 | Bacteria | 18662 |
| 279 | Ga0495671_0015646 | 3300046692 | Bacteria | 4059 |
| 280 | Ga0495671_0031971 | 3300046692 | Bacteria | 2688 |
| 281 | Ga0495671_0048978 | 3300046692 | Bacteria | 2107 |
| 282 | Ga0495649_0000115 | 3300046694 | Bacteria | 71036 |
| 283 | Ga0495649_0076989 | 3300046694 | Bacteria | 1785 |
| 284 | Ga0495589_0006540 | 3300046794 | Bacteria | 6144 |
| 285 | Ga0495589_0027729 | 3300046794 | Bacteria | 2862 |
| 286 | Ga0495589_0028460 | 3300046794 | Bacteria | 2820 |
| 287 | Ga0495589_0037819 | 3300046794 | Bacteria | 2416 |
| 288 | Ga0495589_0043637 | 3300046794 | Bacteria | 2231 |
| 289 | Ga0495589_0060769 | 3300046794 | Bacteria | 1855 |
| 290 | Ga0495589_0094227 | 3300046794 | Bacteria | 1453 |
| 291 | Ga0495600_0014516 | 3300046809 | Bacteria | 4965 |
| 292 | Ga0495600_0092150 | 3300046809 | Bacteria | 1976 |
| 293 | Ga0495660_0087178 | 3300046810 | Bacteria | 1628 |
| 294 | Ga0495660_0131463 | 3300046810 | Bacteria | 1255 |
| 295 | Ga0495660_0152372 | 3300046810 | Bacteria | 1140 |
| 296 | Ga0495581_0117362 | 3300047315 | Bacteria | 1547 |
| 297 | Ga0495581_0192326 | 3300047315 | Bacteria | 1193 |
| 298 | Ga0495604_0024662 | 3300047317 | Bacteria | 4798 |
| 299 | Ga0495604_0106229 | 3300047317 | Bacteria | 2054 |
| 300 | Ga0495636_0038240 | 3300047318 | Bacteria | 1984 |
| 301 | Ga0495636_0204193 | 3300047318 | Bacteria | 903 |
| 302 | Ga0495636_0357326 | 3300047318 | Bacteria | 690 |
| 303 | Ga0495672_0000124 | 3300047320 | Bacteria | 118878 |
| 304 | Ga0495672_0003246 | 3300047320 | Bacteria | 14113 |
| 305 | Ga0495672_0004305 | 3300047320 | Bacteria | 11727 |
| 306 | Ga0495672_0010682 | 3300047320 | Bacteria | 6520 |
| 307 | Ga0495672_0072487 | 3300047320 | Bacteria | 1945 |
| 308 | Ga0495672_0113730 | 3300047320 | Bacteria | 1449 |
| 309 | Ga0495676_0000040 | 3300047321 | Bacteria | 106964 |
| 310 | Ga0495676_0118262 | 3300047321 | Bacteria | 1932 |
| 311 | Ga0495676_0243167 | 3300047321 | Bacteria | 1231 |
| 312 | Ga0495680_0009912 | 3300047322 | Bacteria | 8540 |
| 313 | Ga0495683_0000158 | 3300047323 | Bacteria | 66468 |
| 314 | Ga0495683_0000177 | 3300047323 | Bacteria | 62546 |
| 315 | Ga0495683_0010147 | 3300047323 | Bacteria | 4992 |
| 316 | Ga0495683_0050363 | 3300047323 | Bacteria | 2084 |
| 317 | Ga0495683_0063703 | 3300047323 | Bacteria | 1821 |
| 318 | Ga0495683_0077588 | 3300047323 | Bacteria | 1624 |
| 319 | Ga0495687_002319 | 3300047443 | Bacteria | 15510 |
| 320 | Ga0495687_008911 | 3300047443 | Bacteria | 5680 |
| 321 | Ga0495687_143825 | 3300047443 | Bacteria | 825 |
| 322 | Ga0495675_0062316 | 3300047444 | Bacteria | 2361 |
| 323 | Ga0495675_0133376 | 3300047444 | Bacteria | 1543 |
| 324 | Ga0495677_0001050 | 3300047445 | Bacteria | 11103 |
| 325 | Ga0495677_0001875 | 3300047445 | Bacteria | 8400 |
| 326 | Ga0495677_0005253 | 3300047445 | Bacteria | 4922 |
| 327 | Ga0495677_0005875 | 3300047445 | Bacteria | 4648 |
| 328 | Ga0495677_0014665 | 3300047445 | Bacteria | 2850 |
| 329 | Ga0495677_0031965 | 3300047445 | Bacteria | 1916 |
| 330 | Ga0495677_0052415 | 3300047445 | Bacteria | 1503 |
| 331 | Ga0495677_0060656 | 3300047445 | Bacteria | 1402 |
| 332 | Ga0495679_007400 | 3300047446 | Bacteria | 4578 |
| 333 | Ga0495679_039747 | 3300047446 | Bacteria | 1465 |
| 334 | Ga0495685_014477 | 3300047447 | Bacteria | 2680 |
| 335 | Ga0495685_028684 | 3300047447 | Bacteria | 1914 |
| 336 | Ga0495673_0002276 | 3300047469 | Bacteria | 13763 |
| 337 | Ga0495681_0000515 | 3300047470 | Bacteria | 29483 |
| 338 | Ga0495681_0013839 | 3300047470 | Bacteria | 4663 |
| 339 | Ga0495681_0013920 | 3300047470 | Bacteria | 4642 |
| 340 | Ga0495681_0041109 | 3300047470 | Bacteria | 2246 |
| 341 | Ga0495681_0051143 | 3300047470 | Bacteria | 1944 |
| 342 | Ga0495681_0052657 | 3300047470 | Bacteria | 1908 |
| 343 | Ga0495681_0086611 | 3300047470 | Bacteria | 1390 |
| 344 | Ga0495686_0001860 | 3300047472 | Bacteria | 21178 |
| 345 | Ga0495686_0004141 | 3300047472 | Bacteria | 12069 |
| 346 | Ga0495686_0004633 | 3300047472 | Bacteria | 11181 |
| 347 | Ga0495686_0007279 | 3300047472 | Bacteria | 8320 |
| 348 | Ga0495686_0063245 | 3300047472 | Bacteria | 2294 |
| 349 | Ga0495686_0065968 | 3300047472 | Bacteria | 2237 |
| 350 | Ga0495593_0035261 | 3300047673 | Bacteria | 2717 |
| 351 | Ga0495593_0049989 | 3300047673 | Bacteria | 2216 |
| 352 | Ga0495602_0102129 | 3300048088 | Bacteria | 2351 |
| 353 | Ga0495602_0130425 | 3300048088 | Bacteria | 2006 |
| 354 | Ga0495614_0027641 | 3300048089 | Bacteria | 2445 |
| 355 | Ga0495614_0083237 | 3300048089 | Bacteria | 1387 |
| 356 | Ga0495626_0001148 | 3300048091 | Bacteria | 22121 |
| 357 | Ga0495626_0003185 | 3300048091 | Bacteria | 10689 |
| 358 | Ga0495626_0013539 | 3300048091 | Bacteria | 4236 |
| 359 | Ga0495626_0014027 | 3300048091 | Bacteria | 4146 |
| 360 | Ga0495626_0016371 | 3300048091 | Bacteria | 3767 |
| 361 | Ga0495626_0018975 | 3300048091 | Bacteria | 3442 |
| 362 | Ga0495626_0020927 | 3300048091 | Bacteria | 3253 |
| 363 | Ga0495626_0023891 | 3300048091 | Bacteria | 3003 |
| 364 | Ga0495626_0023929 | 3300048091 | Bacteria | 3000 |
| 365 | Ga0495626_0028062 | 3300048091 | Bacteria | 2732 |
| 366 | Ga0495626_0055098 | 3300048091 | Bacteria | 1824 |
| 367 | Ga0495626_0059941 | 3300048091 | Bacteria | 1735 |
| 368 | Ga0495626_0081717 | 3300048091 | Bacteria | 1434 |
| 369 | Ga0495626_0085893 | 3300048091 | Bacteria | 1391 |
| 370 | Ga0495626_0115352 | 3300048091 | Bacteria | 1159 |
| 371 | Ga0495626_0151978 | 3300048091 | Bacteria | 975 |
| 372 | Ga0495626_0153737 | 3300048091 | Bacteria | 968 |
| 373 | Ga0496100_0462711 | 3300048903 | Bacteria | 973 |
| 374 | Ga0496101_0230455 | 3300048904 | Bacteria | 1439 |
| 375 | Ga0496102_0000285 | 3300048905 | Bacteria | 64637 |
| 376 | Ga0496102_0192580 | 3300048905 | Bacteria | 1921 |
| 377 | Ga0496103_0055104 | 3300048906 | Bacteria | 2465 |
| 378 | Ga0496103_0065418 | 3300048906 | Bacteria | 2268 |
| 379 | Ga0496103_0133406 | 3300048906 | Bacteria | 1586 |
| 380 | Ga0496104_0189478 | 3300048907 | Bacteria | 1968 |
| 381 | Ga0496105_0178623 | 3300048908 | Bacteria | 1739 |
| 382 | Ga0496107_0135535 | 3300048910 | Bacteria | 1819 |
| 383 | Ga0496107_0357106 | 3300048910 | Bacteria | 1087 |
| 384 | Ga0496110_0000403 | 3300048913 | Bacteria | 29296 |
| 385 | Ga0496111_0041010 | 3300048914 | Bacteria | 3321 |
| 386 | Ga0496111_0160477 | 3300048914 | Bacteria | 1669 |
| 387 | Ga0496113_0057669 | 3300048916 | Bacteria | 2919 |
| 388 | Ga0496115_0027507 | 3300048918 | Bacteria | 4449 |
| 389 | Ga0496115_0078393 | 3300048918 | Bacteria | 2688 |
| 390 | Ga0496122_0000326 | 3300048925 | Bacteria | 103567 |
| 391 | Ga0496123_0025878 | 3300048926 | Bacteria | 4410 |
| 392 | Ga0496125_0000696 | 3300048928 | Bacteria | 55487 |
| 393 | Ga0496125_0004366 | 3300048928 | Bacteria | 16383 |
| 394 | Ga0495678_000144 | 3300049459 | Bacteria | 86580 |
| 395 | Ga0495678_000844 | 3300049459 | Bacteria | 27363 |
| 396 | Ga0495678_006701 | 3300049459 | Bacteria | 6079 |
| 397 | Ga0495678_011000 | 3300049459 | Bacteria | 4354 |
| 398 | Ga0495682_0009836 | 3300049460 | Bacteria | 3721 |
| 399 | Ga0495682_0015922 | 3300049460 | Bacteria | 2847 |
| 400 | Ga0501044_0473570 | 3300049823 | Bacteria | 1156 |
| 401 | Ga0587094_020655 | 3300059513 | Bacteria | 954 |
| 402 | Ga0587101_020336 | 3300059623 | Bacteria | 949 |
| 403 | Ga0587076_034410 | 3300059645 | Bacteria | 916 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0014516 | Ga0495600_0014516_3337_4065 | 200 |
| 2 | 3300048904 | Ga0496101_0230455 | Ga0496101_0230455_443_1117 | 202 |
| 3 | 3300048916 | Ga0496113_0057669 | Ga0496113_0057669_634_1308 | 202 |
| 4 | 3300048925 | Ga0496122_0000326 | Ga0496122_0000326_4114_4788 | 202 |
| 5 | 3300048926 | Ga0496123_0025878 | Ga0496123_0025878_3140_3814 | 202 |
| 6 | 3300048928 | Ga0496125_0000696 | Ga0496125_0000696_53344_54018 | 202 |
| 7 | 3300047472 | Ga0495686_0004633 | Ga0495686_0004633_7634_8269 | 204 |
| 8 | 3300025245 | Ga0207425_1000173 | Ga0207425_100017341 | 205 |
| 9 | 3300025294 | Ga0209025_1005905 | Ga0209025_10059052 | 205 |
| 10 | 3300025297 | Ga0209758_1000449 | Ga0209758_100044922 | 205 |
| 11 | 3300030745 | Ga0316182_1439499 | Ga0316182_14394992 | 205 |
| 12 | 3300031730 | Ga0307516_10397074 | Ga0307516_103970742 | 205 |
| 13 | 3300046452 | Ga0495617_002134 | Ga0495617_002134_6637_7269 | 205 |
| 14 | 3300046474 | Ga0495605_0000022 | Ga0495605_0000022_189060_189692 | 205 |
| 15 | 3300046507 | Ga0495606_0000039 | Ga0495606_0000039_219327_219959 | 205 |
| 16 | 3300046507 | Ga0495606_0001106 | Ga0495606_0001106_34934_35566 | 205 |
| 17 | 3300046512 | Ga0495610_0003876 | Ga0495610_0003876_10537_11169 | 205 |
| 18 | 3300046520 | Ga0495637_0057378 | Ga0495637_0057378_585_1217 | 205 |
| 19 | 3300046558 | Ga0495633_0000031 | Ga0495633_0000031_30796_31440 | 205 |
| 20 | 3300046616 | Ga0495668_0000088 | Ga0495668_0000088_30307_30939 | 205 |
| 21 | 3300047472 | Ga0495686_0004141 | Ga0495686_0004141_6735_7367 | 205 |
| 22 | 3300009174 | Ga0105241_10031859 | Ga0105241_100318592 | 206 |
| 23 | 3300025911 | Ga0207654_10015828 | Ga0207654_100158285 | 206 |
| 24 | 3300037471 | Ga0395905_0493104 | Ga0395905_0493104_104_736 | 207 |
| 25 | 3300037471 | Ga0395905_0761797 | Ga0395905_0761797_214_846 | 207 |
| 26 | 3300046463 | Ga0495653_0092534 | Ga0495653_0092534_942_1571 | 208 |
| 27 | 3300046472 | Ga0495580_0027791 | Ga0495580_0027791_3007_3636 | 208 |
| 28 | 3300046473 | Ga0495582_0005898 | Ga0495582_0005898_1745_2374 | 208 |
| 29 | 3300046507 | Ga0495606_0202434 | Ga0495606_0202434_113_742 | 208 |
| 30 | 3300046517 | Ga0495630_0302892 | Ga0495630_0302892_430_1059 | 208 |
| 31 | 3300046533 | Ga0495640_0194811 | Ga0495640_0194811_210_839 | 208 |
| 32 | 3300046535 | Ga0495586_0089780 | Ga0495586_0089780_517_1146 | 208 |
| 33 | 3300046536 | Ga0495587_0120711 | Ga0495587_0120711_260_889 | 208 |
| 34 | 3300046642 | Ga0495634_0137079 | Ga0495634_0137079_624_1253 | 208 |
| 35 | 3300046809 | Ga0495600_0092150 | Ga0495600_0092150_279_908 | 208 |
| 36 | 3300047317 | Ga0495604_0024662 | Ga0495604_0024662_3581_4210 | 208 |
| 37 | 3300048088 | Ga0495602_0130425 | Ga0495602_0130425_895_1524 | 208 |
| 38 | 3300048903 | Ga0496100_0462711 | Ga0496100_0462711_316_960 | 208 |
| 39 | 3300046460 | Ga0495638_0198470 | Ga0495638_0198470_461_1090 | 209 |
| 40 | 3300046472 | Ga0495580_0109384 | Ga0495580_0109384_507_1136 | 209 |
| 41 | 3300046499 | Ga0495594_0021078 | Ga0495594_0021078_513_1142 | 209 |
| 42 | 3300046507 | Ga0495606_0258177 | Ga0495606_0258177_122_751 | 209 |
| 43 | 3300046526 | Ga0495666_0004887 | Ga0495666_0004887_5341_5970 | 209 |
| 44 | 3300046531 | Ga0495665_0040324 | Ga0495665_0040324_487_1116 | 209 |
| 45 | 3300046557 | Ga0495622_0012429 | Ga0495622_0012429_642_1271 | 209 |
| 46 | 3300046689 | Ga0495613_0187660 | Ga0495613_0187660_406_1035 | 209 |
| 47 | 3300047315 | Ga0495581_0117362 | Ga0495581_0117362_826_1455 | 209 |
| 48 | 3300047472 | Ga0495686_0001860 | Ga0495686_0001860_11690_12319 | 209 |
| 49 | 3300046463 | Ga0495653_0028904 | Ga0495653_0028904_2016_2648 | 210 |
| 50 | 3300046471 | Ga0495650_0000171 | Ga0495650_0000171_66742_67377 | 210 |
| 51 | 3300046474 | Ga0495605_0028898 | Ga0495605_0028898_1958_2602 | 210 |
| 52 | 3300046474 | Ga0495605_0181672 | Ga0495605_0181672_146_778 | 210 |
| 53 | 3300046491 | Ga0495584_0024896 | Ga0495584_0024896_2084_2716 | 210 |
| 54 | 3300046499 | Ga0495594_0145972 | Ga0495594_0145972_47_679 | 210 |
| 55 | 3300046500 | Ga0495596_0000023 | Ga0495596_0000023_63870_64502 | 210 |
| 56 | 3300046500 | Ga0495596_0010183 | Ga0495596_0010183_173_817 | 210 |
| 57 | 3300046500 | Ga0495596_0024574 | Ga0495596_0024574_652_1287 | 210 |
| 58 | 3300046500 | Ga0495596_0037366 | Ga0495596_0037366_35_667 | 210 |
| 59 | 3300046500 | Ga0495596_0040321 | Ga0495596_0040321_57_692 | 210 |
| 60 | 3300046500 | Ga0495596_0119419 | Ga0495596_0119419_371_1003 | 210 |
| 61 | 3300046501 | Ga0495607_0018331 | Ga0495607_0018331_3452_4096 | 210 |
| 62 | 3300046506 | Ga0495583_0003442 | Ga0495583_0003442_10202_10834 | 210 |
| 63 | 3300046506 | Ga0495583_0071289 | Ga0495583_0071289_370_1014 | 210 |
| 64 | 3300046507 | Ga0495606_0019535 | Ga0495606_0019535_1410_2054 | 210 |
| 65 | 3300046513 | Ga0495616_0000560 | Ga0495616_0000560_23157_23789 | 210 |
| 66 | 3300046513 | Ga0495616_0212952 | Ga0495616_0212952_173_817 | 210 |
| 67 | 3300046518 | Ga0495631_0015875 | Ga0495631_0015875_1649_2281 | 210 |
| 68 | 3300046519 | Ga0495632_0043078 | Ga0495632_0043078_690_1334 | 210 |
| 69 | 3300046520 | Ga0495637_0058147 | Ga0495637_0058147_134_766 | 210 |
| 70 | 3300046522 | Ga0495643_0020056 | Ga0495643_0020056_2296_2940 | 210 |
| 71 | 3300046523 | Ga0495644_0039940 | Ga0495644_0039940_760_1404 | 210 |
| 72 | 3300046523 | Ga0495644_0065127 | Ga0495644_0065127_59_691 | 210 |
| 73 | 3300046524 | Ga0495648_0063401 | Ga0495648_0063401_959_1594 | 210 |
| 74 | 3300046525 | Ga0495663_0009171 | Ga0495663_0009171_987_1619 | 210 |
| 75 | 3300046530 | Ga0495654_0012120 | Ga0495654_0012120_3522_4154 | 210 |
| 76 | 3300046538 | Ga0495609_0009516 | Ga0495609_0009516_3447_4082 | 210 |
| 77 | 3300046538 | Ga0495609_0015096 | Ga0495609_0015096_1026_1670 | 210 |
| 78 | 3300046538 | Ga0495609_0019310 | Ga0495609_0019310_1286_1918 | 210 |
| 79 | 3300046542 | Ga0495597_0037394 | Ga0495597_0037394_1023_1667 | 210 |
| 80 | 3300046542 | Ga0495597_0095159 | Ga0495597_0095159_319_951 | 210 |
| 81 | 3300046558 | Ga0495633_0027208 | Ga0495633_0027208_1782_2414 | 210 |
| 82 | 3300046615 | Ga0495656_0015185 | Ga0495656_0015185_1724_2356 | 210 |
| 83 | 3300046615 | Ga0495656_0185722 | Ga0495656_0185722_182_814 | 210 |
| 84 | 3300046648 | Ga0495611_0012224 | Ga0495611_0012224_2925_3569 | 210 |
| 85 | 3300046660 | Ga0495625_0232498 | Ga0495625_0232498_200_844 | 210 |
| 86 | 3300046665 | Ga0495661_0021478 | Ga0495661_0021478_640_1284 | 210 |
| 87 | 3300046665 | Ga0495661_0065619 | Ga0495661_0065619_332_964 | 210 |
| 88 | 3300046665 | Ga0495661_0153647 | Ga0495661_0153647_562_1194 | 210 |
| 89 | 3300046679 | Ga0495623_0168502 | Ga0495623_0168502_368_1003 | 210 |
| 90 | 3300046684 | Ga0495669_0026350 | Ga0495669_0026350_865_1497 | 210 |
| 91 | 3300046684 | Ga0495669_0124042 | Ga0495669_0124042_463_1095 | 210 |
| 92 | 3300046691 | Ga0495670_0009478 | Ga0495670_0009478_577_1209 | 210 |
| 93 | 3300046691 | Ga0495670_0041510 | Ga0495670_0041510_842_1474 | 210 |
| 94 | 3300046692 | Ga0495671_0048978 | Ga0495671_0048978_724_1356 | 210 |
| 95 | 3300046794 | Ga0495589_0028460 | Ga0495589_0028460_536_1180 | 210 |
| 96 | 3300046794 | Ga0495589_0043637 | Ga0495589_0043637_556_1191 | 210 |
| 97 | 3300047317 | Ga0495604_0106229 | Ga0495604_0106229_724_1356 | 210 |
| 98 | 3300047320 | Ga0495672_0004305 | Ga0495672_0004305_10290_10925 | 210 |
| 99 | 3300047320 | Ga0495672_0010682 | Ga0495672_0010682_5274_5906 | 210 |
| 100 | 3300047322 | Ga0495680_0009912 | Ga0495680_0009912_3209_3841 | 210 |
| 101 | 3300047323 | Ga0495683_0010147 | Ga0495683_0010147_3432_4076 | 210 |
| 102 | 3300047323 | Ga0495683_0063703 | Ga0495683_0063703_1126_1761 | 210 |
| 103 | 3300047444 | Ga0495675_0133376 | Ga0495675_0133376_569_1201 | 210 |
| 104 | 3300047445 | Ga0495677_0052415 | Ga0495677_0052415_33_677 | 210 |
| 105 | 3300047447 | Ga0495685_014477 | Ga0495685_014477_1568_2212 | 210 |
| 106 | 3300047447 | Ga0495685_028684 | Ga0495685_028684_650_1282 | 210 |
| 107 | 3300047673 | Ga0495593_0049989 | Ga0495593_0049989_878_1510 | 210 |
| 108 | 3300048089 | Ga0495614_0083237 | Ga0495614_0083237_715_1347 | 210 |
| 109 | 3300048091 | Ga0495626_0001148 | Ga0495626_0001148_18002_18634 | 210 |
| 110 | 3300048091 | Ga0495626_0014027 | Ga0495626_0014027_2299_2943 | 210 |
| 111 | 3300048091 | Ga0495626_0115352 | Ga0495626_0115352_324_956 | 210 |
| 112 | 3300009093 | Ga0105240_10011207 | Ga0105240_1001120713 | 211 |
| 113 | 3300014969 | Ga0157376_10469143 | Ga0157376_104691432 | 211 |
| 114 | 3300025913 | Ga0207695_10061667 | Ga0207695_100616672 | 211 |
| 115 | 3300042139 | Ga0450904_001511 | Ga0450904_001511_2338_2973 | 211 |
| 116 | 3300046452 | Ga0495617_000009 | Ga0495617_000009_59606_60241 | 211 |
| 117 | 3300046453 | Ga0495627_000226 | Ga0495627_000226_57327_57962 | 211 |
| 118 | 3300046453 | Ga0495627_004448 | Ga0495627_004448_740_1375 | 211 |
| 119 | 3300046455 | Ga0495603_0018897 | Ga0495603_0018897_3411_4046 | 211 |
| 120 | 3300046455 | Ga0495603_0185234 | Ga0495603_0185234_123_758 | 211 |
| 121 | 3300046459 | Ga0495629_0047979 | Ga0495629_0047979_921_1556 | 211 |
| 122 | 3300046474 | Ga0495605_0000226 | Ga0495605_0000226_51977_52612 | 211 |
| 123 | 3300046491 | Ga0495584_0012148 | Ga0495584_0012148_3311_3946 | 211 |
| 124 | 3300046491 | Ga0495584_0046972 | Ga0495584_0046972_347_982 | 211 |
| 125 | 3300046491 | Ga0495584_0147181 | Ga0495584_0147181_146_781 | 211 |
| 126 | 3300046492 | Ga0495585_0036536 | Ga0495585_0036536_247_882 | 211 |
| 127 | 3300046492 | Ga0495585_0092959 | Ga0495585_0092959_185_820 | 211 |
| 128 | 3300046492 | Ga0495585_0120606 | Ga0495585_0120606_32_667 | 211 |
| 129 | 3300046499 | Ga0495594_0154214 | Ga0495594_0154214_192_827 | 211 |
| 130 | 3300046500 | Ga0495596_0001321 | Ga0495596_0001321_1421_2056 | 211 |
| 131 | 3300046500 | Ga0495596_0003202 | Ga0495596_0003202_1096_1731 | 211 |
| 132 | 3300046500 | Ga0495596_0003783 | Ga0495596_0003783_3790_4425 | 211 |
| 133 | 3300046501 | Ga0495607_0002485 | Ga0495607_0002485_876_1511 | 211 |
| 134 | 3300046506 | Ga0495583_0000386 | Ga0495583_0000386_65009_65644 | 211 |
| 135 | 3300046506 | Ga0495583_0046082 | Ga0495583_0046082_124_759 | 211 |
| 136 | 3300046513 | Ga0495616_0002627 | Ga0495616_0002627_257_892 | 211 |
| 137 | 3300046518 | Ga0495631_0003158 | Ga0495631_0003158_7483_8118 | 211 |
| 138 | 3300046519 | Ga0495632_0000245 | Ga0495632_0000245_25579_26214 | 211 |
| 139 | 3300046519 | Ga0495632_0009037 | Ga0495632_0009037_5045_5680 | 211 |
| 140 | 3300046519 | Ga0495632_0018925 | Ga0495632_0018925_3044_3679 | 211 |
| 141 | 3300046522 | Ga0495643_0000247 | Ga0495643_0000247_2034_2681 | 211 |
| 142 | 3300046524 | Ga0495648_0002211 | Ga0495648_0002211_383_1018 | 211 |
| 143 | 3300046524 | Ga0495648_0062939 | Ga0495648_0062939_880_1515 | 211 |
| 144 | 3300046525 | Ga0495663_0026897 | Ga0495663_0026897_644_1279 | 211 |
| 145 | 3300046526 | Ga0495666_0038566 | Ga0495666_0038566_864_1499 | 211 |
| 146 | 3300046528 | Ga0495642_0004510 | Ga0495642_0004510_2752_3387 | 211 |
| 147 | 3300046528 | Ga0495642_0016335 | Ga0495642_0016335_2114_2749 | 211 |
| 148 | 3300046538 | Ga0495609_0020346 | Ga0495609_0020346_2363_2998 | 211 |
| 149 | 3300046542 | Ga0495597_0007930 | Ga0495597_0007930_3976_4611 | 211 |
| 150 | 3300046542 | Ga0495597_0021601 | Ga0495597_0021601_19_654 | 211 |
| 151 | 3300046542 | Ga0495597_0031142 | Ga0495597_0031142_31_666 | 211 |
| 152 | 3300046557 | Ga0495622_0177089 | Ga0495622_0177089_141_776 | 211 |
| 153 | 3300046558 | Ga0495633_0008579 | Ga0495633_0008579_2423_3058 | 211 |
| 154 | 3300046558 | Ga0495633_0025451 | Ga0495633_0025451_88_723 | 211 |
| 155 | 3300046615 | Ga0495656_0171307 | Ga0495656_0171307_121_756 | 211 |
| 156 | 3300046616 | Ga0495668_0002491 | Ga0495668_0002491_584_1219 | 211 |
| 157 | 3300046616 | Ga0495668_0084403 | Ga0495668_0084403_224_859 | 211 |
| 158 | 3300046616 | Ga0495668_0160471 | Ga0495668_0160471_244_879 | 211 |
| 159 | 3300046648 | Ga0495611_0003553 | Ga0495611_0003553_3801_4436 | 211 |
| 160 | 3300046648 | Ga0495611_0016926 | Ga0495611_0016926_2365_3000 | 211 |
| 161 | 3300046665 | Ga0495661_0001941 | Ga0495661_0001941_14911_15546 | 211 |
| 162 | 3300046665 | Ga0495661_0012786 | Ga0495661_0012786_2215_2850 | 211 |
| 163 | 3300046665 | Ga0495661_0016044 | Ga0495661_0016044_3035_3670 | 211 |
| 164 | 3300046665 | Ga0495661_0038369 | Ga0495661_0038369_2046_2681 | 211 |
| 165 | 3300046665 | Ga0495661_0054858 | Ga0495661_0054858_209_844 | 211 |
| 166 | 3300046665 | Ga0495661_0083336 | Ga0495661_0083336_1008_1643 | 211 |
| 167 | 3300046665 | Ga0495661_0164442 | Ga0495661_0164442_17_652 | 211 |
| 168 | 3300046674 | Ga0495588_0039045 | Ga0495588_0039045_1088_1723 | 211 |
| 169 | 3300046684 | Ga0495669_0000194 | Ga0495669_0000194_32624_33259 | 211 |
| 170 | 3300046684 | Ga0495669_0001648 | Ga0495669_0001648_2884_3519 | 211 |
| 171 | 3300046684 | Ga0495669_0037092 | Ga0495669_0037092_193_828 | 211 |
| 172 | 3300046691 | Ga0495670_0006999 | Ga0495670_0006999_3989_4624 | 211 |
| 173 | 3300046691 | Ga0495670_0018940 | Ga0495670_0018940_877_1512 | 211 |
| 174 | 3300046691 | Ga0495670_0037573 | Ga0495670_0037573_744_1379 | 211 |
| 175 | 3300046691 | Ga0495670_0046737 | Ga0495670_0046737_1286_1921 | 211 |
| 176 | 3300046692 | Ga0495671_0001102 | Ga0495671_0001102_983_1618 | 211 |
| 177 | 3300046692 | Ga0495671_0031971 | Ga0495671_0031971_410_1045 | 211 |
| 178 | 3300046794 | Ga0495589_0027729 | Ga0495589_0027729_574_1209 | 211 |
| 179 | 3300046794 | Ga0495589_0094227 | Ga0495589_0094227_799_1434 | 211 |
| 180 | 3300046810 | Ga0495660_0152372 | Ga0495660_0152372_417_1052 | 211 |
| 181 | 3300047318 | Ga0495636_0038240 | Ga0495636_0038240_710_1345 | 211 |
| 182 | 3300047320 | Ga0495672_0003246 | Ga0495672_0003246_9000_9635 | 211 |
| 183 | 3300047443 | Ga0495687_008911 | Ga0495687_008911_601_1236 | 211 |
| 184 | 3300047445 | Ga0495677_0001050 | Ga0495677_0001050_936_1571 | 211 |
| 185 | 3300047445 | Ga0495677_0005253 | Ga0495677_0005253_4225_4860 | 211 |
| 186 | 3300047445 | Ga0495677_0031965 | Ga0495677_0031965_639_1274 | 211 |
| 187 | 3300047445 | Ga0495677_0060656 | Ga0495677_0060656_596_1231 | 211 |
| 188 | 3300047470 | Ga0495681_0000515 | Ga0495681_0000515_15915_16550 | 211 |
| 189 | 3300047470 | Ga0495681_0013839 | Ga0495681_0013839_3959_4594 | 211 |
| 190 | 3300047470 | Ga0495681_0086611 | Ga0495681_0086611_410_1045 | 211 |
| 191 | 3300047472 | Ga0495686_0063245 | Ga0495686_0063245_1617_2252 | 211 |
| 192 | 3300048089 | Ga0495614_0027641 | Ga0495614_0027641_878_1513 | 211 |
| 193 | 3300048091 | Ga0495626_0020927 | Ga0495626_0020927_2598_3233 | 211 |
| 194 | 3300048905 | Ga0496102_0000285 | Ga0496102_0000285_56186_56821 | 211 |
| 195 | 3300048910 | Ga0496107_0357106 | Ga0496107_0357106_440_1075 | 211 |
| 196 | 3300048913 | Ga0496110_0000403 | Ga0496110_0000403_21226_21861 | 211 |
| 197 | 3300048914 | Ga0496111_0160477 | Ga0496111_0160477_160_795 | 211 |
| 198 | 3300049459 | Ga0495678_011000 | Ga0495678_011000_1278_1913 | 211 |
| 199 | 3300005262 | Ga0065165_1005668 | Ga0065165_10056687 | 212 |
| 200 | 3300037312 | Ga0395899_0000378 | Ga0395899_0000378_47843_48481 | 212 |
| 201 | 3300046452 | Ga0495617_000743 | Ga0495617_000743_1672_2310 | 212 |
| 202 | 3300046457 | Ga0495590_0108335 | Ga0495590_0108335_94_732 | 212 |
| 203 | 3300046463 | Ga0495653_0028287 | Ga0495653_0028287_1371_2009 | 212 |
| 204 | 3300046472 | Ga0495580_0230951 | Ga0495580_0230951_168_806 | 212 |
| 205 | 3300046473 | Ga0495582_0021530 | Ga0495582_0021530_2541_3179 | 212 |
| 206 | 3300046474 | Ga0495605_0012454 | Ga0495605_0012454_793_1431 | 212 |
| 207 | 3300046474 | Ga0495605_0077397 | Ga0495605_0077397_712_1350 | 212 |
| 208 | 3300046491 | Ga0495584_0029808 | Ga0495584_0029808_1238_1876 | 212 |
| 209 | 3300046491 | Ga0495584_0041320 | Ga0495584_0041320_441_1079 | 212 |
| 210 | 3300046491 | Ga0495584_0083101 | Ga0495584_0083101_237_875 | 212 |
| 211 | 3300046491 | Ga0495584_0194642 | Ga0495584_0194642_255_893 | 212 |
| 212 | 3300046492 | Ga0495585_0000010 | Ga0495585_0000010_49879_50517 | 212 |
| 213 | 3300046492 | Ga0495585_0000909 | Ga0495585_0000909_169_807 | 212 |
| 214 | 3300046492 | Ga0495585_0002720 | Ga0495585_0002720_8014_8655 | 212 |
| 215 | 3300046492 | Ga0495585_0041517 | Ga0495585_0041517_793_1431 | 212 |
| 216 | 3300046492 | Ga0495585_0063831 | Ga0495585_0063831_169_807 | 212 |
| 217 | 3300046492 | Ga0495585_0091317 | Ga0495585_0091317_829_1467 | 212 |
| 218 | 3300046492 | Ga0495585_0091811 | Ga0495585_0091811_550_1188 | 212 |
| 219 | 3300046492 | Ga0495585_0148742 | Ga0495585_0148742_133_771 | 212 |
| 220 | 3300046492 | Ga0495585_0172600 | Ga0495585_0172600_113_751 | 212 |
| 221 | 3300046499 | Ga0495594_0006627 | Ga0495594_0006627_3946_4587 | 212 |
| 222 | 3300046499 | Ga0495594_0016932 | Ga0495594_0016932_2545_3183 | 212 |
| 223 | 3300046500 | Ga0495596_0001392 | Ga0495596_0001392_2360_2998 | 212 |
| 224 | 3300046501 | Ga0495607_0008004 | Ga0495607_0008004_744_1382 | 212 |
| 225 | 3300046501 | Ga0495607_0023472 | Ga0495607_0023472_68_706 | 212 |
| 226 | 3300046506 | Ga0495583_0001015 | Ga0495583_0001015_26474_27112 | 212 |
| 227 | 3300046506 | Ga0495583_0044056 | Ga0495583_0044056_1150_1788 | 212 |
| 228 | 3300046507 | Ga0495606_0081373 | Ga0495606_0081373_525_1163 | 212 |
| 229 | 3300046507 | Ga0495606_0108546 | Ga0495606_0108546_756_1394 | 212 |
| 230 | 3300046507 | Ga0495606_0155534 | Ga0495606_0155534_221_859 | 212 |
| 231 | 3300046513 | Ga0495616_0001569 | Ga0495616_0001569_14651_15289 | 212 |
| 232 | 3300046513 | Ga0495616_0013905 | Ga0495616_0013905_367_1005 | 212 |
| 233 | 3300046513 | Ga0495616_0021120 | Ga0495616_0021120_921_1559 | 212 |
| 234 | 3300046515 | Ga0495620_0002294 | Ga0495620_0002294_3043_3681 | 212 |
| 235 | 3300046517 | Ga0495630_0168449 | Ga0495630_0168449_980_1618 | 212 |
| 236 | 3300046518 | Ga0495631_0005612 | Ga0495631_0005612_630_1268 | 212 |
| 237 | 3300046518 | Ga0495631_0055284 | Ga0495631_0055284_736_1374 | 212 |
| 238 | 3300046518 | Ga0495631_0071464 | Ga0495631_0071464_10_651 | 212 |
| 239 | 3300046519 | Ga0495632_0032431 | Ga0495632_0032431_1513_2151 | 212 |
| 240 | 3300046519 | Ga0495632_0112908 | Ga0495632_0112908_620_1258 | 212 |
| 241 | 3300046524 | Ga0495648_0000003 | Ga0495648_0000003_179442_180080 | 212 |
| 242 | 3300046524 | Ga0495648_0021627 | Ga0495648_0021627_3391_4029 | 212 |
| 243 | 3300046524 | Ga0495648_0079098 | Ga0495648_0079098_213_851 | 212 |
| 244 | 3300046526 | Ga0495666_0010165 | Ga0495666_0010165_893_1531 | 212 |
| 245 | 3300046526 | Ga0495666_0014365 | Ga0495666_0014365_984_1625 | 212 |
| 246 | 3300046528 | Ga0495642_0030580 | Ga0495642_0030580_959_1597 | 212 |
| 247 | 3300046531 | Ga0495665_0016990 | Ga0495665_0016990_899_1540 | 212 |
| 248 | 3300046535 | Ga0495586_0122930 | Ga0495586_0122930_371_1012 | 212 |
| 249 | 3300046535 | Ga0495586_0175730 | Ga0495586_0175730_83_721 | 212 |
| 250 | 3300046538 | Ga0495609_0008421 | Ga0495609_0008421_840_1478 | 212 |
| 251 | 3300046542 | Ga0495597_0000619 | Ga0495597_0000619_21707_22345 | 212 |
| 252 | 3300046542 | Ga0495597_0007720 | Ga0495597_0007720_3030_3668 | 212 |
| 253 | 3300046542 | Ga0495597_0036688 | Ga0495597_0036688_624_1262 | 212 |
| 254 | 3300046542 | Ga0495597_0245027 | Ga0495597_0245027_14_652 | 212 |
| 255 | 3300046557 | Ga0495622_0087070 | Ga0495622_0087070_667_1305 | 212 |
| 256 | 3300046558 | Ga0495633_0004197 | Ga0495633_0004197_8398_9036 | 212 |
| 257 | 3300046558 | Ga0495633_0031320 | Ga0495633_0031320_354_992 | 212 |
| 258 | 3300046648 | Ga0495611_0005966 | Ga0495611_0005966_3876_4517 | 212 |
| 259 | 3300046648 | Ga0495611_0009366 | Ga0495611_0009366_2853_3491 | 212 |
| 260 | 3300046663 | Ga0495635_0417508 | Ga0495635_0417508_53_691 | 212 |
| 261 | 3300046665 | Ga0495661_0050930 | Ga0495661_0050930_1416_2054 | 212 |
| 262 | 3300046665 | Ga0495661_0059872 | Ga0495661_0059872_707_1345 | 212 |
| 263 | 3300046665 | Ga0495661_0109230 | Ga0495661_0109230_835_1524 | 212 |
| 264 | 3300046674 | Ga0495588_0170585 | Ga0495588_0170585_362_1003 | 212 |
| 265 | 3300046684 | Ga0495669_0008045 | Ga0495669_0008045_1009_1650 | 212 |
| 266 | 3300046684 | Ga0495669_0061437 | Ga0495669_0061437_626_1264 | 212 |
| 267 | 3300046689 | Ga0495613_0270875 | Ga0495613_0270875_404_1042 | 212 |
| 268 | 3300046691 | Ga0495670_0015671 | Ga0495670_0015671_2602_3240 | 212 |
| 269 | 3300046691 | Ga0495670_0041914 | Ga0495670_0041914_1486_2124 | 212 |
| 270 | 3300046691 | Ga0495670_0301740 | Ga0495670_0301740_47_685 | 212 |
| 271 | 3300046694 | Ga0495649_0076989 | Ga0495649_0076989_665_1303 | 212 |
| 272 | 3300046794 | Ga0495589_0006540 | Ga0495589_0006540_2154_2792 | 212 |
| 273 | 3300046810 | Ga0495660_0087178 | Ga0495660_0087178_901_1539 | 212 |
| 274 | 3300046810 | Ga0495660_0131463 | Ga0495660_0131463_431_1072 | 212 |
| 275 | 3300047320 | Ga0495672_0113730 | Ga0495672_0113730_407_1045 | 212 |
| 276 | 3300047321 | Ga0495676_0118262 | Ga0495676_0118262_530_1168 | 212 |
| 277 | 3300047321 | Ga0495676_0243167 | Ga0495676_0243167_421_1059 | 212 |
| 278 | 3300047323 | Ga0495683_0000177 | Ga0495683_0000177_8147_8785 | 212 |
| 279 | 3300047323 | Ga0495683_0077588 | Ga0495683_0077588_70_708 | 212 |
| 280 | 3300047443 | Ga0495687_002319 | Ga0495687_002319_11722_12405 | 212 |
| 281 | 3300047443 | Ga0495687_143825 | Ga0495687_143825_153_791 | 212 |
| 282 | 3300047444 | Ga0495675_0062316 | Ga0495675_0062316_515_1156 | 212 |
| 283 | 3300047445 | Ga0495677_0005875 | Ga0495677_0005875_1189_1827 | 212 |
| 284 | 3300047445 | Ga0495677_0014665 | Ga0495677_0014665_1663_2301 | 212 |
| 285 | 3300047469 | Ga0495673_0002276 | Ga0495673_0002276_5644_6282 | 212 |
| 286 | 3300047470 | Ga0495681_0041109 | Ga0495681_0041109_1236_1874 | 212 |
| 287 | 3300047470 | Ga0495681_0052657 | Ga0495681_0052657_1195_1866 | 212 |
| 288 | 3300047472 | Ga0495686_0007279 | Ga0495686_0007279_2527_3165 | 212 |
| 289 | 3300047673 | Ga0495593_0035261 | Ga0495593_0035261_220_858 | 212 |
| 290 | 3300048088 | Ga0495602_0102129 | Ga0495602_0102129_863_1504 | 212 |
| 291 | 3300048091 | Ga0495626_0003185 | Ga0495626_0003185_560_1198 | 212 |
| 292 | 3300048091 | Ga0495626_0013539 | Ga0495626_0013539_1980_2618 | 212 |
| 293 | 3300048091 | Ga0495626_0018975 | Ga0495626_0018975_1809_2498 | 212 |
| 294 | 3300048091 | Ga0495626_0023891 | Ga0495626_0023891_2152_2793 | 212 |
| 295 | 3300048091 | Ga0495626_0028062 | Ga0495626_0028062_75_713 | 212 |
| 296 | 3300048091 | Ga0495626_0055098 | Ga0495626_0055098_872_1585 | 212 |
| 297 | 3300048091 | Ga0495626_0059941 | Ga0495626_0059941_799_1437 | 212 |
| 298 | 3300048091 | Ga0495626_0081717 | Ga0495626_0081717_665_1303 | 212 |
| 299 | 3300048091 | Ga0495626_0085893 | Ga0495626_0085893_329_967 | 212 |
| 300 | 3300048091 | Ga0495626_0151978 | Ga0495626_0151978_78_716 | 212 |
| 301 | 3300048918 | Ga0496115_0027507 | Ga0496115_0027507_2022_2672 | 212 |
| 302 | 3300049460 | Ga0495682_0015922 | Ga0495682_0015922_706_1344 | 212 |
| 303 | 3300037471 | Ga0395905_0108061 | Ga0395905_0108061_993_1634 | 213 |
| 304 | 3300037471 | Ga0395905_0526542 | Ga0395905_0526542_272_916 | 213 |
| 305 | 3300038443 | Ga0395901_0402559 | Ga0395901_0402559_545_1186 | 213 |
| 306 | 3300046455 | Ga0495603_0177594 | Ga0495603_0177594_207_851 | 213 |
| 307 | 3300046457 | Ga0495590_0000054 | Ga0495590_0000054_1054_1698 | 213 |
| 308 | 3300046458 | Ga0495591_005672 | Ga0495591_005672_1026_1670 | 213 |
| 309 | 3300046473 | Ga0495582_0056040 | Ga0495582_0056040_645_1289 | 213 |
| 310 | 3300046474 | Ga0495605_0024093 | Ga0495605_0024093_852_1496 | 213 |
| 311 | 3300046474 | Ga0495605_0039968 | Ga0495605_0039968_694_1338 | 213 |
| 312 | 3300046491 | Ga0495584_0007186 | Ga0495584_0007186_3954_4598 | 213 |
| 313 | 3300046491 | Ga0495584_0028477 | Ga0495584_0028477_1486_2136 | 213 |
| 314 | 3300046491 | Ga0495584_0048846 | Ga0495584_0048846_1159_1803 | 213 |
| 315 | 3300046500 | Ga0495596_0093337 | Ga0495596_0093337_73_714 | 213 |
| 316 | 3300046501 | Ga0495607_0083136 | Ga0495607_0083136_323_967 | 213 |
| 317 | 3300046506 | Ga0495583_0000482 | Ga0495583_0000482_3448_4092 | 213 |
| 318 | 3300046506 | Ga0495583_0014380 | Ga0495583_0014380_1209_1850 | 213 |
| 319 | 3300046506 | Ga0495583_0042349 | Ga0495583_0042349_176_817 | 213 |
| 320 | 3300046507 | Ga0495606_0063854 | Ga0495606_0063854_629_1270 | 213 |
| 321 | 3300046507 | Ga0495606_0077174 | Ga0495606_0077174_639_1283 | 213 |
| 322 | 3300046512 | Ga0495610_0007702 | Ga0495610_0007702_3996_4640 | 213 |
| 323 | 3300046513 | Ga0495616_0000374 | Ga0495616_0000374_11951_12592 | 213 |
| 324 | 3300046513 | Ga0495616_0022169 | Ga0495616_0022169_1161_1802 | 213 |
| 325 | 3300046513 | Ga0495616_0171948 | Ga0495616_0171948_262_906 | 213 |
| 326 | 3300046518 | Ga0495631_0000168 | Ga0495631_0000168_26337_26978 | 213 |
| 327 | 3300046518 | Ga0495631_0007454 | Ga0495631_0007454_1810_2454 | 213 |
| 328 | 3300046518 | Ga0495631_0015801 | Ga0495631_0015801_526_1167 | 213 |
| 329 | 3300046518 | Ga0495631_0067639 | Ga0495631_0067639_459_1100 | 213 |
| 330 | 3300046518 | Ga0495631_0199081 | Ga0495631_0199081_148_792 | 213 |
| 331 | 3300046520 | Ga0495637_0000012 | Ga0495637_0000012_232531_233175 | 213 |
| 332 | 3300046522 | Ga0495643_0016364 | Ga0495643_0016364_2781_3425 | 213 |
| 333 | 3300046522 | Ga0495643_0104952 | Ga0495643_0104952_375_1016 | 213 |
| 334 | 3300046523 | Ga0495644_0028957 | Ga0495644_0028957_1050_1694 | 213 |
| 335 | 3300046524 | Ga0495648_0066417 | Ga0495648_0066417_217_858 | 213 |
| 336 | 3300046524 | Ga0495648_0173562 | Ga0495648_0173562_253_894 | 213 |
| 337 | 3300046528 | Ga0495642_0032827 | Ga0495642_0032827_1066_1710 | 213 |
| 338 | 3300046538 | Ga0495609_0052198 | Ga0495609_0052198_587_1228 | 213 |
| 339 | 3300046538 | Ga0495609_0112857 | Ga0495609_0112857_436_1080 | 213 |
| 340 | 3300046538 | Ga0495609_0139489 | Ga0495609_0139489_211_855 | 213 |
| 341 | 3300046538 | Ga0495609_0255956 | Ga0495609_0255956_53_694 | 213 |
| 342 | 3300046557 | Ga0495622_0063310 | Ga0495622_0063310_807_1448 | 213 |
| 343 | 3300046558 | Ga0495633_0023703 | Ga0495633_0023703_1708_2352 | 213 |
| 344 | 3300046616 | Ga0495668_0000346 | Ga0495668_0000346_5556_6197 | 213 |
| 345 | 3300046664 | Ga0495659_0116171 | Ga0495659_0116171_49_693 | 213 |
| 346 | 3300046674 | Ga0495588_0053876 | Ga0495588_0053876_323_967 | 213 |
| 347 | 3300046674 | Ga0495588_0122582 | Ga0495588_0122582_195_836 | 213 |
| 348 | 3300046689 | Ga0495613_0179168 | Ga0495613_0179168_134_778 | 213 |
| 349 | 3300046692 | Ga0495671_0015646 | Ga0495671_0015646_963_1604 | 213 |
| 350 | 3300046694 | Ga0495649_0000115 | Ga0495649_0000115_41614_42258 | 213 |
| 351 | 3300046794 | Ga0495589_0037819 | Ga0495589_0037819_1007_1651 | 213 |
| 352 | 3300046794 | Ga0495589_0060769 | Ga0495589_0060769_931_1575 | 213 |
| 353 | 3300047315 | Ga0495581_0192326 | Ga0495581_0192326_232_876 | 213 |
| 354 | 3300047318 | Ga0495636_0204193 | Ga0495636_0204193_47_688 | 213 |
| 355 | 3300047318 | Ga0495636_0357326 | Ga0495636_0357326_37_678 | 213 |
| 356 | 3300047320 | Ga0495672_0000124 | Ga0495672_0000124_4160_4804 | 213 |
| 357 | 3300047320 | Ga0495672_0072487 | Ga0495672_0072487_388_1032 | 213 |
| 358 | 3300047321 | Ga0495676_0000040 | Ga0495676_0000040_59268_59909 | 213 |
| 359 | 3300047323 | Ga0495683_0000158 | Ga0495683_0000158_3933_4577 | 213 |
| 360 | 3300047323 | Ga0495683_0050363 | Ga0495683_0050363_67_708 | 213 |
| 361 | 3300047445 | Ga0495677_0001875 | Ga0495677_0001875_5849_6493 | 213 |
| 362 | 3300047446 | Ga0495679_007400 | Ga0495679_007400_3729_4373 | 213 |
| 363 | 3300047446 | Ga0495679_039747 | Ga0495679_039747_568_1212 | 213 |
| 364 | 3300047470 | Ga0495681_0013920 | Ga0495681_0013920_3238_3879 | 213 |
| 365 | 3300047470 | Ga0495681_0051143 | Ga0495681_0051143_1251_1892 | 213 |
| 366 | 3300047472 | Ga0495686_0065968 | Ga0495686_0065968_992_1636 | 213 |
| 367 | 3300048091 | Ga0495626_0016371 | Ga0495626_0016371_1459_2103 | 213 |
| 368 | 3300048091 | Ga0495626_0023929 | Ga0495626_0023929_226_867 | 213 |
| 369 | 3300048091 | Ga0495626_0153737 | Ga0495626_0153737_15_656 | 213 |
| 370 | 3300048906 | Ga0496103_0055104 | Ga0496103_0055104_143_784 | 213 |
| 371 | 3300048906 | Ga0496103_0065418 | Ga0496103_0065418_316_957 | 213 |
| 372 | 3300048918 | Ga0496115_0078393 | Ga0496115_0078393_425_1066 | 213 |
| 373 | 3300048928 | Ga0496125_0004366 | Ga0496125_0004366_5472_6140 | 213 |
| 374 | 3300049459 | Ga0495678_000144 | Ga0495678_000144_79469_80113 | 213 |
| 375 | 3300049459 | Ga0495678_000844 | Ga0495678_000844_4522_5163 | 213 |
| 376 | 3300049459 | Ga0495678_006701 | Ga0495678_006701_2443_3084 | 213 |
| 377 | 3300049460 | Ga0495682_0009836 | Ga0495682_0009836_906_1547 | 213 |
| 378 | 3300048905 | Ga0496102_0192580 | Ga0496102_0192580_992_1636 | 214 |
| 379 | 3300048906 | Ga0496103_0133406 | Ga0496103_0133406_803_1447 | 214 |
| 380 | 3300048907 | Ga0496104_0189478 | Ga0496104_0189478_419_1063 | 214 |
| 381 | 3300048908 | Ga0496105_0178623 | Ga0496105_0178623_451_1095 | 214 |
| 382 | 3300048910 | Ga0496107_0135535 | Ga0496107_0135535_204_848 | 214 |
| 383 | 3300048914 | Ga0496111_0041010 | Ga0496111_0041010_623_1267 | 214 |
| 384 | 3300044658 | Ga0466972_0085221 | Ga0466972_0085221_206_853 | 215 |
| 385 | 3300044684 | Ga0466966_0008752 | Ga0466966_0008752_3878_4525 | 215 |
| 386 | 3300037312 | Ga0395899_0011225 | Ga0395899_0011225_4594_5244 | 216 |
| 387 | 3300037418 | Ga0395900_0100455 | Ga0395900_0100455_1422_2078 | 216 |
| 388 | 3300037471 | Ga0395905_0210785 | Ga0395905_0210785_968_1618 | 216 |
| 389 | 3300038443 | Ga0395901_0211091 | Ga0395901_0211091_84_734 | 216 |
| 390 | 3300038443 | Ga0395901_0941881 | Ga0395901_0941881_91_747 | 216 |
| 391 | 3300049823 | Ga0501044_0473570 | Ga0501044_0473570_67_720 | 216 |
| 392 | 3300059513 | Ga0587094_020655 | Ga0587094_020655_256_906 | 216 |
| 393 | 3300059623 | Ga0587101_020336 | Ga0587101_020336_255_905 | 216 |
| 394 | 3300059645 | Ga0587076_034410 | Ga0587076_034410_94_744 | 216 |
| 395 | iso_pu_bacteria | 2511231003 | 2511250625 | 216 |
| 396 | 3300037312 | Ga0395899_0007222 | Ga0395899_0007222_7369_8064 | 218 |
| 397 | 3300037312 | Ga0395899_0013403 | Ga0395899_0013403_4945_5631 | 218 |
| 398 | 3300037466 | Ga0395898_0890294 | Ga0395898_0890294_30_725 | 218 |
| 399 | 3300038443 | Ga0395901_0019285 | Ga0395901_0019285_1980_2675 | 218 |
| 400 | 3300002704 | JGI25155J39150_1000186 | JGI25155J39150_100018613 | 220 |
| 401 | 3300002705 | JGI25156J39149_1013802 | JGI25156J39149_10138022 | 220 |
| 402 | 3300002738 | JGI25154J39366_1000504 | JGI25154J39366_10005047 | 220 |
| 403 | 3300025206 | Ga0209435_100200 | Ga0209435_10020015 | 220 |
| 404 | 3300025256 | Ga0209759_1000520 | Ga0209759_100052024 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2w7q-assembly1.cif.gz_A | structure of pseudomonas aeruginosa lola | 0.874 | 35 | 220 |
| 4ki3-assembly4.cif.gz_J | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.8682 | 37 | 219 |
| 8orn-assembly2.cif.gz_C | crystal structure of xanthomonas campestris pv. campestris lola-lolb complex | 0.8678 | 35 | 220 |
| 4ki3-assembly3.cif.gz_I | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.8672 | 37 | 219 |
| 2w7q-assembly2.cif.gz_B | structure of pseudomonas aeruginosa lola | 0.8661 | 35 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2w7qB00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8661 | 35 | 220 | 2.50.20.10 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.86 | 37 | 219 | 2.50.20.10 |
| 2w7qB00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8529 | 35 | 220 | 2.50.20.10 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8336 | 37 | 219 | 2.50.20.10 |
| af_Q3Y3Z9_160_298_3.40.630.90 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; | 0.7747 | 163 | 181 | 3.40.630.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E4L6Y9-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.9582 | 30 | 220 |
GO:0030288
GO:0042953 GO:0044874 |
| AF-A0A2M7J2S5-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9493 | 83 | 220 |
|
| AF-A0A1F4BUG3-F1-model_v4 | deleted | 0.9484 | 49 | 220 |
|
| AF-A0A1E4L6Y9-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.9484 | 30 | 220 |
GO:0030288
GO:0042953 GO:0044874 |
| AF-A0A3B9PLS1-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.94 | 36 | 220 |
GO:0042597
GO:0042953 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar