F435754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 241 | 808 | 457 |
Family's Representative Sequence
| Representative Sequence | 3300046499|Ga0495594_0000004|Ga0495594_0000004_140566_142062 |
| Length | 498 |
| Sequence | MGAGGPGEHADRDAYPQLSKNVHMRKPNRPGARASIRHTSRMAEVPQPPYRRRARASSRDLERYAGLFAGRTAVMRSSAMRDLMAITARPEVISLAGGLPDTSTFPPESFAAEMTRIAQKSAAEALQYGPTEGFEETKDCILEVMGAEGMLPEHDDVIVTTGGQQAIDLICKTLVDPGDVVICEAPTYPGAVPTFCSYEADVIQIECDQEGMRVEELEPLLDRLQSEGRHPKFVYSVPTFQNPAGVTMSLPRRRQLVELARSRELLVVEDNPYGLLRYSGEPLPPLYQLDGGDFVLYIGTFSKILSPGIRLGWAVAPPPVMDKIVLGKQAADLCSSTLTQYFVREYFAEGRWREYIEELVGIYRRRRDTMVAALHEHFPAEATWTEPQGGLFIWATLPGYIDTSDLLAKALRADVAFVPGQAAFVAERGGNSMRLNFSGVDEDEIREGIRRIGKVIDEQVELYGALTGEHRLPSREPAAEEPAEENVVPFRRSGEGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 192 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 197 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 200 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 237 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 238 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 13.37 |
| Rhizosphere | 81.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495594_0000004 | 3300046499 | Bacteria | 195881 |
| 2 | JGI24746J21847_1000681 | 3300001977 | Bacteria | 5202 |
| 3 | JGI24740J21852_10001243 | 3300001979 | Bacteria | 11534 |
| 4 | JGI24748J21848_1000144 | 3300002074 | Bacteria | 11985 |
| 5 | Ga0070683_100003521 | 3300005329 | Bacteria | 12744 |
| 6 | Ga0070683_100035102 | 3300005329 | Bacteria | 4584 |
| 7 | Ga0070683_100158789 | 3300005329 | Bacteria | 2145 |
| 8 | Ga0070677_10000018 | 3300005333 | Bacteria | 51146 |
| 9 | Ga0068869_100044938 | 3300005334 | Bacteria | 3178 |
| 10 | Ga0070666_10030316 | 3300005335 | Bacteria | 3562 |
| 11 | Ga0070682_100000016 | 3300005337 | Bacteria | 239799 |
| 12 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 13 | Ga0068868_100001722 | 3300005338 | Bacteria | 14978 |
| 14 | Ga0068868_100010335 | 3300005338 | Bacteria | 6750 |
| 15 | Ga0070691_10000083 | 3300005341 | Bacteria | 26414 |
| 16 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 17 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 18 | Ga0070674_100000028 | 3300005356 | Bacteria | 69584 |
| 19 | Ga0070673_100074539 | 3300005364 | Bacteria | 2735 |
| 20 | Ga0070688_100000070 | 3300005365 | Bacteria | 50587 |
| 21 | Ga0070659_100001759 | 3300005366 | Bacteria | 15569 |
| 22 | Ga0070667_100003476 | 3300005367 | Bacteria | 13422 |
| 23 | Ga0070667_100076527 | 3300005367 | Bacteria | 2857 |
| 24 | Ga0070713_100000014 | 3300005436 | Bacteria | 124804 |
| 25 | Ga0070713_100023578 | 3300005436 | Bacteria | 4778 |
| 26 | Ga0070711_100022371 | 3300005439 | Bacteria | 4097 |
| 27 | Ga0070700_100067091 | 3300005441 | Bacteria | 2279 |
| 28 | Ga0070663_100000869 | 3300005455 | Bacteria | 16439 |
| 29 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 30 | Ga0068867_100002065 | 3300005459 | Bacteria | 14077 |
| 31 | Ga0070685_10000028 | 3300005466 | Bacteria | 90128 |
| 32 | Ga0070679_100000674 | 3300005530 | Bacteria | 29110 |
| 33 | Ga0070679_100000812 | 3300005530 | Bacteria | 27087 |
| 34 | Ga0070684_100004572 | 3300005535 | Bacteria | 10549 |
| 35 | Ga0068853_100244686 | 3300005539 | Bacteria | 1645 |
| 36 | Ga0070672_100000858 | 3300005543 | Bacteria | 18170 |
| 37 | Ga0070693_100000093 | 3300005547 | Bacteria | 38785 |
| 38 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 39 | Ga0070665_100036132 | 3300005548 | Bacteria | 4971 |
| 40 | Ga0070665_100072801 | 3300005548 | Bacteria | 3443 |
| 41 | Ga0068854_100003092 | 3300005578 | Bacteria | 10364 |
| 42 | Ga0068854_100076010 | 3300005578 | Bacteria | 2467 |
| 43 | Ga0068856_100000186 | 3300005614 | Bacteria | 64970 |
| 44 | Ga0068856_100005266 | 3300005614 | Bacteria | 12756 |
| 45 | Ga0068852_100000013 | 3300005616 | Bacteria | 139537 |
| 46 | Ga0068852_100072991 | 3300005616 | Bacteria | 3018 |
| 47 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 48 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 49 | Ga0068866_10000306 | 3300005718 | Bacteria | 23392 |
| 50 | Ga0068851_10000347 | 3300005834 | Bacteria | 20830 |
| 51 | Ga0068851_10052210 | 3300005834 | Bacteria | 2078 |
| 52 | Ga0068863_100000080 | 3300005841 | Bacteria | 106670 |
| 53 | Ga0068863_100014346 | 3300005841 | Bacteria | 7631 |
| 54 | Ga0068863_100061635 | 3300005841 | Bacteria | 3547 |
| 55 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 56 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 57 | Ga0068860_100001897 | 3300005843 | Bacteria | 22186 |
| 58 | Ga0068860_100122934 | 3300005843 | Bacteria | 2486 |
| 59 | Ga0068862_100003207 | 3300005844 | Bacteria | 14173 |
| 60 | Ga0081455_10006118 | 3300005937 | Bacteria | 13005 |
| 61 | Ga0081455_10083551 | 3300005937 | Unclassified | 2609 |
| 62 | Ga0081540_1000115 | 3300005983 | Bacteria | 84188 |
| 63 | Ga0081540_1002319 | 3300005983 | Bacteria | 15596 |
| 64 | Ga0081539_10000674 | 3300005985 | Bacteria | 68446 |
| 65 | Ga0081539_10002431 | 3300005985 | Bacteria | 26296 |
| 66 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 67 | Ga0070712_100113678 | 3300006175 | Unclassified | 2025 |
| 68 | Ga0075433_10000031 | 3300006852 | Bacteria | 55735 |
| 69 | Ga0075433_10011318 | 3300006852 | Bacteria | 7181 |
| 70 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 71 | Ga0105245_10000045 | 3300009098 | Bacteria | 134057 |
| 72 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 73 | Ga0105245_10000488 | 3300009098 | Bacteria | 36321 |
| 74 | Ga0105245_10013033 | 3300009098 | Bacteria | 7244 |
| 75 | Ga0105247_10000169 | 3300009101 | Bacteria | 64387 |
| 76 | Ga0105242_10001870 | 3300009176 | Bacteria | 16542 |
| 77 | Ga0105242_10212645 | 3300009176 | Bacteria | 1724 |
| 78 | Ga0105248_10000089 | 3300009177 | Bacteria | 102101 |
| 79 | Ga0105238_10001238 | 3300009551 | Bacteria | 25694 |
| 80 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 81 | Ga0105249_10003796 | 3300009553 | Bacteria | 13043 |
| 82 | Ga0157369_10000037 | 3300013105 | Bacteria | 190395 |
| 83 | Ga0157374_10004334 | 3300013296 | Bacteria | 11938 |
| 84 | Ga0157374_10053794 | 3300013296 | Bacteria | 3754 |
| 85 | Ga0157372_10000064 | 3300013307 | Bacteria | 114648 |
| 86 | Ga0157375_10000076 | 3300013308 | Bacteria | 101715 |
| 87 | Ga0157375_10082274 | 3300013308 | Bacteria | 3261 |
| 88 | Ga0163163_10158747 | 3300014325 | Unclassified | 2306 |
| 89 | Ga0163163_10242440 | 3300014325 | Bacteria | 1852 |
| 90 | Ga0157380_10000118 | 3300014326 | Bacteria | 43745 |
| 91 | Ga0157380_10000163 | 3300014326 | Bacteria | 38484 |
| 92 | Ga0157379_10036417 | 3300014968 | Bacteria | 4388 |
| 93 | Ga0157379_10039730 | 3300014968 | Bacteria | 4198 |
| 94 | Ga0157379_10080392 | 3300014968 | Bacteria | 2920 |
| 95 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 96 | Ga0207656_10000168 | 3300025321 | Bacteria | 24193 |
| 97 | Ga0207656_10007949 | 3300025321 | Bacteria | 3888 |
| 98 | Ga0207682_10000047 | 3300025893 | Bacteria | 51208 |
| 99 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 100 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 101 | Ga0207642_10000058 | 3300025899 | Bacteria | 33156 |
| 102 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 103 | Ga0207680_10015660 | 3300025903 | Bacteria | 3964 |
| 104 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 105 | Ga0207707_10072554 | 3300025912 | Bacteria | 3001 |
| 106 | Ga0207693_10128505 | 3300025915 | Unclassified | 1992 |
| 107 | Ga0207663_10001124 | 3300025916 | Bacteria | 12316 |
| 108 | Ga0207649_10000025 | 3300025920 | Bacteria | 177532 |
| 109 | Ga0207652_10000385 | 3300025921 | Bacteria | 45964 |
| 110 | Ga0207652_10000544 | 3300025921 | Bacteria | 38182 |
| 111 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 112 | Ga0207659_10000032 | 3300025926 | Bacteria | 119492 |
| 113 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 114 | Ga0207687_10000023 | 3300025927 | Bacteria | 217098 |
| 115 | Ga0207687_10000241 | 3300025927 | Bacteria | 37298 |
| 116 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 117 | Ga0207700_10023878 | 3300025928 | Bacteria | 4225 |
| 118 | Ga0207700_10077893 | 3300025928 | Unclassified | 2577 |
| 119 | Ga0207690_10001315 | 3300025932 | Bacteria | 15617 |
| 120 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 121 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 122 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 123 | Ga0207686_10000189 | 3300025934 | Bacteria | 47718 |
| 124 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 125 | Ga0207669_10000024 | 3300025937 | Bacteria | 96123 |
| 126 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 127 | Ga0207691_10000062 | 3300025940 | Bacteria | 85448 |
| 128 | Ga0207711_10000083 | 3300025941 | Bacteria | 102109 |
| 129 | Ga0207689_10057960 | 3300025942 | Bacteria | 3186 |
| 130 | Ga0207661_10000064 | 3300025944 | Bacteria | 75730 |
| 131 | Ga0207661_10000086 | 3300025944 | Bacteria | 64501 |
| 132 | Ga0207661_10014619 | 3300025944 | Bacteria | 5756 |
| 133 | Ga0207661_10058811 | 3300025944 | Bacteria | 3095 |
| 134 | Ga0207651_10008539 | 3300025960 | Bacteria | 5538 |
| 135 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 136 | Ga0207712_10007185 | 3300025961 | Bacteria | 7026 |
| 137 | Ga0207668_10005659 | 3300025972 | Bacteria | 7355 |
| 138 | Ga0207668_10135287 | 3300025972 | Bacteria | 1888 |
| 139 | Ga0207640_10001945 | 3300025981 | Bacteria | 11120 |
| 140 | Ga0207640_10057361 | 3300025981 | Bacteria | 2561 |
| 141 | Ga0207658_10007026 | 3300025986 | Bacteria | 7662 |
| 142 | Ga0207658_10057656 | 3300025986 | Bacteria | 2887 |
| 143 | Ga0207677_10000429 | 3300026023 | Bacteria | 28292 |
| 144 | Ga0207677_10000783 | 3300026023 | Bacteria | 18211 |
| 145 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 146 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 147 | Ga0207678_10006240 | 3300026067 | Bacteria | 10589 |
| 148 | Ga0207678_10144558 | 3300026067 | Bacteria | 2030 |
| 149 | Ga0207708_10089536 | 3300026075 | Bacteria | 2372 |
| 150 | Ga0207702_10000134 | 3300026078 | Bacteria | 88324 |
| 151 | Ga0207702_10002492 | 3300026078 | Bacteria | 17387 |
| 152 | Ga0207641_10000304 | 3300026088 | Bacteria | 61194 |
| 153 | Ga0207641_10010570 | 3300026088 | Bacteria | 7573 |
| 154 | Ga0207641_10051176 | 3300026088 | Bacteria | 3498 |
| 155 | Ga0207648_10004663 | 3300026089 | Bacteria | 14027 |
| 156 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 157 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 158 | Ga0207698_10094003 | 3300026142 | Bacteria | 2463 |
| 159 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 160 | Ga0268266_10000748 | 3300028379 | Bacteria | 43458 |
| 161 | Ga0268266_10001671 | 3300028379 | Bacteria | 25564 |
| 162 | Ga0268264_10007035 | 3300028381 | Bacteria | 9436 |
| 163 | Ga0268264_10092456 | 3300028381 | Bacteria | 2611 |
| 164 | Ga0268264_10092707 | 3300028381 | Bacteria | 2608 |
| 165 | Ga0265337_1000013 | 3300028556 | Bacteria | 82926 |
| 166 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 167 | Ga0265319_1000044 | 3300028563 | Bacteria | 103641 |
| 168 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 169 | Ga0265336_10002629 | 3300028666 | Bacteria | 7298 |
| 170 | Ga0265336_10020020 | 3300028666 | Bacteria | 2153 |
| 171 | Ga0265338_10000297 | 3300028800 | Bacteria | 89764 |
| 172 | Ga0265324_10000226 | 3300029957 | Bacteria | 42741 |
| 173 | Ga0265328_10000723 | 3300031239 | Bacteria | 15312 |
| 174 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 175 | Ga0265325_10038231 | 3300031241 | Bacteria | 2533 |
| 176 | Ga0265329_10006990 | 3300031242 | Bacteria | 4411 |
| 177 | Ga0265339_10016758 | 3300031249 | Bacteria | 4360 |
| 178 | Ga0265331_10001141 | 3300031250 | Bacteria | 20260 |
| 179 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 180 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 181 | Ga0307409_100048696 | 3300031995 | Bacteria | 3227 |
| 182 | Ga0307416_100097208 | 3300032002 | Bacteria | 2549 |
| 183 | Ga0307415_100010927 | 3300032126 | Bacteria | 5166 |
| 184 | Ga0373941_0003716 | 3300035115 | Bacteria | 3479 |
| 185 | Ga0373954_0033072 | 3300035118 | Bacteria | 2393 |
| 186 | Ga0373937_0043910 | 3300036401 | Bacteria | 4082 |
| 187 | Ga0395905_0129758 | 3300037471 | Bacteria | 2371 |
| 188 | Ga0395901_0364611 | 3300038443 | Unclassified | 1489 |
| 189 | Ga0451853_3827414 | 3300041512 | Bacteria | 6651 |
| 190 | Ga0466963_0000027 | 3300044694 | Bacteria | 48596 |
| 191 | Ga0466963_0198487 | 3300044694 | Bacteria | 1403 |
| 192 | Ga0466957_0012306 | 3300044842 | Bacteria | 4953 |
| 193 | Ga0466960_0000138 | 3300044901 | Bacteria | 24715 |
| 194 | Ga0466967_0000004 | 3300045976 | Bacteria | 155664 |
| 195 | Ga0466967_0009623 | 3300045976 | Bacteria | 7183 |
| 196 | Ga0495592_0000518 | 3300046454 | Bacteria | 27890 |
| 197 | Ga0495603_0000554 | 3300046455 | Bacteria | 20910 |
| 198 | Ga0495603_0001096 | 3300046455 | Bacteria | 15726 |
| 199 | Ga0495603_0009964 | 3300046455 | Bacteria | 5750 |
| 200 | Ga0495629_0000014 | 3300046459 | Bacteria | 201801 |
| 201 | Ga0495629_0014779 | 3300046459 | Bacteria | 5616 |
| 202 | Ga0495629_0016189 | 3300046459 | Bacteria | 5352 |
| 203 | Ga0495638_0043328 | 3300046460 | Bacteria | 2839 |
| 204 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 205 | Ga0495641_0003587 | 3300046461 | Bacteria | 11512 |
| 206 | Ga0495651_0057675 | 3300046462 | Bacteria | 2981 |
| 207 | Ga0495653_0050094 | 3300046463 | Bacteria | 3213 |
| 208 | Ga0495653_0054474 | 3300046463 | Bacteria | 3056 |
| 209 | Ga0495650_0000049 | 3300046471 | Bacteria | 325092 |
| 210 | Ga0495582_0000012 | 3300046473 | Bacteria | 112893 |
| 211 | Ga0495662_0000118 | 3300046476 | Bacteria | 29672 |
| 212 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 213 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 214 | Ga0495608_0004473 | 3300046511 | Bacteria | 9988 |
| 215 | Ga0495608_0008111 | 3300046511 | Bacteria | 7382 |
| 216 | Ga0495608_0060125 | 3300046511 | Bacteria | 2501 |
| 217 | Ga0495618_0000068 | 3300046514 | Bacteria | 74614 |
| 218 | Ga0495620_0000428 | 3300046515 | Bacteria | 28031 |
| 219 | Ga0495628_0000070 | 3300046516 | Bacteria | 80592 |
| 220 | Ga0495628_0026077 | 3300046516 | Bacteria | 4772 |
| 221 | Ga0495628_0029686 | 3300046516 | Bacteria | 4432 |
| 222 | Ga0495628_0046594 | 3300046516 | Bacteria | 3443 |
| 223 | Ga0495628_0069017 | 3300046516 | Bacteria | 2757 |
| 224 | Ga0495628_0097120 | 3300046516 | Bacteria | 2276 |
| 225 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 226 | Ga0495630_0000312 | 3300046517 | Bacteria | 38816 |
| 227 | Ga0495630_0013070 | 3300046517 | Bacteria | 6035 |
| 228 | Ga0495631_0010422 | 3300046518 | Bacteria | 4598 |
| 229 | Ga0495644_0000296 | 3300046523 | Bacteria | 23051 |
| 230 | Ga0495652_0000066 | 3300046529 | Bacteria | 109895 |
| 231 | Ga0495652_0004909 | 3300046529 | Bacteria | 12688 |
| 232 | Ga0495640_0013109 | 3300046533 | Bacteria | 6309 |
| 233 | Ga0495587_0005907 | 3300046536 | Bacteria | 7981 |
| 234 | Ga0495587_0050690 | 3300046536 | Bacteria | 2456 |
| 235 | Ga0495598_0007191 | 3300046537 | Bacteria | 2544 |
| 236 | Ga0495621_0006932 | 3300046539 | Bacteria | 3333 |
| 237 | Ga0495645_0012182 | 3300046543 | Bacteria | 6056 |
| 238 | Ga0495622_0000016 | 3300046557 | Bacteria | 177089 |
| 239 | Ga0495633_0050903 | 3300046558 | Bacteria | 1952 |
| 240 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 241 | Ga0495634_0000187 | 3300046642 | Bacteria | 57203 |
| 242 | Ga0495634_0000755 | 3300046642 | Bacteria | 31302 |
| 243 | Ga0495634_0012777 | 3300046642 | Bacteria | 6078 |
| 244 | Ga0495625_0000020 | 3300046660 | Bacteria | 290440 |
| 245 | Ga0495635_0000036 | 3300046663 | Bacteria | 95138 |
| 246 | Ga0495635_0010660 | 3300046663 | Bacteria | 6436 |
| 247 | Ga0495588_0000217 | 3300046674 | Bacteria | 54461 |
| 248 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 249 | Ga0495657_0057749 | 3300046675 | Bacteria | 2579 |
| 250 | Ga0495599_0014638 | 3300046678 | Bacteria | 4858 |
| 251 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 252 | Ga0495647_0000059 | 3300046681 | Bacteria | 27437 |
| 253 | Ga0495647_0001175 | 3300046681 | Bacteria | 8050 |
| 254 | Ga0495658_0000024 | 3300046683 | Bacteria | 81300 |
| 255 | Ga0495658_0003615 | 3300046683 | Bacteria | 7654 |
| 256 | Ga0495669_0000251 | 3300046684 | Bacteria | 31256 |
| 257 | Ga0495669_0068590 | 3300046684 | Bacteria | 1613 |
| 258 | Ga0495613_0000040 | 3300046689 | Bacteria | 131633 |
| 259 | Ga0495613_0000159 | 3300046689 | Bacteria | 65969 |
| 260 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 261 | Ga0495624_0001178 | 3300046690 | Bacteria | 20710 |
| 262 | Ga0495624_0016229 | 3300046690 | Bacteria | 5015 |
| 263 | Ga0495649_0004295 | 3300046694 | Bacteria | 9350 |
| 264 | Ga0495600_0003198 | 3300046809 | Bacteria | 9590 |
| 265 | Ga0495600_0015263 | 3300046809 | Bacteria | 4854 |
| 266 | Ga0495600_0061142 | 3300046809 | Bacteria | 2460 |
| 267 | Ga0495604_0001650 | 3300047317 | Bacteria | 18348 |
| 268 | Ga0495604_0080054 | 3300047317 | Bacteria | 2449 |
| 269 | Ga0495674_0000025 | 3300047319 | Bacteria | 141103 |
| 270 | Ga0495674_0102581 | 3300047319 | Bacteria | 2433 |
| 271 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 272 | Ga0495676_0000252 | 3300047321 | Bacteria | 43212 |
| 273 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 274 | Ga0495680_0000286 | 3300047322 | Bacteria | 56839 |
| 275 | Ga0495680_0003127 | 3300047322 | Bacteria | 16492 |
| 276 | Ga0495680_0019259 | 3300047322 | Bacteria | 5771 |
| 277 | Ga0495675_0000019 | 3300047444 | Bacteria | 113641 |
| 278 | Ga0495675_0011076 | 3300047444 | Bacteria | 5654 |
| 279 | Ga0495673_0009117 | 3300047469 | Bacteria | 5509 |
| 280 | Ga0495684_0160577 | 3300047471 | Bacteria | 1677 |
| 281 | Ga0495686_0000003 | 3300047472 | Bacteria | 899502 |
| 282 | Ga0495686_0021687 | 3300047472 | Bacteria | 4260 |
| 283 | Ga0495593_0020262 | 3300047673 | Bacteria | 3725 |
| 284 | Ga0495593_0095243 | 3300047673 | Bacteria | 1531 |
| 285 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 286 | Ga0495602_0002159 | 3300048088 | Bacteria | 19865 |
| 287 | Ga0495602_0178258 | 3300048088 | Bacteria | 1642 |
| 288 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 289 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 290 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 291 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 292 | Ga0496102_0000054 | 3300048905 | Bacteria | 175565 |
| 293 | Ga0496102_0098579 | 3300048905 | Bacteria | 2712 |
| 294 | Ga0496102_0187616 | 3300048905 | Bacteria | 1949 |
| 295 | Ga0496103_0000079 | 3300048906 | Bacteria | 110624 |
| 296 | Ga0496103_0008162 | 3300048906 | Bacteria | 6215 |
| 297 | Ga0496103_0065681 | 3300048906 | Bacteria | 2263 |
| 298 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 299 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 300 | Ga0496104_0001123 | 3300048907 | Bacteria | 22922 |
| 301 | Ga0496104_0009399 | 3300048907 | Bacteria | 8696 |
| 302 | Ga0496104_0109443 | 3300048907 | Bacteria | 2648 |
| 303 | Ga0496104_0310494 | 3300048907 | Bacteria | 1490 |
| 304 | Ga0496105_0000031 | 3300048908 | Bacteria | 137220 |
| 305 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 306 | Ga0496105_0000209 | 3300048908 | Bacteria | 39293 |
| 307 | Ga0496105_0006962 | 3300048908 | Bacteria | 8711 |
| 308 | Ga0496105_0010894 | 3300048908 | Bacteria | 7161 |
| 309 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 310 | Ga0496106_0000052 | 3300048909 | Bacteria | 94849 |
| 311 | Ga0496106_0000086 | 3300048909 | Bacteria | 73933 |
| 312 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 313 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 314 | Ga0496107_0052369 | 3300048910 | Bacteria | 2944 |
| 315 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 316 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 317 | Ga0496108_0000153 | 3300048911 | Bacteria | 66080 |
| 318 | Ga0496108_0003787 | 3300048911 | Bacteria | 12109 |
| 319 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 320 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 321 | Ga0496109_0000267 | 3300048912 | Bacteria | 50405 |
| 322 | Ga0496109_0000310 | 3300048912 | Bacteria | 45964 |
| 323 | Ga0496109_0000809 | 3300048912 | Bacteria | 26080 |
| 324 | Ga0496109_0176606 | 3300048912 | Bacteria | 2005 |
| 325 | Ga0496110_0000008 | 3300048913 | Bacteria | 113408 |
| 326 | Ga0496110_0061380 | 3300048913 | Bacteria | 3317 |
| 327 | Ga0496110_0125483 | 3300048913 | Bacteria | 2316 |
| 328 | Ga0496111_0000004 | 3300048914 | Bacteria | 116115 |
| 329 | Ga0496111_0006948 | 3300048914 | Bacteria | 7387 |
| 330 | Ga0496111_0071756 | 3300048914 | Bacteria | 2520 |
| 331 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 332 | Ga0496112_0007130 | 3300048915 | Bacteria | 9891 |
| 333 | Ga0496112_0010774 | 3300048915 | Bacteria | 8315 |
| 334 | Ga0496113_0000030 | 3300048916 | Bacteria | 60123 |
| 335 | Ga0496113_0031520 | 3300048916 | Bacteria | 3848 |
| 336 | Ga0496113_0064161 | 3300048916 | Bacteria | 2776 |
| 337 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 338 | Ga0496114_0014927 | 3300048917 | Bacteria | 6244 |
| 339 | Ga0496114_0221385 | 3300048917 | Bacteria | 1661 |
| 340 | Ga0496115_0000074 | 3300048918 | Bacteria | 90267 |
| 341 | Ga0496115_0000212 | 3300048918 | Bacteria | 53976 |
| 342 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 343 | Ga0496117_0009596 | 3300048920 | Bacteria | 8965 |
| 344 | Ga0496118_0000389 | 3300048921 | Bacteria | 74298 |
| 345 | Ga0496118_0049602 | 3300048921 | Bacteria | 3231 |
| 346 | Ga0496119_0003689 | 3300048922 | Bacteria | 15697 |
| 347 | Ga0496119_0013076 | 3300048922 | Bacteria | 6657 |
| 348 | Ga0496119_0019997 | 3300048922 | Bacteria | 4901 |
| 349 | Ga0496120_0002730 | 3300048923 | Bacteria | 17241 |
| 350 | Ga0496121_0031101 | 3300048924 | Bacteria | 4886 |
| 351 | Ga0496121_0070650 | 3300048924 | Bacteria | 2811 |
| 352 | Ga0496124_0155903 | 3300048927 | Bacteria | 1786 |
| 353 | Ga0496125_0035491 | 3300048928 | Bacteria | 4372 |
| 354 | Ga0496126_0217732 | 3300048929 | Bacteria | 1605 |
| 355 | Ga0501031_0000172 | 3300049568 | Bacteria | 36896 |
| 356 | Ga0501033_0000211 | 3300049570 | Bacteria | 55768 |
| 357 | Ga0501034_0014703 | 3300049571 | Bacteria | 8056 |
| 358 | Ga0501034_0017286 | 3300049571 | Bacteria | 7399 |
| 359 | Ga0501036_0004069 | 3300049572 | Bacteria | 11762 |
| 360 | Ga0501037_0000120 | 3300049573 | Bacteria | 73352 |
| 361 | Ga0501038_0000139 | 3300049574 | Bacteria | 62162 |
| 362 | Ga0501039_0041265 | 3300049575 | Bacteria | 3563 |
| 363 | Ga0501040_0027779 | 3300049576 | Bacteria | 3811 |
| 364 | Ga0501042_0015949 | 3300049578 | Bacteria | 5153 |
| 365 | Ga0501043_0000203 | 3300049579 | Bacteria | 54330 |
| 366 | Ga0501046_0000194 | 3300049580 | Bacteria | 62330 |
| 367 | Ga0501047_0000287 | 3300049581 | Bacteria | 58087 |
| 368 | Ga0501047_0022100 | 3300049581 | Bacteria | 6111 |
| 369 | Ga0501048_0000004 | 3300049582 | Bacteria | 100672 |
| 370 | Ga0501067_0007250 | 3300049583 | Bacteria | 6157 |
| 371 | Ga0501069_0000985 | 3300049585 | Bacteria | 13568 |
| 372 | Ga0501070_0000079 | 3300049586 | Bacteria | 82054 |
| 373 | Ga0501070_0005413 | 3300049586 | Bacteria | 10893 |
| 374 | Ga0501073_0001052 | 3300049589 | Bacteria | 19910 |
| 375 | Ga0501075_0011548 | 3300049591 | Bacteria | 6251 |
| 376 | Ga0501079_0052483 | 3300049741 | Bacteria | 3146 |
| 377 | Ga0501083_0000759 | 3300049744 | Bacteria | 21081 |
| 378 | Ga0501035_0000059 | 3300049822 | Bacteria | 134506 |
| 379 | Ga0501044_0003201 | 3300049823 | Bacteria | 18453 |
| 380 | Ga0501045_0091513 | 3300049824 | Bacteria | 2248 |
| 381 | nmdc:mga06r32_328153_c1 | 3300050510 | Bacteria | 1515 |
| 382 | nmdc:mga0a205_2747_c1 | 3300050515 | Bacteria | 11610 |
| 383 | nmdc:mga0a205_9_c1 | 3300050515 | Bacteria | 55726 |
| 384 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 385 | Ga0495601_0000120 | 3300053077 | Bacteria | 43540 |
| 386 | Ga0495601_0004446 | 3300053077 | Bacteria | 8095 |
| 387 | Ga0495612_0000100 | 3300053078 | Bacteria | 37132 |
| 388 | Ga0495655_0001042 | 3300053083 | Bacteria | 4272 |
| 389 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 390 | Ga0495595_0000117 | 3300053084 | Bacteria | 34251 |
| 391 | Ga0495619_0000020 | 3300053085 | Bacteria | 201556 |
| 392 | Ga0495619_0000046 | 3300053085 | Bacteria | 104451 |
| 393 | Ga0495619_0000129 | 3300053085 | Bacteria | 55936 |
| 394 | Ga0495619_0000626 | 3300053085 | Bacteria | 23392 |
| 395 | Ga0495619_0001343 | 3300053085 | Bacteria | 16123 |
| 396 | Ga0495619_0002283 | 3300053085 | Bacteria | 12644 |
| 397 | Ga0495619_0014328 | 3300053085 | Bacteria | 5009 |
| 398 | Ga0500566_0002230 | 3300053094 | Bacteria | 11446 |
| 399 | Ga0500641_0002499 | 3300053096 | Bacteria | 6501 |
| 400 | Ga0500614_002385 | 3300053123 | Bacteria | 4199 |
| 401 | Ga0500658_0041194 | 3300053134 | Bacteria | 1852 |
| 402 | Ga0500616_0002898 | 3300053153 | Bacteria | 13745 |
| 403 | Ga0501084_0155450 | 3300054114 | Bacteria | 1929 |
| 404 | Ga0501082_0002166 | 3300060353 | Bacteria | 17213 |
| 405 | Ga0495594_0000004 | |||
| 406 | JGI24746J21847_1000681 | |||
| 407 | JGI24740J21852_10001243 | |||
| 408 | JGI24748J21848_1000144 | |||
| 409 | Ga0070683_100003521 | |||
| 410 | Ga0070683_100035102 | |||
| 411 | Ga0070683_100158789 | |||
| 412 | Ga0070677_10000018 | |||
| 413 | Ga0068869_100044938 | |||
| 414 | Ga0070666_10030316 | |||
| 415 | Ga0070682_100000016 | |||
| 416 | Ga0070682_100000029 | |||
| 417 | Ga0068868_100001722 | |||
| 418 | Ga0068868_100010335 | |||
| 419 | Ga0070691_10000083 | |||
| 420 | Ga0070675_100000015 | |||
| 421 | Ga0070674_100000003 | |||
| 422 | Ga0070674_100000028 | |||
| 423 | Ga0070673_100074539 | |||
| 424 | Ga0070688_100000070 | |||
| 425 | Ga0070659_100001759 | |||
| 426 | Ga0070667_100003476 | |||
| 427 | Ga0070667_100076527 | |||
| 428 | Ga0070713_100000014 | |||
| 429 | Ga0070713_100023578 | |||
| 430 | Ga0070711_100022371 | |||
| 431 | Ga0070700_100067091 | |||
| 432 | Ga0070663_100000869 | |||
| 433 | Ga0070662_100000008 | |||
| 434 | Ga0068867_100002065 | |||
| 435 | Ga0070685_10000028 | |||
| 436 | Ga0070679_100000674 | |||
| 437 | Ga0070679_100000812 | |||
| 438 | Ga0070684_100004572 | |||
| 439 | Ga0068853_100244686 | |||
| 440 | Ga0070672_100000858 | |||
| 441 | Ga0070693_100000093 | |||
| 442 | Ga0070665_100000120 | |||
| 443 | Ga0070665_100036132 | |||
| 444 | Ga0070665_100072801 | |||
| 445 | Ga0068854_100003092 | |||
| 446 | Ga0068854_100076010 | |||
| 447 | Ga0068856_100000186 | |||
| 448 | Ga0068856_100005266 | |||
| 449 | Ga0068852_100000013 | |||
| 450 | Ga0068852_100072991 | |||
| 451 | Ga0068864_100000044 | |||
| 452 | Ga0068866_10000002 | |||
| 453 | Ga0068866_10000306 | |||
| 454 | Ga0068851_10000347 | |||
| 455 | Ga0068851_10052210 | |||
| 456 | Ga0068863_100000080 | |||
| 457 | Ga0068863_100014346 | |||
| 458 | Ga0068863_100061635 | |||
| 459 | Ga0068858_100000035 | |||
| 460 | Ga0068858_100000042 | |||
| 461 | Ga0068860_100001897 | |||
| 462 | Ga0068860_100122934 | |||
| 463 | Ga0068862_100003207 | |||
| 464 | Ga0081455_10006118 | |||
| 465 | Ga0081455_10083551 | |||
| 466 | Ga0081540_1000115 | |||
| 467 | Ga0081540_1002319 | |||
| 468 | Ga0081539_10000674 | |||
| 469 | Ga0081539_10002431 | |||
| 470 | Ga0070715_10000015 | |||
| 471 | Ga0070712_100113678 | |||
| 472 | Ga0075433_10000031 | |||
| 473 | Ga0075433_10011318 | |||
| 474 | Ga0068865_100000001 | |||
| 475 | Ga0105245_10000045 | |||
| 476 | Ga0105245_10000053 | |||
| 477 | Ga0105245_10000488 | |||
| 478 | Ga0105245_10013033 | |||
| 479 | Ga0105247_10000169 | |||
| 480 | Ga0105242_10001870 | |||
| 481 | Ga0105242_10212645 | |||
| 482 | Ga0105248_10000089 | |||
| 483 | Ga0105238_10001238 | |||
| 484 | Ga0105249_10000095 | |||
| 485 | Ga0105249_10003796 | |||
| 486 | Ga0157369_10000037 | |||
| 487 | Ga0157374_10004334 | |||
| 488 | Ga0157374_10053794 | |||
| 489 | Ga0157372_10000064 | |||
| 490 | Ga0157375_10000076 | |||
| 491 | Ga0157375_10082274 | |||
| 492 | Ga0163163_10158747 | |||
| 493 | Ga0163163_10242440 | |||
| 494 | Ga0157380_10000118 | |||
| 495 | Ga0157380_10000163 | |||
| 496 | Ga0157379_10036417 | |||
| 497 | Ga0157379_10039730 | |||
| 498 | Ga0157379_10080392 | |||
| 499 | Ga0163161_10000058 | |||
| 500 | Ga0207656_10000168 | |||
| 501 | Ga0207656_10007949 | |||
| 502 | Ga0207682_10000047 | |||
| 503 | Ga0207642_10000001 | |||
| 504 | Ga0207642_10000003 | |||
| 505 | Ga0207642_10000058 | |||
| 506 | Ga0207710_10000103 | |||
| 507 | Ga0207680_10015660 | |||
| 508 | Ga0207685_10000001 | |||
| 509 | Ga0207707_10072554 | |||
| 510 | Ga0207693_10128505 | |||
| 511 | Ga0207663_10001124 | |||
| 512 | Ga0207649_10000025 | |||
| 513 | Ga0207652_10000385 | |||
| 514 | Ga0207652_10000544 | |||
| 515 | Ga0207694_10000067 | |||
| 516 | Ga0207659_10000032 | |||
| 517 | Ga0207687_10000021 | |||
| 518 | Ga0207687_10000023 | |||
| 519 | Ga0207687_10000241 | |||
| 520 | Ga0207700_10000009 | |||
| 521 | Ga0207700_10023878 | |||
| 522 | Ga0207700_10077893 | |||
| 523 | Ga0207690_10001315 | |||
| 524 | Ga0207706_10000016 | |||
| 525 | Ga0207686_10000016 | |||
| 526 | Ga0207686_10000029 | |||
| 527 | Ga0207686_10000189 | |||
| 528 | Ga0207669_10000014 | |||
| 529 | Ga0207669_10000024 | |||
| 530 | Ga0207704_10000004 | |||
| 531 | Ga0207691_10000062 | |||
| 532 | Ga0207711_10000083 | |||
| 533 | Ga0207689_10057960 | |||
| 534 | Ga0207661_10000064 | |||
| 535 | Ga0207661_10000086 | |||
| 536 | Ga0207661_10014619 | |||
| 537 | Ga0207661_10058811 | |||
| 538 | Ga0207651_10008539 | |||
| 539 | Ga0207712_10000003 | |||
| 540 | Ga0207712_10007185 | |||
| 541 | Ga0207668_10005659 | |||
| 542 | Ga0207668_10135287 | |||
| 543 | Ga0207640_10001945 | |||
| 544 | Ga0207640_10057361 | |||
| 545 | Ga0207658_10007026 | |||
| 546 | Ga0207658_10057656 | |||
| 547 | Ga0207677_10000429 | |||
| 548 | Ga0207677_10000783 | |||
| 549 | Ga0207703_10000060 | |||
| 550 | Ga0207703_10000067 | |||
| 551 | Ga0207678_10006240 | |||
| 552 | Ga0207678_10144558 | |||
| 553 | Ga0207708_10089536 | |||
| 554 | Ga0207702_10000134 | |||
| 555 | Ga0207702_10002492 | |||
| 556 | Ga0207641_10000304 | |||
| 557 | Ga0207641_10010570 | |||
| 558 | Ga0207641_10051176 | |||
| 559 | Ga0207648_10004663 | |||
| 560 | Ga0207676_10000043 | |||
| 561 | Ga0207698_10000002 | |||
| 562 | Ga0207698_10094003 | |||
| 563 | Ga0268266_10000023 | |||
| 564 | Ga0268266_10000748 | |||
| 565 | Ga0268266_10001671 | |||
| 566 | Ga0268264_10007035 | |||
| 567 | Ga0268264_10092456 | |||
| 568 | Ga0268264_10092707 | |||
| 569 | Ga0265337_1000013 | |||
| 570 | Ga0265326_10000012 | |||
| 571 | Ga0265319_1000044 | |||
| 572 | Ga0265322_10000003 | |||
| 573 | Ga0265336_10002629 | |||
| 574 | Ga0265336_10020020 | |||
| 575 | Ga0265338_10000297 | |||
| 576 | Ga0265324_10000226 | |||
| 577 | Ga0265328_10000723 | |||
| 578 | Ga0265320_10000001 | |||
| 579 | Ga0265325_10038231 | |||
| 580 | Ga0265329_10006990 | |||
| 581 | Ga0265339_10016758 | |||
| 582 | Ga0265331_10001141 | |||
| 583 | Ga0265327_10000003 | |||
| 584 | Ga0265314_10000044 | |||
| 585 | Ga0307409_100048696 | |||
| 586 | Ga0307416_100097208 | |||
| 587 | Ga0307415_100010927 | |||
| 588 | Ga0373941_0003716 | |||
| 589 | Ga0373954_0033072 | |||
| 590 | Ga0373937_0043910 | |||
| 591 | Ga0395905_0129758 | |||
| 592 | Ga0395901_0364611 | |||
| 593 | Ga0451853_3827414 | |||
| 594 | Ga0466963_0000027 | |||
| 595 | Ga0466963_0198487 | |||
| 596 | Ga0466957_0012306 | |||
| 597 | Ga0466960_0000138 | |||
| 598 | Ga0466967_0000004 | |||
| 599 | Ga0466967_0009623 | |||
| 600 | Ga0495592_0000518 | |||
| 601 | Ga0495603_0000554 | |||
| 602 | Ga0495603_0001096 | |||
| 603 | Ga0495603_0009964 | |||
| 604 | Ga0495629_0000014 | |||
| 605 | Ga0495629_0014779 | |||
| 606 | Ga0495629_0016189 | |||
| 607 | Ga0495638_0043328 | |||
| 608 | Ga0495641_0000001 | |||
| 609 | Ga0495641_0003587 | |||
| 610 | Ga0495651_0057675 | |||
| 611 | Ga0495653_0050094 | |||
| 612 | Ga0495653_0054474 | |||
| 613 | Ga0495650_0000049 | |||
| 614 | Ga0495582_0000012 | |||
| 615 | Ga0495662_0000118 | |||
| 616 | Ga0495606_0000045 | |||
| 617 | Ga0495608_0000001 | |||
| 618 | Ga0495608_0004473 | |||
| 619 | Ga0495608_0008111 | |||
| 620 | Ga0495608_0060125 | |||
| 621 | Ga0495618_0000068 | |||
| 622 | Ga0495620_0000428 | |||
| 623 | Ga0495628_0000070 | |||
| 624 | Ga0495628_0026077 | |||
| 625 | Ga0495628_0029686 | |||
| 626 | Ga0495628_0046594 | |||
| 627 | Ga0495628_0069017 | |||
| 628 | Ga0495628_0097120 | |||
| 629 | Ga0495630_0000007 | |||
| 630 | Ga0495630_0000312 | |||
| 631 | Ga0495630_0013070 | |||
| 632 | Ga0495631_0010422 | |||
| 633 | Ga0495644_0000296 | |||
| 634 | Ga0495652_0000066 | |||
| 635 | Ga0495652_0004909 | |||
| 636 | Ga0495640_0013109 | |||
| 637 | Ga0495587_0005907 | |||
| 638 | Ga0495587_0050690 | |||
| 639 | Ga0495598_0007191 | |||
| 640 | Ga0495621_0006932 | |||
| 641 | Ga0495645_0012182 | |||
| 642 | Ga0495622_0000016 | |||
| 643 | Ga0495633_0050903 | |||
| 644 | Ga0495667_0000015 | |||
| 645 | Ga0495634_0000187 | |||
| 646 | Ga0495634_0000755 | |||
| 647 | Ga0495634_0012777 | |||
| 648 | Ga0495625_0000020 | |||
| 649 | Ga0495635_0000036 | |||
| 650 | Ga0495635_0010660 | |||
| 651 | Ga0495588_0000217 | |||
| 652 | Ga0495657_0000002 | |||
| 653 | Ga0495657_0057749 | |||
| 654 | Ga0495599_0014638 | |||
| 655 | Ga0495647_0000013 | |||
| 656 | Ga0495647_0000059 | |||
| 657 | Ga0495647_0001175 | |||
| 658 | Ga0495658_0000024 | |||
| 659 | Ga0495658_0003615 | |||
| 660 | Ga0495669_0000251 | |||
| 661 | Ga0495669_0068590 | |||
| 662 | Ga0495613_0000040 | |||
| 663 | Ga0495613_0000159 | |||
| 664 | Ga0495624_0000013 | |||
| 665 | Ga0495624_0001178 | |||
| 666 | Ga0495624_0016229 | |||
| 667 | Ga0495649_0004295 | |||
| 668 | Ga0495600_0003198 | |||
| 669 | Ga0495600_0015263 | |||
| 670 | Ga0495600_0061142 | |||
| 671 | Ga0495604_0001650 | |||
| 672 | Ga0495604_0080054 | |||
| 673 | Ga0495674_0000025 | |||
| 674 | Ga0495674_0102581 | |||
| 675 | Ga0495676_0000091 | |||
| 676 | Ga0495676_0000252 | |||
| 677 | Ga0495680_0000023 | |||
| 678 | Ga0495680_0000286 | |||
| 679 | Ga0495680_0003127 | |||
| 680 | Ga0495680_0019259 | |||
| 681 | Ga0495675_0000019 | |||
| 682 | Ga0495675_0011076 | |||
| 683 | Ga0495673_0009117 | |||
| 684 | Ga0495684_0160577 | |||
| 685 | Ga0495686_0000003 | |||
| 686 | Ga0495686_0021687 | |||
| 687 | Ga0495593_0020262 | |||
| 688 | Ga0495593_0095243 | |||
| 689 | Ga0495602_0000010 | |||
| 690 | Ga0495602_0002159 | |||
| 691 | Ga0495602_0178258 | |||
| 692 | Ga0496100_0000003 | |||
| 693 | Ga0496100_0000008 | |||
| 694 | Ga0496101_0000003 | |||
| 695 | Ga0496101_0000016 | |||
| 696 | Ga0496102_0000054 | |||
| 697 | Ga0496102_0098579 | |||
| 698 | Ga0496102_0187616 | |||
| 699 | Ga0496103_0000079 | |||
| 700 | Ga0496103_0008162 | |||
| 701 | Ga0496103_0065681 | |||
| 702 | Ga0496104_0000003 | |||
| 703 | Ga0496104_0000063 | |||
| 704 | Ga0496104_0001123 | |||
| 705 | Ga0496104_0009399 | |||
| 706 | Ga0496104_0109443 | |||
| 707 | Ga0496104_0310494 | |||
| 708 | Ga0496105_0000031 | |||
| 709 | Ga0496105_0000041 | |||
| 710 | Ga0496105_0000209 | |||
| 711 | Ga0496105_0006962 | |||
| 712 | Ga0496105_0010894 | |||
| 713 | Ga0496106_0000048 | |||
| 714 | Ga0496106_0000052 | |||
| 715 | Ga0496106_0000086 | |||
| 716 | Ga0496107_0000008 | |||
| 717 | Ga0496107_0000009 | |||
| 718 | Ga0496107_0052369 | |||
| 719 | Ga0496108_0000002 | |||
| 720 | Ga0496108_0000024 | |||
| 721 | Ga0496108_0000153 | |||
| 722 | Ga0496108_0003787 | |||
| 723 | Ga0496109_0000001 | |||
| 724 | Ga0496109_0000033 | |||
| 725 | Ga0496109_0000267 | |||
| 726 | Ga0496109_0000310 | |||
| 727 | Ga0496109_0000809 | |||
| 728 | Ga0496109_0176606 | |||
| 729 | Ga0496110_0000008 | |||
| 730 | Ga0496110_0061380 | |||
| 731 | Ga0496110_0125483 | |||
| 732 | Ga0496111_0000004 | |||
| 733 | Ga0496111_0006948 | |||
| 734 | Ga0496111_0071756 | |||
| 735 | Ga0496112_0000002 | |||
| 736 | Ga0496112_0007130 | |||
| 737 | Ga0496112_0010774 | |||
| 738 | Ga0496113_0000030 | |||
| 739 | Ga0496113_0031520 | |||
| 740 | Ga0496113_0064161 | |||
| 741 | Ga0496114_0000010 | |||
| 742 | Ga0496114_0014927 | |||
| 743 | Ga0496114_0221385 | |||
| 744 | Ga0496115_0000074 | |||
| 745 | Ga0496115_0000212 | |||
| 746 | Ga0496116_0000014 | |||
| 747 | Ga0496117_0009596 | |||
| 748 | Ga0496118_0000389 | |||
| 749 | Ga0496118_0049602 | |||
| 750 | Ga0496119_0003689 | |||
| 751 | Ga0496119_0013076 | |||
| 752 | Ga0496119_0019997 | |||
| 753 | Ga0496120_0002730 | |||
| 754 | Ga0496121_0031101 | |||
| 755 | Ga0496121_0070650 | |||
| 756 | Ga0496124_0155903 | |||
| 757 | Ga0496125_0035491 | |||
| 758 | Ga0496126_0217732 | |||
| 759 | Ga0501031_0000172 | |||
| 760 | Ga0501033_0000211 | |||
| 761 | Ga0501034_0014703 | |||
| 762 | Ga0501034_0017286 | |||
| 763 | Ga0501036_0004069 | |||
| 764 | Ga0501037_0000120 | |||
| 765 | Ga0501038_0000139 | |||
| 766 | Ga0501039_0041265 | |||
| 767 | Ga0501040_0027779 | |||
| 768 | Ga0501042_0015949 | |||
| 769 | Ga0501043_0000203 | |||
| 770 | Ga0501046_0000194 | |||
| 771 | Ga0501047_0000287 | |||
| 772 | Ga0501047_0022100 | |||
| 773 | Ga0501048_0000004 | |||
| 774 | Ga0501067_0007250 | |||
| 775 | Ga0501069_0000985 | |||
| 776 | Ga0501070_0000079 | |||
| 777 | Ga0501070_0005413 | |||
| 778 | Ga0501073_0001052 | |||
| 779 | Ga0501075_0011548 | |||
| 780 | Ga0501079_0052483 | |||
| 781 | Ga0501083_0000759 | |||
| 782 | Ga0501035_0000059 | |||
| 783 | Ga0501044_0003201 | |||
| 784 | Ga0501045_0091513 | |||
| 785 | nmdc:mga06r32_328153_c1 | |||
| 786 | nmdc:mga0a205_2747_c1 | |||
| 787 | nmdc:mga0a205_9_c1 | |||
| 788 | Ga0495601_0000012 | |||
| 789 | Ga0495601_0000120 | |||
| 790 | Ga0495601_0004446 | |||
| 791 | Ga0495612_0000100 | |||
| 792 | Ga0495655_0001042 | |||
| 793 | Ga0495595_0000001 | |||
| 794 | Ga0495595_0000117 | |||
| 795 | Ga0495619_0000020 | |||
| 796 | Ga0495619_0000046 | |||
| 797 | Ga0495619_0000129 | |||
| 798 | Ga0495619_0000626 | |||
| 799 | Ga0495619_0001343 | |||
| 800 | Ga0495619_0002283 | |||
| 801 | Ga0495619_0014328 | |||
| 802 | Ga0500566_0002230 | |||
| 803 | Ga0500641_0002499 | |||
| 804 | Ga0500614_002385 | |||
| 805 | Ga0500658_0041194 | |||
| 806 | Ga0500616_0002898 | |||
| 807 | Ga0501084_0155450 | |||
| 808 | Ga0501082_0002166 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zc0-assembly1.cif.gz_A | crystal structure of an archaeal alanine:glyoxylate aminotransferase | 0.9445 | 20 | 415 |
| 2z1y-assembly1.cif.gz_A | crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 | 0.9423 | 20 | 419 |
| 2zp7-assembly3.cif.gz_F | crystal structure of lysn, alpha-aminoadipate aminotransferase (leucine complex), from thermus thermophilus hb27 | 0.9382 | 20 | 415 |
| 2z1y-assembly1.cif.gz_A | crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 | 0.933 | 20 | 419 |
| 3av7-assembly1.cif.gz_A | crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products | 0.9283 | 16 | 415 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zc0A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9599 | 83 | 306 | 3.40.640.10 |
| 1vp4B02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.951 | 83 | 304 | 3.40.640.10 |
| 2zc0A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9476 | 83 | 306 | 3.40.640.10 |
| 2z1yA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9461 | 306 | 419 | 3.90.1150.10 |
| 3aovA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9445 | 83 | 306 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6V8NP89-F1-model_v4 | 2-aminoadipate transaminase | 0.9777 | 89 | 426 |
GO:0008483
GO:0009058 GO:0030170 GO:1901605 |
| AF-A0A6I0DZS2-F1-model_v4 | PLP-dependent aminotransferase family protein | 0.9731 | 101 | 420 |
GO:0008483
GO:0009058 GO:0030170 GO:1901605 |
| AF-A0A6V8NP89-F1-model_v4 | 2-aminoadipate transaminase | 0.9692 | 89 | 426 |
GO:0008483
GO:0009058 GO:0030170 GO:1901605 |
| AF-A0A7J9WHI1-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9667 | 31 | 423 |
GO:0008483
GO:0009058 GO:0030170 GO:1901605 |
| AF-A0A1F9UR80-F1-model_v4 | Aminotransferase class I/classII large domain-containing protein | 0.9643 | 27 | 414 |
GO:0008483
GO:0009058 GO:0030170 GO:1901605 |