F435677

General Info

Members Datasets Scaffolds Average Seq Length
404 219 808 165

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10019390|Ga0213876_100193905
Length 182
Sequence MGRFLFSKSAAYARLLVLLLLAQLIVFFNGCAGYHIGPIQPTPMRGVKTIAVGTFKNATLIPRIEVLITDTVIRQIQQDGTYQIAPEDKADAVLTGEIERVRRSPSRSVVGNVIATAEFTMDLTIHYTVRRRDNGLVVQNTSATGQTNFFVSGDVNQDERQAIPLAAEDAAVRLVSQISEGW

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 8.66
Rhizosphere 86.63
Stem 0
Stem Tuber 0
Unclassified 20.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10019390 3300021384 Bacteria 3593
2 JGI24035J26624_1000486 3300002126 Unclassified 3704
3 Ga0065704_10016812 3300005289 Bacteria 2574
4 Ga0065712_10001994 3300005290 Bacteria 8060
5 Ga0065712_10023150 3300005290 Unclassified 1330
6 Ga0065715_10001936 3300005293 Bacteria 7793
7 Ga0065715_10002587 3300005293 Bacteria 7483
8 Ga0065715_10007703 3300005293 Bacteria 7863
9 Ga0065715_10220346 3300005293 Bacteria 1274
10 Ga0065707_10240053 3300005295 Unclassified 1159
11 Ga0070676_10018547 3300005328 Bacteria 3858
12 Ga0070683_100018602 3300005329 Bacteria 6157
13 Ga0070683_100210452 3300005329 Bacteria 1847
14 Ga0070670_100582844 3300005331 Unclassified 1000
15 Ga0070666_10115562 3300005335 Bacteria 1858
16 Ga0070666_11008654 3300005335 Unclassified 617
17 Ga0068868_100476517 3300005338 Bacteria 1089
18 Ga0070689_100000681 3300005340 Bacteria 20637
19 Ga0070687_100461546 3300005343 Unclassified 847
20 Ga0070661_100235264 3300005344 Bacteria 1409
21 Ga0070661_100267963 3300005344 Bacteria 1322
22 Ga0070668_100007553 3300005347 Bacteria 8069
23 Ga0070669_100008646 3300005353 Bacteria 7264
24 Ga0070669_100218707 3300005353 Bacteria 1505
25 Ga0070675_100001807 3300005354 Bacteria 15816
26 Ga0070675_100006933 3300005354 Bacteria 8701
27 Ga0070675_100074328 3300005354 Bacteria 2823
28 Ga0070675_100514939 3300005354 Bacteria 1079
29 Ga0070671_100044963 3300005355 Bacteria 3669
30 Ga0070671_100524799 3300005355 Bacteria 1020
31 Ga0070674_100117421 3300005356 Bacteria 1964
32 Ga0070688_100009073 3300005365 Bacteria 5423
33 Ga0070688_100064712 3300005365 Bacteria 2321
34 Ga0070688_100103972 3300005365 Bacteria 1877
35 Ga0070688_100127575 3300005365 Bacteria 1712
36 Ga0070688_101075131 3300005365 Unclassified 642
37 Ga0070659_100000778 3300005366 Bacteria 23158
38 Ga0070659_100049458 3300005366 Bacteria 3306
39 Ga0070667_100429997 3300005367 Unclassified 1204
40 Ga0070703_10012594 3300005406 Bacteria 2397
41 Ga0070714_100024622 3300005435 Bacteria 4960
42 Ga0070713_101689952 3300005436 Unclassified 614
43 Ga0070710_10191099 3300005437 Bacteria 1288
44 Ga0070711_100200831 3300005439 Unclassified 1538
45 Ga0070711_100213626 3300005439 Bacteria 1495
46 Ga0070711_100783481 3300005439 Unclassified 808
47 Ga0070708_100216176 3300005445 Bacteria 1797
48 Ga0070708_100606594 3300005445 Unclassified 1032
49 Ga0070678_100084798 3300005456 Bacteria 2412
50 Ga0070678_100138432 3300005456 Bacteria 1944
51 Ga0070678_100162192 3300005456 Unclassified 1812
52 Ga0070662_100005856 3300005457 Bacteria 7890
53 Ga0070662_100021820 3300005457 Bacteria 4377
54 Ga0070662_100080242 3300005457 Bacteria 2428
55 Ga0070681_10028964 3300005458 Bacteria 5562
56 Ga0068867_100133829 3300005459 Bacteria 1930
57 Ga0070685_10088040 3300005466 Bacteria 1875
58 Ga0070685_10169864 3300005466 Bacteria 1397
59 Ga0070706_100000012 3300005467 Bacteria 195040
60 Ga0070706_100007637 3300005467 Bacteria 10116
61 Ga0070706_100007749 3300005467 Bacteria 10040
62 Ga0070706_100024766 3300005467 Bacteria 5524
63 Ga0070706_100036826 3300005467 Bacteria 4519
64 Ga0070706_100044108 3300005467 Bacteria 4119
65 Ga0070706_100072365 3300005467 Unclassified 3190
66 Ga0070706_100438679 3300005467 Bacteria 1215
67 Ga0070707_100000171 3300005468 Bacteria 63131
68 Ga0070707_100002533 3300005468 Bacteria 17381
69 Ga0070707_100009190 3300005468 Bacteria 9169
70 Ga0070707_100018503 3300005468 Bacteria 6554
71 Ga0070707_100034464 3300005468 Unclassified 4828
72 Ga0070707_100307817 3300005468 Unclassified 1540
73 Ga0070707_100406006 3300005468 Bacteria 1322
74 Ga0070707_100680421 3300005468 Bacteria 991
75 Ga0070698_100004632 3300005471 Bacteria 15113
76 Ga0070698_100006241 3300005471 Bacteria 12968
77 Ga0070698_100042963 3300005471 Bacteria 4636
78 Ga0070698_100088594 3300005471 Bacteria 3080
79 Ga0070698_100109891 3300005471 Unclassified 2723
80 Ga0070698_100532204 3300005471 Unclassified 1114
81 Ga0070699_100018307 3300005518 Bacteria 6019
82 Ga0070699_100258288 3300005518 Bacteria 1558
83 Ga0070699_100687426 3300005518 Bacteria 934
84 Ga0070699_100834302 3300005518 Bacteria 844
85 Ga0070684_100000434 3300005535 Bacteria 28740
86 Ga0070684_100024143 3300005535 Bacteria 5097
87 Ga0070697_100001418 3300005536 Bacteria 18201
88 Ga0070697_100076997 3300005536 Bacteria 2743
89 Ga0070697_100081568 3300005536 Unclassified 2665
90 Ga0070697_100114185 3300005536 Bacteria 2253
91 Ga0070697_100116326 3300005536 Bacteria 2233
92 Ga0070697_100148717 3300005536 Unclassified 1973
93 Ga0070697_100572218 3300005536 Bacteria 992
94 Ga0068853_100000044 3300005539 Bacteria 100605
95 Ga0070672_100005886 3300005543 Bacteria 8180
96 Ga0070686_100007931 3300005544 Bacteria 5935
97 Ga0070686_100025700 3300005544 Bacteria 3545
98 Ga0070695_100120132 3300005545 Unclassified 1797
99 Ga0070696_100038309 3300005546 Bacteria 3308
100 Ga0070693_100014269 3300005547 Bacteria 4068
101 Ga0070693_100395507 3300005547 Bacteria 957
102 Ga0070665_100035997 3300005548 Bacteria 4980
103 Ga0070665_100036111 3300005548 Bacteria 4973
104 Ga0070665_100179424 3300005548 Bacteria 2118
105 Ga0070665_100358859 3300005548 Bacteria 1463
106 Ga0070665_100445959 3300005548 Bacteria 1304
107 Ga0070704_100028526 3300005549 Bacteria 3715
108 Ga0068855_100282391 3300005563 Bacteria 1843
109 Ga0068855_100433113 3300005563 Bacteria 1437
110 Ga0068855_100864885 3300005563 Unclassified 957
111 Ga0070664_100242675 3300005564 Bacteria 1617
112 Ga0068856_100053957 3300005614 Bacteria 3964
113 Ga0068852_100766092 3300005616 Unclassified 978
114 Ga0068859_100023527 3300005617 Bacteria 6181
115 Ga0068864_100128118 3300005618 Bacteria 2277
116 Ga0068864_101571793 3300005618 Unclassified 661
117 Ga0068866_10681967 3300005718 Bacteria 703
118 Ga0068861_100101220 3300005719 Bacteria 2292
119 Ga0068863_100100955 3300005841 Bacteria 2743
120 Ga0068860_100717411 3300005843 Unclassified 1010
121 Ga0081455_10002693 3300005937 Bacteria 20986
122 Ga0081455_10003329 3300005937 Bacteria 18535
123 Ga0081455_10037465 3300005937 Bacteria 4306
124 Ga0081455_10078158 3300005937 Unclassified 2720
125 Ga0081540_1000368 3300005983 Bacteria 45151
126 Ga0081540_1051535 3300005983 Bacteria 2034
127 Ga0070717_10010820 3300006028 Bacteria 6902
128 Ga0070717_10020000 3300006028 Bacteria 5258
129 Ga0070717_10025240 3300006028 Bacteria 4724
130 Ga0070717_10026280 3300006028 Bacteria 4643
131 Ga0070717_10088496 3300006028 Bacteria 2610
132 Ga0070717_10407014 3300006028 Bacteria 1223
133 Ga0070717_10685802 3300006028 Bacteria 930
134 Ga0075363_100406140 3300006048 Unclassified 801
135 Ga0070715_10004923 3300006163 Bacteria 4425
136 Ga0070715_10009316 3300006163 Bacteria 3458
137 Ga0070716_100043592 3300006173 Bacteria 2509
138 Ga0070716_100058735 3300006173 Bacteria 2214
139 Ga0070716_100136021 3300006173 Unclassified 1561
140 Ga0070712_100037553 3300006175 Bacteria 3303
141 Ga0070712_100245528 3300006175 Unclassified 1428
142 Ga0075362_10016526 3300006177 Bacteria 3023
143 Ga0075366_10008058 3300006195 Bacteria 5838
144 Ga0075370_10265555 3300006353 Unclassified 1018
145 Ga0068871_100068921 3300006358 Bacteria 2905
146 Ga0068871_100220045 3300006358 Unclassified 1645
147 Ga0075434_100397887 3300006871 Bacteria 1398
148 Ga0075434_100637041 3300006871 Bacteria 1085
149 Ga0068865_100334219 3300006881 Bacteria 1222
150 Ga0097620_100023527 3300006931 Bacteria 6181
151 Ga0099795_10302354 3300007788 Bacteria 704
152 Ga0111539_10086167 3300009094 Unclassified 3691
153 Ga0111539_10178196 3300009094 Bacteria 2483
154 Ga0111539_11011864 3300009094 Bacteria 966
155 Ga0105245_10134774 3300009098 Bacteria 2320
156 Ga0105245_10357784 3300009098 Bacteria 1448
157 Ga0114129_10501506 3300009147 Unclassified 1585
158 Ga0114129_12537722 3300009147 Unclassified 612
159 Ga0105243_10345576 3300009148 Unclassified 1364
160 Ga0105243_11263137 3300009148 Bacteria 754
161 Ga0105241_10670359 3300009174 Bacteria 944
162 Ga0105248_10483617 3300009177 Unclassified 1396
163 Ga0105248_11577856 3300009177 Bacteria 743
164 Ga0105249_10056574 3300009553 Bacteria 3591
165 Ga0105239_10158387 3300010375 Bacteria 2529
166 Ga0105239_10197182 3300010375 Bacteria 2255
167 Ga0105239_12688489 3300010375 Unclassified 581
168 Ga0105246_10226740 3300011119 Unclassified 1468
169 Ga0105246_10789614 3300011119 Bacteria 841
170 Ga0157373_10190096 3300013100 Unclassified 1447
171 Ga0157371_10078754 3300013102 Bacteria 2335
172 Ga0157371_10334338 3300013102 Bacteria 1101
173 Ga0157370_10079422 3300013104 Bacteria 3089
174 Ga0157369_10040134 3300013105 Bacteria 5112
175 Ga0157374_10022086 3300013296 Bacteria 5672
176 Ga0157374_10085961 3300013296 Bacteria 2991
177 Ga0157374_10188737 3300013296 Bacteria 2016
178 Ga0157374_10241702 3300013296 Bacteria 1775
179 Ga0157374_10649082 3300013296 Unclassified 1067
180 Ga0157374_10675883 3300013296 Bacteria 1045
181 Ga0157374_10702932 3300013296 Unclassified 1024
182 Ga0157378_10068278 3300013297 Bacteria 3187
183 Ga0157378_10285229 3300013297 Unclassified 1593
184 Ga0163162_10610480 3300013306 Unclassified 1216
185 Ga0157372_10049902 3300013307 Bacteria 4655
186 Ga0157372_10437788 3300013307 Unclassified 1524
187 Ga0157375_10021763 3300013308 Bacteria 5887
188 Ga0157375_10094634 3300013308 Bacteria 3057
189 Ga0157375_10148467 3300013308 Bacteria 2477
190 Ga0163163_10600305 3300014325 Bacteria 1164
191 Ga0163163_10602726 3300014325 Unclassified 1161
192 Ga0157379_10004731 3300014968 Bacteria 11679
193 Ga0157376_10299803 3300014969 Unclassified 1521
194 Ga0157376_10367362 3300014969 Bacteria 1382
195 Ga0157376_11776271 3300014969 Bacteria 653
196 Ga0182006_1097194 3300015261 Bacteria 1050
197 Ga0182005_1036454 3300015265 Bacteria 1337
198 Ga0163161_10007769 3300017792 Bacteria 7419
199 Ga0163161_10617673 3300017792 Bacteria 895
200 Ga0213872_10008506 3300021361 Bacteria 4964
201 Ga0213872_10016363 3300021361 Unclassified 3442
202 Ga0213872_10160493 3300021361 Unclassified 978
203 Ga0213874_10018766 3300021377 Unclassified 1873
204 Ga0213876_10097354 3300021384 Bacteria 1559
205 Ga0213871_10024971 3300021441 Bacteria 1519
206 Ga0207666_1001085 3300025271 Bacteria 3218
207 Ga0207666_1002956 3300025271 Bacteria 2066
208 Ga0207666_1003236 3300025271 Bacteria 1993
209 Ga0207673_1003170 3300025290 Bacteria 1915
210 Ga0207673_1005215 3300025290 Bacteria 1580
211 Ga0207697_10000657 3300025315 Bacteria 19633
212 Ga0207653_10046558 3300025885 Bacteria 1434
213 Ga0207682_10009001 3300025893 Bacteria 3945
214 Ga0207688_10002691 3300025901 Bacteria 9622
215 Ga0207685_10158218 3300025905 Unclassified 1032
216 Ga0207645_10004601 3300025907 Bacteria 10168
217 Ga0207645_10173506 3300025907 Bacteria 1414
218 Ga0207705_10613733 3300025909 Bacteria 846
219 Ga0207684_10000028 3300025910 Bacteria 306450
220 Ga0207684_10003348 3300025910 Bacteria 15715
221 Ga0207684_10030545 3300025910 Bacteria 4586
222 Ga0207684_10101243 3300025910 Bacteria 2463
223 Ga0207684_10121879 3300025910 Bacteria 2236
224 Ga0207684_10154523 3300025910 Bacteria 1975
225 Ga0207684_10164912 3300025910 Bacteria 1908
226 Ga0207684_10303913 3300025910 Bacteria 1375
227 Ga0207654_10384277 3300025911 Bacteria 973
228 Ga0207707_10151756 3300025912 Bacteria 2025
229 Ga0207693_10052840 3300025915 Bacteria 3187
230 Ga0207693_10342121 3300025915 Unclassified 1171
231 Ga0207693_10397510 3300025915 Bacteria 1077
232 Ga0207693_10599966 3300025915 Unclassified 857
233 Ga0207657_10077550 3300025919 Bacteria 2800
234 Ga0207657_10662605 3300025919 Unclassified 812
235 Ga0207649_10028040 3300025920 Bacteria 3312
236 Ga0207649_10270231 3300025920 Bacteria 1232
237 Ga0207652_10040855 3300025921 Bacteria 3940
238 Ga0207646_10022446 3300025922 Bacteria 5813
239 Ga0207646_10049801 3300025922 Unclassified 3751
240 Ga0207646_10102854 3300025922 Bacteria 2562
241 Ga0207646_10175473 3300025922 Bacteria 1935
242 Ga0207646_10321984 3300025922 Bacteria 1397
243 Ga0207646_10326518 3300025922 Bacteria 1386
244 Ga0207681_10137871 3300025923 Unclassified 1813
245 Ga0207659_10470857 3300025926 Unclassified 1060
246 Ga0207700_10957444 3300025928 Unclassified 766
247 Ga0207664_10030027 3300025929 Bacteria 4148
248 Ga0207664_10213234 3300025929 Bacteria 1671
249 Ga0207664_10636001 3300025929 Unclassified 959
250 Ga0207644_10522766 3300025931 Bacteria 980
251 Ga0207706_10064034 3300025933 Bacteria 3237
252 Ga0207686_10272317 3300025934 Bacteria 1246
253 Ga0207670_10009030 3300025936 Bacteria 5659
254 Ga0207670_10155609 3300025936 Bacteria 1701
255 Ga0207670_10282717 3300025936 Bacteria 1294
256 Ga0207704_10006052 3300025938 Bacteria 5607
257 Ga0207704_10327081 3300025938 Bacteria 1185
258 Ga0207665_10002886 3300025939 Bacteria 11532
259 Ga0207665_10105629 3300025939 Unclassified 1972
260 Ga0207665_10248914 3300025939 Bacteria 1312
261 Ga0207691_10019373 3300025940 Bacteria 6438
262 Ga0207711_10606506 3300025941 Bacteria 1021
263 Ga0207679_10080123 3300025945 Bacteria 2492
264 Ga0207667_10194189 3300025949 Bacteria 2083
265 Ga0207712_10093608 3300025961 Bacteria 2218
266 Ga0207668_10025867 3300025972 Bacteria 3804
267 Ga0207668_10496205 3300025972 Bacteria 1049
268 Ga0207640_10445821 3300025981 Bacteria 1065
269 Ga0207658_10134031 3300025986 Bacteria 1994
270 Ga0207677_10010140 3300026023 Bacteria 5322
271 Ga0207677_10806148 3300026023 Bacteria 841
272 Ga0207639_10000041 3300026041 Bacteria 142289
273 Ga0207678_10476902 3300026067 Bacteria 1086
274 Ga0207708_10389904 3300026075 Bacteria 1150
275 Ga0207702_10025614 3300026078 Bacteria 4897
276 Ga0207641_10118323 3300026088 Bacteria 2360
277 Ga0207641_10485202 3300026088 Bacteria 1198
278 Ga0207648_10137719 3300026089 Bacteria 2150
279 Ga0207676_10187182 3300026095 Bacteria 1818
280 Ga0207676_10320899 3300026095 Bacteria 1422
281 Ga0207675_100176204 3300026118 Bacteria 2046
282 Ga0207675_100771206 3300026118 Bacteria 974
283 Ga0207683_10067315 3300026121 Bacteria 3159
284 Ga0207683_10091434 3300026121 Unclassified 2711
285 Ga0210002_1041873 3300027617 Unclassified 778
286 Ga0268266_10114897 3300028379 Bacteria 2389
287 Ga0268266_10482894 3300028379 Bacteria 1181
288 Ga0268266_10694159 3300028379 Unclassified 981
289 Ga0373945_0309060 3300035116 Bacteria 678
290 Ga0373943_0006398 3300035170 Bacteria 5290
291 Ga0373943_0038070 3300035170 Bacteria 2311
292 Ga0373946_0018523 3300035171 Bacteria 2675
293 Ga0373962_0198127 3300035242 Bacteria 679
294 Ga0373931_1028080 3300035691 Bacteria 559
295 Ga0373935_0030950 3300035692 Bacteria 3318
296 Ga0373935_0302282 3300035692 Bacteria 1131
297 Ga0373927_0046659 3300035695 Bacteria 2803
298 Ga0373927_0057783 3300035695 Bacteria 2509
299 Ga0373927_0635255 3300035695 Unclassified 706
300 Ga0373933_0034353 3300035724 Bacteria 2955
301 Ga0373933_0344197 3300035724 Bacteria 968
302 Ga0373947_0071142 3300035725 Bacteria 2133
303 Ga0373947_0659508 3300035725 Bacteria 713
304 Ga0373937_0124825 3300036401 Bacteria 2401
305 Ga0373925_0019202 3300037068 Bacteria 4970
306 Ga0373925_0257950 3300037068 Bacteria 1400
307 Ga0373925_0311527 3300037068 Bacteria 1272
308 Ga0395899_0023471 3300037312 Bacteria 4671
309 Ga0395900_0017844 3300037418 Bacteria 7243
310 Ga0395900_0363217 3300037418 Unclassified 1419
311 Ga0395900_0417423 3300037418 Bacteria 1303
312 Ga0395898_1050515 3300037466 Bacteria 749
313 Ga0395905_0008736 3300037471 Bacteria 9966
314 Ga0395905_0995030 3300037471 Bacteria 742
315 Ga0436364_0370735 3300037853 Bacteria 2597
316 Ga0436364_1165566 3300037853 Bacteria 714
317 Ga0395901_0000757 3300038443 Bacteria 36285
318 Ga0395901_0109388 3300038443 Bacteria 2902
319 Ga0436365_0523238 3300039437 Unclassified 631
320 Ga0436365_0847841 3300039437 Bacteria 6687
321 Ga0436360_0199473 3300039438 Bacteria 7106
322 Ga0436360_0960920 3300039438 Unclassified 2655
323 Ga0436361_0039022 3300039447 Bacteria 3407
324 Ga0436361_0133081 3300039447 Bacteria 1408
325 Ga0436361_0848966 3300039447 Unclassified 2353
326 Ga0436361_0943929 3300039447 Bacteria 22001
327 Ga0436361_1061952 3300039447 Unclassified 649
328 Ga0436363_0128892 3300039450 Bacteria 1399
329 Ga0436363_1071858 3300039450 Bacteria 8267
330 Ga0451853_0443164 3300041512 Unclassified 753
331 Ga0439444_0108029 3300042437 Bacteria 637
332 Ga0439464_0022671 3300042439 Bacteria 1731
333 Ga0439440_0025633 3300042993 Bacteria 1359
334 Ga0495592_0178097 3300046454 Bacteria 1450
335 Ga0495603_0149488 3300046455 Bacteria 1357
336 Ga0495629_0030026 3300046459 Bacteria 3854
337 Ga0495651_0274114 3300046462 Bacteria 1143
338 Ga0495639_0154306 3300046475 Bacteria 1109
339 Ga0495662_0506825 3300046476 Bacteria 592
340 Ga0495664_0166792 3300046477 Bacteria 1336
341 Ga0495584_0072588 3300046491 Bacteria 1730
342 Ga0495608_0382702 3300046511 Bacteria 862
343 Ga0495630_0127791 3300046517 Bacteria 1929
344 Ga0495666_0177670 3300046526 Bacteria 984
345 Ga0495586_0051820 3300046535 Bacteria 2221
346 Ga0495667_0400345 3300046559 Bacteria 865
347 Ga0495634_0152240 3300046642 Bacteria 1462
348 Ga0495635_0745963 3300046663 Bacteria 633
349 Ga0495588_0260124 3300046674 Bacteria 915
350 Ga0495657_0247995 3300046675 Bacteria 1073
351 Ga0495657_0289416 3300046675 Bacteria 979
352 Ga0495600_0671993 3300046809 Bacteria 625
353 Ga0495581_0045572 3300047315 Bacteria 2535
354 Ga0495676_0235047 3300047321 Bacteria 1257
355 Ga0495680_0114905 3300047322 Bacteria 1992
356 Ga0496100_0585309 3300048903 Unclassified 865
357 Ga0496101_0218004 3300048904 Bacteria 1480
358 Ga0496101_0371346 3300048904 Bacteria 1125
359 Ga0496102_0067068 3300048905 Bacteria 3290
360 Ga0496102_0536854 3300048905 Bacteria 1092
361 Ga0496102_1003361 3300048905 Bacteria 755
362 Ga0496103_0018572 3300048906 Bacteria 4171
363 Ga0496103_0517758 3300048906 Bacteria 763
364 Ga0496103_0624437 3300048906 Bacteria 686
365 Ga0496104_0146177 3300048907 Bacteria 2270
366 Ga0496104_0654571 3300048907 Unclassified 959
367 Ga0496105_0097311 3300048908 Bacteria 2431
368 Ga0496105_0254348 3300048908 Bacteria 1422
369 Ga0496105_0333063 3300048908 Unclassified 1215
370 Ga0496105_0438472 3300048908 Bacteria 1032
371 Ga0496105_0909626 3300048908 Bacteria 663
372 Ga0496106_0006430 3300048909 Bacteria 8699
373 Ga0496106_0366935 3300048909 Bacteria 1157
374 Ga0496107_0003054 3300048910 Bacteria 11105
375 Ga0496107_0465366 3300048910 Bacteria 939
376 Ga0496108_0558048 3300048911 Bacteria 999
377 Ga0496108_0733924 3300048911 Bacteria 855
378 Ga0496109_1707195 3300048912 Unclassified 563
379 Ga0496110_0301741 3300048913 Bacteria 1459
380 Ga0496110_0593629 3300048913 Unclassified 1005
381 Ga0496110_1135877 3300048913 Unclassified 690
382 Ga0496112_0026285 3300048915 Bacteria 5598
383 Ga0496112_0378943 3300048915 Bacteria 1356
384 Ga0496112_0890287 3300048915 Unclassified 812
385 Ga0496113_0133996 3300048916 Unclassified 1946
386 Ga0496114_0011481 3300048917 Bacteria 7079
387 Ga0496114_0025773 3300048917 Bacteria 4809
388 Ga0496115_0083954 3300048918 Bacteria 2596
389 Ga0496115_0167602 3300048918 Bacteria 1816
390 Ga0496115_1126299 3300048918 Bacteria 593
391 Ga0501080_0017617 3300049742 Bacteria 6606
392 nmdc:mga03683_10942_c2 3300050489 Unclassified 2090
393 nmdc:mga0k408_15732_c1 3300050493 Unclassified 4188
394 nmdc:mga07m45_371446_c1 3300050496 Unclassified 831
395 nmdc:mga05p37_134608_c1 3300050507 Bacteria 3032
396 nmdc:mga05p37_766570_c1 3300050507 Unclassified 1061
397 nmdc:mga09592_803680_c1 3300050508 Unclassified 795
398 nmdc:mga08y16_143151_c1 3300050511 Unclassified 2485
399 nmdc:mga08y16_373915_c1 3300050511 Bacteria 1461
400 nmdc:mga0n895_305014_c1 3300050512 Unclassified 1614
401 Ga0495601_0069576 3300053077 Bacteria 2245
402 Ga0495595_0113746 3300053084 Bacteria 1314
403 Ga0500555_000106 3300053103 Bacteria 39675
404 Ga0500556_0000193 3300053104 Bacteria 49891
405 Ga0213876_10019390
406 JGI24035J26624_1000486
407 Ga0065704_10016812
408 Ga0065712_10001994
409 Ga0065712_10023150
410 Ga0065715_10001936
411 Ga0065715_10002587
412 Ga0065715_10007703
413 Ga0065715_10220346
414 Ga0065707_10240053
415 Ga0070676_10018547
416 Ga0070683_100018602
417 Ga0070683_100210452
418 Ga0070670_100582844
419 Ga0070666_10115562
420 Ga0070666_11008654
421 Ga0068868_100476517
422 Ga0070689_100000681
423 Ga0070687_100461546
424 Ga0070661_100235264
425 Ga0070661_100267963
426 Ga0070668_100007553
427 Ga0070669_100008646
428 Ga0070669_100218707
429 Ga0070675_100001807
430 Ga0070675_100006933
431 Ga0070675_100074328
432 Ga0070675_100514939
433 Ga0070671_100044963
434 Ga0070671_100524799
435 Ga0070674_100117421
436 Ga0070688_100009073
437 Ga0070688_100064712
438 Ga0070688_100103972
439 Ga0070688_100127575
440 Ga0070688_101075131
441 Ga0070659_100000778
442 Ga0070659_100049458
443 Ga0070667_100429997
444 Ga0070703_10012594
445 Ga0070714_100024622
446 Ga0070713_101689952
447 Ga0070710_10191099
448 Ga0070711_100200831
449 Ga0070711_100213626
450 Ga0070711_100783481
451 Ga0070708_100216176
452 Ga0070708_100606594
453 Ga0070678_100084798
454 Ga0070678_100138432
455 Ga0070678_100162192
456 Ga0070662_100005856
457 Ga0070662_100021820
458 Ga0070662_100080242
459 Ga0070681_10028964
460 Ga0068867_100133829
461 Ga0070685_10088040
462 Ga0070685_10169864
463 Ga0070706_100000012
464 Ga0070706_100007637
465 Ga0070706_100007749
466 Ga0070706_100024766
467 Ga0070706_100036826
468 Ga0070706_100044108
469 Ga0070706_100072365
470 Ga0070706_100438679
471 Ga0070707_100000171
472 Ga0070707_100002533
473 Ga0070707_100009190
474 Ga0070707_100018503
475 Ga0070707_100034464
476 Ga0070707_100307817
477 Ga0070707_100406006
478 Ga0070707_100680421
479 Ga0070698_100004632
480 Ga0070698_100006241
481 Ga0070698_100042963
482 Ga0070698_100088594
483 Ga0070698_100109891
484 Ga0070698_100532204
485 Ga0070699_100018307
486 Ga0070699_100258288
487 Ga0070699_100687426
488 Ga0070699_100834302
489 Ga0070684_100000434
490 Ga0070684_100024143
491 Ga0070697_100001418
492 Ga0070697_100076997
493 Ga0070697_100081568
494 Ga0070697_100114185
495 Ga0070697_100116326
496 Ga0070697_100148717
497 Ga0070697_100572218
498 Ga0068853_100000044
499 Ga0070672_100005886
500 Ga0070686_100007931
501 Ga0070686_100025700
502 Ga0070695_100120132
503 Ga0070696_100038309
504 Ga0070693_100014269
505 Ga0070693_100395507
506 Ga0070665_100035997
507 Ga0070665_100036111
508 Ga0070665_100179424
509 Ga0070665_100358859
510 Ga0070665_100445959
511 Ga0070704_100028526
512 Ga0068855_100282391
513 Ga0068855_100433113
514 Ga0068855_100864885
515 Ga0070664_100242675
516 Ga0068856_100053957
517 Ga0068852_100766092
518 Ga0068859_100023527
519 Ga0068864_100128118
520 Ga0068864_101571793
521 Ga0068866_10681967
522 Ga0068861_100101220
523 Ga0068863_100100955
524 Ga0068860_100717411
525 Ga0081455_10002693
526 Ga0081455_10003329
527 Ga0081455_10037465
528 Ga0081455_10078158
529 Ga0081540_1000368
530 Ga0081540_1051535
531 Ga0070717_10010820
532 Ga0070717_10020000
533 Ga0070717_10025240
534 Ga0070717_10026280
535 Ga0070717_10088496
536 Ga0070717_10407014
537 Ga0070717_10685802
538 Ga0075363_100406140
539 Ga0070715_10004923
540 Ga0070715_10009316
541 Ga0070716_100043592
542 Ga0070716_100058735
543 Ga0070716_100136021
544 Ga0070712_100037553
545 Ga0070712_100245528
546 Ga0075362_10016526
547 Ga0075366_10008058
548 Ga0075370_10265555
549 Ga0068871_100068921
550 Ga0068871_100220045
551 Ga0075434_100397887
552 Ga0075434_100637041
553 Ga0068865_100334219
554 Ga0097620_100023527
555 Ga0099795_10302354
556 Ga0111539_10086167
557 Ga0111539_10178196
558 Ga0111539_11011864
559 Ga0105245_10134774
560 Ga0105245_10357784
561 Ga0114129_10501506
562 Ga0114129_12537722
563 Ga0105243_10345576
564 Ga0105243_11263137
565 Ga0105241_10670359
566 Ga0105248_10483617
567 Ga0105248_11577856
568 Ga0105249_10056574
569 Ga0105239_10158387
570 Ga0105239_10197182
571 Ga0105239_12688489
572 Ga0105246_10226740
573 Ga0105246_10789614
574 Ga0157373_10190096
575 Ga0157371_10078754
576 Ga0157371_10334338
577 Ga0157370_10079422
578 Ga0157369_10040134
579 Ga0157374_10022086
580 Ga0157374_10085961
581 Ga0157374_10188737
582 Ga0157374_10241702
583 Ga0157374_10649082
584 Ga0157374_10675883
585 Ga0157374_10702932
586 Ga0157378_10068278
587 Ga0157378_10285229
588 Ga0163162_10610480
589 Ga0157372_10049902
590 Ga0157372_10437788
591 Ga0157375_10021763
592 Ga0157375_10094634
593 Ga0157375_10148467
594 Ga0163163_10600305
595 Ga0163163_10602726
596 Ga0157379_10004731
597 Ga0157376_10299803
598 Ga0157376_10367362
599 Ga0157376_11776271
600 Ga0182006_1097194
601 Ga0182005_1036454
602 Ga0163161_10007769
603 Ga0163161_10617673
604 Ga0213872_10008506
605 Ga0213872_10016363
606 Ga0213872_10160493
607 Ga0213874_10018766
608 Ga0213876_10097354
609 Ga0213871_10024971
610 Ga0207666_1001085
611 Ga0207666_1002956
612 Ga0207666_1003236
613 Ga0207673_1003170
614 Ga0207673_1005215
615 Ga0207697_10000657
616 Ga0207653_10046558
617 Ga0207682_10009001
618 Ga0207688_10002691
619 Ga0207685_10158218
620 Ga0207645_10004601
621 Ga0207645_10173506
622 Ga0207705_10613733
623 Ga0207684_10000028
624 Ga0207684_10003348
625 Ga0207684_10030545
626 Ga0207684_10101243
627 Ga0207684_10121879
628 Ga0207684_10154523
629 Ga0207684_10164912
630 Ga0207684_10303913
631 Ga0207654_10384277
632 Ga0207707_10151756
633 Ga0207693_10052840
634 Ga0207693_10342121
635 Ga0207693_10397510
636 Ga0207693_10599966
637 Ga0207657_10077550
638 Ga0207657_10662605
639 Ga0207649_10028040
640 Ga0207649_10270231
641 Ga0207652_10040855
642 Ga0207646_10022446
643 Ga0207646_10049801
644 Ga0207646_10102854
645 Ga0207646_10175473
646 Ga0207646_10321984
647 Ga0207646_10326518
648 Ga0207681_10137871
649 Ga0207659_10470857
650 Ga0207700_10957444
651 Ga0207664_10030027
652 Ga0207664_10213234
653 Ga0207664_10636001
654 Ga0207644_10522766
655 Ga0207706_10064034
656 Ga0207686_10272317
657 Ga0207670_10009030
658 Ga0207670_10155609
659 Ga0207670_10282717
660 Ga0207704_10006052
661 Ga0207704_10327081
662 Ga0207665_10002886
663 Ga0207665_10105629
664 Ga0207665_10248914
665 Ga0207691_10019373
666 Ga0207711_10606506
667 Ga0207679_10080123
668 Ga0207667_10194189
669 Ga0207712_10093608
670 Ga0207668_10025867
671 Ga0207668_10496205
672 Ga0207640_10445821
673 Ga0207658_10134031
674 Ga0207677_10010140
675 Ga0207677_10806148
676 Ga0207639_10000041
677 Ga0207678_10476902
678 Ga0207708_10389904
679 Ga0207702_10025614
680 Ga0207641_10118323
681 Ga0207641_10485202
682 Ga0207648_10137719
683 Ga0207676_10187182
684 Ga0207676_10320899
685 Ga0207675_100176204
686 Ga0207675_100771206
687 Ga0207683_10067315
688 Ga0207683_10091434
689 Ga0210002_1041873
690 Ga0268266_10114897
691 Ga0268266_10482894
692 Ga0268266_10694159
693 Ga0373945_0309060
694 Ga0373943_0006398
695 Ga0373943_0038070
696 Ga0373946_0018523
697 Ga0373962_0198127
698 Ga0373931_1028080
699 Ga0373935_0030950
700 Ga0373935_0302282
701 Ga0373927_0046659
702 Ga0373927_0057783
703 Ga0373927_0635255
704 Ga0373933_0034353
705 Ga0373933_0344197
706 Ga0373947_0071142
707 Ga0373947_0659508
708 Ga0373937_0124825
709 Ga0373925_0019202
710 Ga0373925_0257950
711 Ga0373925_0311527
712 Ga0395899_0023471
713 Ga0395900_0017844
714 Ga0395900_0363217
715 Ga0395900_0417423
716 Ga0395898_1050515
717 Ga0395905_0008736
718 Ga0395905_0995030
719 Ga0436364_0370735
720 Ga0436364_1165566
721 Ga0395901_0000757
722 Ga0395901_0109388
723 Ga0436365_0523238
724 Ga0436365_0847841
725 Ga0436360_0199473
726 Ga0436360_0960920
727 Ga0436361_0039022
728 Ga0436361_0133081
729 Ga0436361_0848966
730 Ga0436361_0943929
731 Ga0436361_1061952
732 Ga0436363_0128892
733 Ga0436363_1071858
734 Ga0451853_0443164
735 Ga0439444_0108029
736 Ga0439464_0022671
737 Ga0439440_0025633
738 Ga0495592_0178097
739 Ga0495603_0149488
740 Ga0495629_0030026
741 Ga0495651_0274114
742 Ga0495639_0154306
743 Ga0495662_0506825
744 Ga0495664_0166792
745 Ga0495584_0072588
746 Ga0495608_0382702
747 Ga0495630_0127791
748 Ga0495666_0177670
749 Ga0495586_0051820
750 Ga0495667_0400345
751 Ga0495634_0152240
752 Ga0495635_0745963
753 Ga0495588_0260124
754 Ga0495657_0247995
755 Ga0495657_0289416
756 Ga0495600_0671993
757 Ga0495581_0045572
758 Ga0495676_0235047
759 Ga0495680_0114905
760 Ga0496100_0585309
761 Ga0496101_0218004
762 Ga0496101_0371346
763 Ga0496102_0067068
764 Ga0496102_0536854
765 Ga0496102_1003361
766 Ga0496103_0018572
767 Ga0496103_0517758
768 Ga0496103_0624437
769 Ga0496104_0146177
770 Ga0496104_0654571
771 Ga0496105_0097311
772 Ga0496105_0254348
773 Ga0496105_0333063
774 Ga0496105_0438472
775 Ga0496105_0909626
776 Ga0496106_0006430
777 Ga0496106_0366935
778 Ga0496107_0003054
779 Ga0496107_0465366
780 Ga0496108_0558048
781 Ga0496108_0733924
782 Ga0496109_1707195
783 Ga0496110_0301741
784 Ga0496110_0593629
785 Ga0496110_1135877
786 Ga0496112_0026285
787 Ga0496112_0378943
788 Ga0496112_0890287
789 Ga0496113_0133996
790 Ga0496114_0011481
791 Ga0496114_0025773
792 Ga0496115_0083954
793 Ga0496115_0167602
794 Ga0496115_1126299
795 Ga0501080_0017617
796 nmdc:mga03683_10942_c2
797 nmdc:mga0k408_15732_c1
798 nmdc:mga07m45_371446_c1
799 nmdc:mga05p37_134608_c1
800 nmdc:mga05p37_766570_c1
801 nmdc:mga09592_803680_c1
802 nmdc:mga08y16_143151_c1
803 nmdc:mga08y16_373915_c1
804 nmdc:mga0n895_305014_c1
805 Ga0495601_0069576
806 Ga0495595_0113746
807 Ga0500555_000106
808 Ga0500556_0000193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

47

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rxu-assembly1.cif.gz_A crystal structure of cj1090c 0.7906 33 163
3bf2-assembly1.cif.gz_A-2 crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a 0.753 31 164
7rxu-assembly1.cif.gz_A crystal structure of cj1090c 0.7492 33 163
1vbk-assembly1.cif.gz_B crystal structure of ph1313 from pyrococcus horikoshii ot3 0.7439 34 85
5tse-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7372 32 166
ID Description Score Start End Superfamily
3bf2A00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.714 31 164 3.30.160.150
3w1eA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.7057 31 165 3.40.50.10610
af_Q75HZ1_74_232_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.689 101 140 2.60.40.1820
af_Q75JX1_270_414_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.6885 32 71 3.40.50.10330
af_Q9LJT8_38_173_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6864 101 136 2.60.40.1820
ID Description Score Start End GO Terms
AF-A0A1M3CNA9-F1-model_v4 deleted 0.9442 30 167
AF-A0A1M3CNA9-F1-model_v4 deleted 0.9311 30 167
AF-A0A3E1E2Q9-F1-model_v4 Lipopolysaccharide-assembly 0.9186 22 167 GO:0019867
GO:0043165
AF-A0A7U0TVN8-F1-model_v4 deleted 0.9144 15 167
AF-A0A5R8KEI0-F1-model_v4 LptE family protein 0.9121 8 167 GO:0019867
GO:0043165

Map