F435754

General Info

Members Datasets Scaffolds Average Seq Length
404 241 808 457

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0000004|Ga0495594_0000004_140566_142062
Length 498
Sequence MGAGGPGEHADRDAYPQLSKNVHMRKPNRPGARASIRHTSRMAEVPQPPYRRRARASSRDLERYAGLFAGRTAVMRSSAMRDLMAITARPEVISLAGGLPDTSTFPPESFAAEMTRIAQKSAAEALQYGPTEGFEETKDCILEVMGAEGMLPEHDDVIVTTGGQQAIDLICKTLVDPGDVVICEAPTYPGAVPTFCSYEADVIQIECDQEGMRVEELEPLLDRLQSEGRHPKFVYSVPTFQNPAGVTMSLPRRRQLVELARSRELLVVEDNPYGLLRYSGEPLPPLYQLDGGDFVLYIGTFSKILSPGIRLGWAVAPPPVMDKIVLGKQAADLCSSTLTQYFVREYFAEGRWREYIEELVGIYRRRRDTMVAALHEHFPAEATWTEPQGGLFIWATLPGYIDTSDLLAKALRADVAFVPGQAAFVAERGGNSMRLNFSGVDEDEIREGIRRIGKVIDEQVELYGALTGEHRLPSREPAAEEPAEENVVPFRRSGEGAG

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 13.37
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0000004 3300046499 Bacteria 195881
2 JGI24746J21847_1000681 3300001977 Bacteria 5202
3 JGI24740J21852_10001243 3300001979 Bacteria 11534
4 JGI24748J21848_1000144 3300002074 Bacteria 11985
5 Ga0070683_100003521 3300005329 Bacteria 12744
6 Ga0070683_100035102 3300005329 Bacteria 4584
7 Ga0070683_100158789 3300005329 Bacteria 2145
8 Ga0070677_10000018 3300005333 Bacteria 51146
9 Ga0068869_100044938 3300005334 Bacteria 3178
10 Ga0070666_10030316 3300005335 Bacteria 3562
11 Ga0070682_100000016 3300005337 Bacteria 239799
12 Ga0070682_100000029 3300005337 Bacteria 183516
13 Ga0068868_100001722 3300005338 Bacteria 14978
14 Ga0068868_100010335 3300005338 Bacteria 6750
15 Ga0070691_10000083 3300005341 Bacteria 26414
16 Ga0070675_100000015 3300005354 Bacteria 201080
17 Ga0070674_100000003 3300005356 Bacteria 258221
18 Ga0070674_100000028 3300005356 Bacteria 69584
19 Ga0070673_100074539 3300005364 Bacteria 2735
20 Ga0070688_100000070 3300005365 Bacteria 50587
21 Ga0070659_100001759 3300005366 Bacteria 15569
22 Ga0070667_100003476 3300005367 Bacteria 13422
23 Ga0070667_100076527 3300005367 Bacteria 2857
24 Ga0070713_100000014 3300005436 Bacteria 124804
25 Ga0070713_100023578 3300005436 Bacteria 4778
26 Ga0070711_100022371 3300005439 Bacteria 4097
27 Ga0070700_100067091 3300005441 Bacteria 2279
28 Ga0070663_100000869 3300005455 Bacteria 16439
29 Ga0070662_100000008 3300005457 Bacteria 168754
30 Ga0068867_100002065 3300005459 Bacteria 14077
31 Ga0070685_10000028 3300005466 Bacteria 90128
32 Ga0070679_100000674 3300005530 Bacteria 29110
33 Ga0070679_100000812 3300005530 Bacteria 27087
34 Ga0070684_100004572 3300005535 Bacteria 10549
35 Ga0068853_100244686 3300005539 Bacteria 1645
36 Ga0070672_100000858 3300005543 Bacteria 18170
37 Ga0070693_100000093 3300005547 Bacteria 38785
38 Ga0070665_100000120 3300005548 Bacteria 148340
39 Ga0070665_100036132 3300005548 Bacteria 4971
40 Ga0070665_100072801 3300005548 Bacteria 3443
41 Ga0068854_100003092 3300005578 Bacteria 10364
42 Ga0068854_100076010 3300005578 Bacteria 2467
43 Ga0068856_100000186 3300005614 Bacteria 64970
44 Ga0068856_100005266 3300005614 Bacteria 12756
45 Ga0068852_100000013 3300005616 Bacteria 139537
46 Ga0068852_100072991 3300005616 Bacteria 3018
47 Ga0068864_100000044 3300005618 Bacteria 157919
48 Ga0068866_10000002 3300005718 Bacteria 394090
49 Ga0068866_10000306 3300005718 Bacteria 23392
50 Ga0068851_10000347 3300005834 Bacteria 20830
51 Ga0068851_10052210 3300005834 Bacteria 2078
52 Ga0068863_100000080 3300005841 Bacteria 106670
53 Ga0068863_100014346 3300005841 Bacteria 7631
54 Ga0068863_100061635 3300005841 Bacteria 3547
55 Ga0068858_100000035 3300005842 Bacteria 140466
56 Ga0068858_100000042 3300005842 Bacteria 132482
57 Ga0068860_100001897 3300005843 Bacteria 22186
58 Ga0068860_100122934 3300005843 Bacteria 2486
59 Ga0068862_100003207 3300005844 Bacteria 14173
60 Ga0081455_10006118 3300005937 Bacteria 13005
61 Ga0081455_10083551 3300005937 Unclassified 2609
62 Ga0081540_1000115 3300005983 Bacteria 84188
63 Ga0081540_1002319 3300005983 Bacteria 15596
64 Ga0081539_10000674 3300005985 Bacteria 68446
65 Ga0081539_10002431 3300005985 Bacteria 26296
66 Ga0070715_10000015 3300006163 Bacteria 152816
67 Ga0070712_100113678 3300006175 Unclassified 2025
68 Ga0075433_10000031 3300006852 Bacteria 55735
69 Ga0075433_10011318 3300006852 Bacteria 7181
70 Ga0068865_100000001 3300006881 Bacteria 288199
71 Ga0105245_10000045 3300009098 Bacteria 134057
72 Ga0105245_10000053 3300009098 Bacteria 125678
73 Ga0105245_10000488 3300009098 Bacteria 36321
74 Ga0105245_10013033 3300009098 Bacteria 7244
75 Ga0105247_10000169 3300009101 Bacteria 64387
76 Ga0105242_10001870 3300009176 Bacteria 16542
77 Ga0105242_10212645 3300009176 Bacteria 1724
78 Ga0105248_10000089 3300009177 Bacteria 102101
79 Ga0105238_10001238 3300009551 Bacteria 25694
80 Ga0105249_10000095 3300009553 Bacteria 121300
81 Ga0105249_10003796 3300009553 Bacteria 13043
82 Ga0157369_10000037 3300013105 Bacteria 190395
83 Ga0157374_10004334 3300013296 Bacteria 11938
84 Ga0157374_10053794 3300013296 Bacteria 3754
85 Ga0157372_10000064 3300013307 Bacteria 114648
86 Ga0157375_10000076 3300013308 Bacteria 101715
87 Ga0157375_10082274 3300013308 Bacteria 3261
88 Ga0163163_10158747 3300014325 Unclassified 2306
89 Ga0163163_10242440 3300014325 Bacteria 1852
90 Ga0157380_10000118 3300014326 Bacteria 43745
91 Ga0157380_10000163 3300014326 Bacteria 38484
92 Ga0157379_10036417 3300014968 Bacteria 4388
93 Ga0157379_10039730 3300014968 Bacteria 4198
94 Ga0157379_10080392 3300014968 Bacteria 2920
95 Ga0163161_10000058 3300017792 Bacteria 114035
96 Ga0207656_10000168 3300025321 Bacteria 24193
97 Ga0207656_10007949 3300025321 Bacteria 3888
98 Ga0207682_10000047 3300025893 Bacteria 51208
99 Ga0207642_10000001 3300025899 Bacteria 714030
100 Ga0207642_10000003 3300025899 Bacteria 650651
101 Ga0207642_10000058 3300025899 Bacteria 33156
102 Ga0207710_10000103 3300025900 Bacteria 109033
103 Ga0207680_10015660 3300025903 Bacteria 3964
104 Ga0207685_10000001 3300025905 Bacteria 604473
105 Ga0207707_10072554 3300025912 Bacteria 3001
106 Ga0207693_10128505 3300025915 Unclassified 1992
107 Ga0207663_10001124 3300025916 Bacteria 12316
108 Ga0207649_10000025 3300025920 Bacteria 177532
109 Ga0207652_10000385 3300025921 Bacteria 45964
110 Ga0207652_10000544 3300025921 Bacteria 38182
111 Ga0207694_10000067 3300025924 Bacteria 128108
112 Ga0207659_10000032 3300025926 Bacteria 119492
113 Ga0207687_10000021 3300025927 Bacteria 226396
114 Ga0207687_10000023 3300025927 Bacteria 217098
115 Ga0207687_10000241 3300025927 Bacteria 37298
116 Ga0207700_10000009 3300025928 Bacteria 314953
117 Ga0207700_10023878 3300025928 Bacteria 4225
118 Ga0207700_10077893 3300025928 Unclassified 2577
119 Ga0207690_10001315 3300025932 Bacteria 15617
120 Ga0207706_10000016 3300025933 Bacteria 170697
121 Ga0207686_10000016 3300025934 Bacteria 198779
122 Ga0207686_10000029 3300025934 Bacteria 160239
123 Ga0207686_10000189 3300025934 Bacteria 47718
124 Ga0207669_10000014 3300025937 Bacteria 129145
125 Ga0207669_10000024 3300025937 Bacteria 96123
126 Ga0207704_10000004 3300025938 Bacteria 239295
127 Ga0207691_10000062 3300025940 Bacteria 85448
128 Ga0207711_10000083 3300025941 Bacteria 102109
129 Ga0207689_10057960 3300025942 Bacteria 3186
130 Ga0207661_10000064 3300025944 Bacteria 75730
131 Ga0207661_10000086 3300025944 Bacteria 64501
132 Ga0207661_10014619 3300025944 Bacteria 5756
133 Ga0207661_10058811 3300025944 Bacteria 3095
134 Ga0207651_10008539 3300025960 Bacteria 5538
135 Ga0207712_10000003 3300025961 Bacteria 615314
136 Ga0207712_10007185 3300025961 Bacteria 7026
137 Ga0207668_10005659 3300025972 Bacteria 7355
138 Ga0207668_10135287 3300025972 Bacteria 1888
139 Ga0207640_10001945 3300025981 Bacteria 11120
140 Ga0207640_10057361 3300025981 Bacteria 2561
141 Ga0207658_10007026 3300025986 Bacteria 7662
142 Ga0207658_10057656 3300025986 Bacteria 2887
143 Ga0207677_10000429 3300026023 Bacteria 28292
144 Ga0207677_10000783 3300026023 Bacteria 18211
145 Ga0207703_10000060 3300026035 Bacteria 134334
146 Ga0207703_10000067 3300026035 Bacteria 125623
147 Ga0207678_10006240 3300026067 Bacteria 10589
148 Ga0207678_10144558 3300026067 Bacteria 2030
149 Ga0207708_10089536 3300026075 Bacteria 2372
150 Ga0207702_10000134 3300026078 Bacteria 88324
151 Ga0207702_10002492 3300026078 Bacteria 17387
152 Ga0207641_10000304 3300026088 Bacteria 61194
153 Ga0207641_10010570 3300026088 Bacteria 7573
154 Ga0207641_10051176 3300026088 Bacteria 3498
155 Ga0207648_10004663 3300026089 Bacteria 14027
156 Ga0207676_10000043 3300026095 Bacteria 161948
157 Ga0207698_10000002 3300026142 Bacteria 404991
158 Ga0207698_10094003 3300026142 Bacteria 2463
159 Ga0268266_10000023 3300028379 Bacteria 501899
160 Ga0268266_10000748 3300028379 Bacteria 43458
161 Ga0268266_10001671 3300028379 Bacteria 25564
162 Ga0268264_10007035 3300028381 Bacteria 9436
163 Ga0268264_10092456 3300028381 Bacteria 2611
164 Ga0268264_10092707 3300028381 Bacteria 2608
165 Ga0265337_1000013 3300028556 Bacteria 82926
166 Ga0265326_10000012 3300028558 Bacteria 175352
167 Ga0265319_1000044 3300028563 Bacteria 103641
168 Ga0265322_10000003 3300028654 Bacteria 468671
169 Ga0265336_10002629 3300028666 Bacteria 7298
170 Ga0265336_10020020 3300028666 Bacteria 2153
171 Ga0265338_10000297 3300028800 Bacteria 89764
172 Ga0265324_10000226 3300029957 Bacteria 42741
173 Ga0265328_10000723 3300031239 Bacteria 15312
174 Ga0265320_10000001 3300031240 Bacteria 847191
175 Ga0265325_10038231 3300031241 Bacteria 2533
176 Ga0265329_10006990 3300031242 Bacteria 4411
177 Ga0265339_10016758 3300031249 Bacteria 4360
178 Ga0265331_10001141 3300031250 Bacteria 20260
179 Ga0265327_10000003 3300031251 Bacteria 852750
180 Ga0265314_10000044 3300031711 Bacteria 207337
181 Ga0307409_100048696 3300031995 Bacteria 3227
182 Ga0307416_100097208 3300032002 Bacteria 2549
183 Ga0307415_100010927 3300032126 Bacteria 5166
184 Ga0373941_0003716 3300035115 Bacteria 3479
185 Ga0373954_0033072 3300035118 Bacteria 2393
186 Ga0373937_0043910 3300036401 Bacteria 4082
187 Ga0395905_0129758 3300037471 Bacteria 2371
188 Ga0395901_0364611 3300038443 Unclassified 1489
189 Ga0451853_3827414 3300041512 Bacteria 6651
190 Ga0466963_0000027 3300044694 Bacteria 48596
191 Ga0466963_0198487 3300044694 Bacteria 1403
192 Ga0466957_0012306 3300044842 Bacteria 4953
193 Ga0466960_0000138 3300044901 Bacteria 24715
194 Ga0466967_0000004 3300045976 Bacteria 155664
195 Ga0466967_0009623 3300045976 Bacteria 7183
196 Ga0495592_0000518 3300046454 Bacteria 27890
197 Ga0495603_0000554 3300046455 Bacteria 20910
198 Ga0495603_0001096 3300046455 Bacteria 15726
199 Ga0495603_0009964 3300046455 Bacteria 5750
200 Ga0495629_0000014 3300046459 Bacteria 201801
201 Ga0495629_0014779 3300046459 Bacteria 5616
202 Ga0495629_0016189 3300046459 Bacteria 5352
203 Ga0495638_0043328 3300046460 Bacteria 2839
204 Ga0495641_0000001 3300046461 Bacteria 485224
205 Ga0495641_0003587 3300046461 Bacteria 11512
206 Ga0495651_0057675 3300046462 Bacteria 2981
207 Ga0495653_0050094 3300046463 Bacteria 3213
208 Ga0495653_0054474 3300046463 Bacteria 3056
209 Ga0495650_0000049 3300046471 Bacteria 325092
210 Ga0495582_0000012 3300046473 Bacteria 112893
211 Ga0495662_0000118 3300046476 Bacteria 29672
212 Ga0495606_0000045 3300046507 Bacteria 212105
213 Ga0495608_0000001 3300046511 Bacteria 411278
214 Ga0495608_0004473 3300046511 Bacteria 9988
215 Ga0495608_0008111 3300046511 Bacteria 7382
216 Ga0495608_0060125 3300046511 Bacteria 2501
217 Ga0495618_0000068 3300046514 Bacteria 74614
218 Ga0495620_0000428 3300046515 Bacteria 28031
219 Ga0495628_0000070 3300046516 Bacteria 80592
220 Ga0495628_0026077 3300046516 Bacteria 4772
221 Ga0495628_0029686 3300046516 Bacteria 4432
222 Ga0495628_0046594 3300046516 Bacteria 3443
223 Ga0495628_0069017 3300046516 Bacteria 2757
224 Ga0495628_0097120 3300046516 Bacteria 2276
225 Ga0495630_0000007 3300046517 Bacteria 376915
226 Ga0495630_0000312 3300046517 Bacteria 38816
227 Ga0495630_0013070 3300046517 Bacteria 6035
228 Ga0495631_0010422 3300046518 Bacteria 4598
229 Ga0495644_0000296 3300046523 Bacteria 23051
230 Ga0495652_0000066 3300046529 Bacteria 109895
231 Ga0495652_0004909 3300046529 Bacteria 12688
232 Ga0495640_0013109 3300046533 Bacteria 6309
233 Ga0495587_0005907 3300046536 Bacteria 7981
234 Ga0495587_0050690 3300046536 Bacteria 2456
235 Ga0495598_0007191 3300046537 Bacteria 2544
236 Ga0495621_0006932 3300046539 Bacteria 3333
237 Ga0495645_0012182 3300046543 Bacteria 6056
238 Ga0495622_0000016 3300046557 Bacteria 177089
239 Ga0495633_0050903 3300046558 Bacteria 1952
240 Ga0495667_0000015 3300046559 Bacteria 200377
241 Ga0495634_0000187 3300046642 Bacteria 57203
242 Ga0495634_0000755 3300046642 Bacteria 31302
243 Ga0495634_0012777 3300046642 Bacteria 6078
244 Ga0495625_0000020 3300046660 Bacteria 290440
245 Ga0495635_0000036 3300046663 Bacteria 95138
246 Ga0495635_0010660 3300046663 Bacteria 6436
247 Ga0495588_0000217 3300046674 Bacteria 54461
248 Ga0495657_0000002 3300046675 Bacteria 411958
249 Ga0495657_0057749 3300046675 Bacteria 2579
250 Ga0495599_0014638 3300046678 Bacteria 4858
251 Ga0495647_0000013 3300046681 Bacteria 88029
252 Ga0495647_0000059 3300046681 Bacteria 27437
253 Ga0495647_0001175 3300046681 Bacteria 8050
254 Ga0495658_0000024 3300046683 Bacteria 81300
255 Ga0495658_0003615 3300046683 Bacteria 7654
256 Ga0495669_0000251 3300046684 Bacteria 31256
257 Ga0495669_0068590 3300046684 Bacteria 1613
258 Ga0495613_0000040 3300046689 Bacteria 131633
259 Ga0495613_0000159 3300046689 Bacteria 65969
260 Ga0495624_0000013 3300046690 Bacteria 115278
261 Ga0495624_0001178 3300046690 Bacteria 20710
262 Ga0495624_0016229 3300046690 Bacteria 5015
263 Ga0495649_0004295 3300046694 Bacteria 9350
264 Ga0495600_0003198 3300046809 Bacteria 9590
265 Ga0495600_0015263 3300046809 Bacteria 4854
266 Ga0495600_0061142 3300046809 Bacteria 2460
267 Ga0495604_0001650 3300047317 Bacteria 18348
268 Ga0495604_0080054 3300047317 Bacteria 2449
269 Ga0495674_0000025 3300047319 Bacteria 141103
270 Ga0495674_0102581 3300047319 Bacteria 2433
271 Ga0495676_0000091 3300047321 Bacteria 66575
272 Ga0495676_0000252 3300047321 Bacteria 43212
273 Ga0495680_0000023 3300047322 Bacteria 116444
274 Ga0495680_0000286 3300047322 Bacteria 56839
275 Ga0495680_0003127 3300047322 Bacteria 16492
276 Ga0495680_0019259 3300047322 Bacteria 5771
277 Ga0495675_0000019 3300047444 Bacteria 113641
278 Ga0495675_0011076 3300047444 Bacteria 5654
279 Ga0495673_0009117 3300047469 Bacteria 5509
280 Ga0495684_0160577 3300047471 Bacteria 1677
281 Ga0495686_0000003 3300047472 Bacteria 899502
282 Ga0495686_0021687 3300047472 Bacteria 4260
283 Ga0495593_0020262 3300047673 Bacteria 3725
284 Ga0495593_0095243 3300047673 Bacteria 1531
285 Ga0495602_0000010 3300048088 Bacteria 212121
286 Ga0495602_0002159 3300048088 Bacteria 19865
287 Ga0495602_0178258 3300048088 Bacteria 1642
288 Ga0496100_0000003 3300048903 Bacteria 360802
289 Ga0496100_0000008 3300048903 Bacteria 231974
290 Ga0496101_0000003 3300048904 Bacteria 406565
291 Ga0496101_0000016 3300048904 Bacteria 240753
292 Ga0496102_0000054 3300048905 Bacteria 175565
293 Ga0496102_0098579 3300048905 Bacteria 2712
294 Ga0496102_0187616 3300048905 Bacteria 1949
295 Ga0496103_0000079 3300048906 Bacteria 110624
296 Ga0496103_0008162 3300048906 Bacteria 6215
297 Ga0496103_0065681 3300048906 Bacteria 2263
298 Ga0496104_0000003 3300048907 Bacteria 669219
299 Ga0496104_0000063 3300048907 Bacteria 116618
300 Ga0496104_0001123 3300048907 Bacteria 22922
301 Ga0496104_0009399 3300048907 Bacteria 8696
302 Ga0496104_0109443 3300048907 Bacteria 2648
303 Ga0496104_0310494 3300048907 Bacteria 1490
304 Ga0496105_0000031 3300048908 Bacteria 137220
305 Ga0496105_0000041 3300048908 Bacteria 116618
306 Ga0496105_0000209 3300048908 Bacteria 39293
307 Ga0496105_0006962 3300048908 Bacteria 8711
308 Ga0496105_0010894 3300048908 Bacteria 7161
309 Ga0496106_0000048 3300048909 Bacteria 98233
310 Ga0496106_0000052 3300048909 Bacteria 94849
311 Ga0496106_0000086 3300048909 Bacteria 73933
312 Ga0496107_0000008 3300048910 Bacteria 251874
313 Ga0496107_0000009 3300048910 Bacteria 231682
314 Ga0496107_0052369 3300048910 Bacteria 2944
315 Ga0496108_0000002 3300048911 Bacteria 700890
316 Ga0496108_0000024 3300048911 Bacteria 183389
317 Ga0496108_0000153 3300048911 Bacteria 66080
318 Ga0496108_0003787 3300048911 Bacteria 12109
319 Ga0496109_0000001 3300048912 Bacteria 700852
320 Ga0496109_0000033 3300048912 Bacteria 160496
321 Ga0496109_0000267 3300048912 Bacteria 50405
322 Ga0496109_0000310 3300048912 Bacteria 45964
323 Ga0496109_0000809 3300048912 Bacteria 26080
324 Ga0496109_0176606 3300048912 Bacteria 2005
325 Ga0496110_0000008 3300048913 Bacteria 113408
326 Ga0496110_0061380 3300048913 Bacteria 3317
327 Ga0496110_0125483 3300048913 Bacteria 2316
328 Ga0496111_0000004 3300048914 Bacteria 116115
329 Ga0496111_0006948 3300048914 Bacteria 7387
330 Ga0496111_0071756 3300048914 Bacteria 2520
331 Ga0496112_0000002 3300048915 Bacteria 782039
332 Ga0496112_0007130 3300048915 Bacteria 9891
333 Ga0496112_0010774 3300048915 Bacteria 8315
334 Ga0496113_0000030 3300048916 Bacteria 60123
335 Ga0496113_0031520 3300048916 Bacteria 3848
336 Ga0496113_0064161 3300048916 Bacteria 2776
337 Ga0496114_0000010 3300048917 Bacteria 363396
338 Ga0496114_0014927 3300048917 Bacteria 6244
339 Ga0496114_0221385 3300048917 Bacteria 1661
340 Ga0496115_0000074 3300048918 Bacteria 90267
341 Ga0496115_0000212 3300048918 Bacteria 53976
342 Ga0496116_0000014 3300048919 Bacteria 569049
343 Ga0496117_0009596 3300048920 Bacteria 8965
344 Ga0496118_0000389 3300048921 Bacteria 74298
345 Ga0496118_0049602 3300048921 Bacteria 3231
346 Ga0496119_0003689 3300048922 Bacteria 15697
347 Ga0496119_0013076 3300048922 Bacteria 6657
348 Ga0496119_0019997 3300048922 Bacteria 4901
349 Ga0496120_0002730 3300048923 Bacteria 17241
350 Ga0496121_0031101 3300048924 Bacteria 4886
351 Ga0496121_0070650 3300048924 Bacteria 2811
352 Ga0496124_0155903 3300048927 Bacteria 1786
353 Ga0496125_0035491 3300048928 Bacteria 4372
354 Ga0496126_0217732 3300048929 Bacteria 1605
355 Ga0501031_0000172 3300049568 Bacteria 36896
356 Ga0501033_0000211 3300049570 Bacteria 55768
357 Ga0501034_0014703 3300049571 Bacteria 8056
358 Ga0501034_0017286 3300049571 Bacteria 7399
359 Ga0501036_0004069 3300049572 Bacteria 11762
360 Ga0501037_0000120 3300049573 Bacteria 73352
361 Ga0501038_0000139 3300049574 Bacteria 62162
362 Ga0501039_0041265 3300049575 Bacteria 3563
363 Ga0501040_0027779 3300049576 Bacteria 3811
364 Ga0501042_0015949 3300049578 Bacteria 5153
365 Ga0501043_0000203 3300049579 Bacteria 54330
366 Ga0501046_0000194 3300049580 Bacteria 62330
367 Ga0501047_0000287 3300049581 Bacteria 58087
368 Ga0501047_0022100 3300049581 Bacteria 6111
369 Ga0501048_0000004 3300049582 Bacteria 100672
370 Ga0501067_0007250 3300049583 Bacteria 6157
371 Ga0501069_0000985 3300049585 Bacteria 13568
372 Ga0501070_0000079 3300049586 Bacteria 82054
373 Ga0501070_0005413 3300049586 Bacteria 10893
374 Ga0501073_0001052 3300049589 Bacteria 19910
375 Ga0501075_0011548 3300049591 Bacteria 6251
376 Ga0501079_0052483 3300049741 Bacteria 3146
377 Ga0501083_0000759 3300049744 Bacteria 21081
378 Ga0501035_0000059 3300049822 Bacteria 134506
379 Ga0501044_0003201 3300049823 Bacteria 18453
380 Ga0501045_0091513 3300049824 Bacteria 2248
381 nmdc:mga06r32_328153_c1 3300050510 Bacteria 1515
382 nmdc:mga0a205_2747_c1 3300050515 Bacteria 11610
383 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
384 Ga0495601_0000012 3300053077 Bacteria 227853
385 Ga0495601_0000120 3300053077 Bacteria 43540
386 Ga0495601_0004446 3300053077 Bacteria 8095
387 Ga0495612_0000100 3300053078 Bacteria 37132
388 Ga0495655_0001042 3300053083 Bacteria 4272
389 Ga0495595_0000001 3300053084 Bacteria 495226
390 Ga0495595_0000117 3300053084 Bacteria 34251
391 Ga0495619_0000020 3300053085 Bacteria 201556
392 Ga0495619_0000046 3300053085 Bacteria 104451
393 Ga0495619_0000129 3300053085 Bacteria 55936
394 Ga0495619_0000626 3300053085 Bacteria 23392
395 Ga0495619_0001343 3300053085 Bacteria 16123
396 Ga0495619_0002283 3300053085 Bacteria 12644
397 Ga0495619_0014328 3300053085 Bacteria 5009
398 Ga0500566_0002230 3300053094 Bacteria 11446
399 Ga0500641_0002499 3300053096 Bacteria 6501
400 Ga0500614_002385 3300053123 Bacteria 4199
401 Ga0500658_0041194 3300053134 Bacteria 1852
402 Ga0500616_0002898 3300053153 Bacteria 13745
403 Ga0501084_0155450 3300054114 Bacteria 1929
404 Ga0501082_0002166 3300060353 Bacteria 17213
405 Ga0495594_0000004
406 JGI24746J21847_1000681
407 JGI24740J21852_10001243
408 JGI24748J21848_1000144
409 Ga0070683_100003521
410 Ga0070683_100035102
411 Ga0070683_100158789
412 Ga0070677_10000018
413 Ga0068869_100044938
414 Ga0070666_10030316
415 Ga0070682_100000016
416 Ga0070682_100000029
417 Ga0068868_100001722
418 Ga0068868_100010335
419 Ga0070691_10000083
420 Ga0070675_100000015
421 Ga0070674_100000003
422 Ga0070674_100000028
423 Ga0070673_100074539
424 Ga0070688_100000070
425 Ga0070659_100001759
426 Ga0070667_100003476
427 Ga0070667_100076527
428 Ga0070713_100000014
429 Ga0070713_100023578
430 Ga0070711_100022371
431 Ga0070700_100067091
432 Ga0070663_100000869
433 Ga0070662_100000008
434 Ga0068867_100002065
435 Ga0070685_10000028
436 Ga0070679_100000674
437 Ga0070679_100000812
438 Ga0070684_100004572
439 Ga0068853_100244686
440 Ga0070672_100000858
441 Ga0070693_100000093
442 Ga0070665_100000120
443 Ga0070665_100036132
444 Ga0070665_100072801
445 Ga0068854_100003092
446 Ga0068854_100076010
447 Ga0068856_100000186
448 Ga0068856_100005266
449 Ga0068852_100000013
450 Ga0068852_100072991
451 Ga0068864_100000044
452 Ga0068866_10000002
453 Ga0068866_10000306
454 Ga0068851_10000347
455 Ga0068851_10052210
456 Ga0068863_100000080
457 Ga0068863_100014346
458 Ga0068863_100061635
459 Ga0068858_100000035
460 Ga0068858_100000042
461 Ga0068860_100001897
462 Ga0068860_100122934
463 Ga0068862_100003207
464 Ga0081455_10006118
465 Ga0081455_10083551
466 Ga0081540_1000115
467 Ga0081540_1002319
468 Ga0081539_10000674
469 Ga0081539_10002431
470 Ga0070715_10000015
471 Ga0070712_100113678
472 Ga0075433_10000031
473 Ga0075433_10011318
474 Ga0068865_100000001
475 Ga0105245_10000045
476 Ga0105245_10000053
477 Ga0105245_10000488
478 Ga0105245_10013033
479 Ga0105247_10000169
480 Ga0105242_10001870
481 Ga0105242_10212645
482 Ga0105248_10000089
483 Ga0105238_10001238
484 Ga0105249_10000095
485 Ga0105249_10003796
486 Ga0157369_10000037
487 Ga0157374_10004334
488 Ga0157374_10053794
489 Ga0157372_10000064
490 Ga0157375_10000076
491 Ga0157375_10082274
492 Ga0163163_10158747
493 Ga0163163_10242440
494 Ga0157380_10000118
495 Ga0157380_10000163
496 Ga0157379_10036417
497 Ga0157379_10039730
498 Ga0157379_10080392
499 Ga0163161_10000058
500 Ga0207656_10000168
501 Ga0207656_10007949
502 Ga0207682_10000047
503 Ga0207642_10000001
504 Ga0207642_10000003
505 Ga0207642_10000058
506 Ga0207710_10000103
507 Ga0207680_10015660
508 Ga0207685_10000001
509 Ga0207707_10072554
510 Ga0207693_10128505
511 Ga0207663_10001124
512 Ga0207649_10000025
513 Ga0207652_10000385
514 Ga0207652_10000544
515 Ga0207694_10000067
516 Ga0207659_10000032
517 Ga0207687_10000021
518 Ga0207687_10000023
519 Ga0207687_10000241
520 Ga0207700_10000009
521 Ga0207700_10023878
522 Ga0207700_10077893
523 Ga0207690_10001315
524 Ga0207706_10000016
525 Ga0207686_10000016
526 Ga0207686_10000029
527 Ga0207686_10000189
528 Ga0207669_10000014
529 Ga0207669_10000024
530 Ga0207704_10000004
531 Ga0207691_10000062
532 Ga0207711_10000083
533 Ga0207689_10057960
534 Ga0207661_10000064
535 Ga0207661_10000086
536 Ga0207661_10014619
537 Ga0207661_10058811
538 Ga0207651_10008539
539 Ga0207712_10000003
540 Ga0207712_10007185
541 Ga0207668_10005659
542 Ga0207668_10135287
543 Ga0207640_10001945
544 Ga0207640_10057361
545 Ga0207658_10007026
546 Ga0207658_10057656
547 Ga0207677_10000429
548 Ga0207677_10000783
549 Ga0207703_10000060
550 Ga0207703_10000067
551 Ga0207678_10006240
552 Ga0207678_10144558
553 Ga0207708_10089536
554 Ga0207702_10000134
555 Ga0207702_10002492
556 Ga0207641_10000304
557 Ga0207641_10010570
558 Ga0207641_10051176
559 Ga0207648_10004663
560 Ga0207676_10000043
561 Ga0207698_10000002
562 Ga0207698_10094003
563 Ga0268266_10000023
564 Ga0268266_10000748
565 Ga0268266_10001671
566 Ga0268264_10007035
567 Ga0268264_10092456
568 Ga0268264_10092707
569 Ga0265337_1000013
570 Ga0265326_10000012
571 Ga0265319_1000044
572 Ga0265322_10000003
573 Ga0265336_10002629
574 Ga0265336_10020020
575 Ga0265338_10000297
576 Ga0265324_10000226
577 Ga0265328_10000723
578 Ga0265320_10000001
579 Ga0265325_10038231
580 Ga0265329_10006990
581 Ga0265339_10016758
582 Ga0265331_10001141
583 Ga0265327_10000003
584 Ga0265314_10000044
585 Ga0307409_100048696
586 Ga0307416_100097208
587 Ga0307415_100010927
588 Ga0373941_0003716
589 Ga0373954_0033072
590 Ga0373937_0043910
591 Ga0395905_0129758
592 Ga0395901_0364611
593 Ga0451853_3827414
594 Ga0466963_0000027
595 Ga0466963_0198487
596 Ga0466957_0012306
597 Ga0466960_0000138
598 Ga0466967_0000004
599 Ga0466967_0009623
600 Ga0495592_0000518
601 Ga0495603_0000554
602 Ga0495603_0001096
603 Ga0495603_0009964
604 Ga0495629_0000014
605 Ga0495629_0014779
606 Ga0495629_0016189
607 Ga0495638_0043328
608 Ga0495641_0000001
609 Ga0495641_0003587
610 Ga0495651_0057675
611 Ga0495653_0050094
612 Ga0495653_0054474
613 Ga0495650_0000049
614 Ga0495582_0000012
615 Ga0495662_0000118
616 Ga0495606_0000045
617 Ga0495608_0000001
618 Ga0495608_0004473
619 Ga0495608_0008111
620 Ga0495608_0060125
621 Ga0495618_0000068
622 Ga0495620_0000428
623 Ga0495628_0000070
624 Ga0495628_0026077
625 Ga0495628_0029686
626 Ga0495628_0046594
627 Ga0495628_0069017
628 Ga0495628_0097120
629 Ga0495630_0000007
630 Ga0495630_0000312
631 Ga0495630_0013070
632 Ga0495631_0010422
633 Ga0495644_0000296
634 Ga0495652_0000066
635 Ga0495652_0004909
636 Ga0495640_0013109
637 Ga0495587_0005907
638 Ga0495587_0050690
639 Ga0495598_0007191
640 Ga0495621_0006932
641 Ga0495645_0012182
642 Ga0495622_0000016
643 Ga0495633_0050903
644 Ga0495667_0000015
645 Ga0495634_0000187
646 Ga0495634_0000755
647 Ga0495634_0012777
648 Ga0495625_0000020
649 Ga0495635_0000036
650 Ga0495635_0010660
651 Ga0495588_0000217
652 Ga0495657_0000002
653 Ga0495657_0057749
654 Ga0495599_0014638
655 Ga0495647_0000013
656 Ga0495647_0000059
657 Ga0495647_0001175
658 Ga0495658_0000024
659 Ga0495658_0003615
660 Ga0495669_0000251
661 Ga0495669_0068590
662 Ga0495613_0000040
663 Ga0495613_0000159
664 Ga0495624_0000013
665 Ga0495624_0001178
666 Ga0495624_0016229
667 Ga0495649_0004295
668 Ga0495600_0003198
669 Ga0495600_0015263
670 Ga0495600_0061142
671 Ga0495604_0001650
672 Ga0495604_0080054
673 Ga0495674_0000025
674 Ga0495674_0102581
675 Ga0495676_0000091
676 Ga0495676_0000252
677 Ga0495680_0000023
678 Ga0495680_0000286
679 Ga0495680_0003127
680 Ga0495680_0019259
681 Ga0495675_0000019
682 Ga0495675_0011076
683 Ga0495673_0009117
684 Ga0495684_0160577
685 Ga0495686_0000003
686 Ga0495686_0021687
687 Ga0495593_0020262
688 Ga0495593_0095243
689 Ga0495602_0000010
690 Ga0495602_0002159
691 Ga0495602_0178258
692 Ga0496100_0000003
693 Ga0496100_0000008
694 Ga0496101_0000003
695 Ga0496101_0000016
696 Ga0496102_0000054
697 Ga0496102_0098579
698 Ga0496102_0187616
699 Ga0496103_0000079
700 Ga0496103_0008162
701 Ga0496103_0065681
702 Ga0496104_0000003
703 Ga0496104_0000063
704 Ga0496104_0001123
705 Ga0496104_0009399
706 Ga0496104_0109443
707 Ga0496104_0310494
708 Ga0496105_0000031
709 Ga0496105_0000041
710 Ga0496105_0000209
711 Ga0496105_0006962
712 Ga0496105_0010894
713 Ga0496106_0000048
714 Ga0496106_0000052
715 Ga0496106_0000086
716 Ga0496107_0000008
717 Ga0496107_0000009
718 Ga0496107_0052369
719 Ga0496108_0000002
720 Ga0496108_0000024
721 Ga0496108_0000153
722 Ga0496108_0003787
723 Ga0496109_0000001
724 Ga0496109_0000033
725 Ga0496109_0000267
726 Ga0496109_0000310
727 Ga0496109_0000809
728 Ga0496109_0176606
729 Ga0496110_0000008
730 Ga0496110_0061380
731 Ga0496110_0125483
732 Ga0496111_0000004
733 Ga0496111_0006948
734 Ga0496111_0071756
735 Ga0496112_0000002
736 Ga0496112_0007130
737 Ga0496112_0010774
738 Ga0496113_0000030
739 Ga0496113_0031520
740 Ga0496113_0064161
741 Ga0496114_0000010
742 Ga0496114_0014927
743 Ga0496114_0221385
744 Ga0496115_0000074
745 Ga0496115_0000212
746 Ga0496116_0000014
747 Ga0496117_0009596
748 Ga0496118_0000389
749 Ga0496118_0049602
750 Ga0496119_0003689
751 Ga0496119_0013076
752 Ga0496119_0019997
753 Ga0496120_0002730
754 Ga0496121_0031101
755 Ga0496121_0070650
756 Ga0496124_0155903
757 Ga0496125_0035491
758 Ga0496126_0217732
759 Ga0501031_0000172
760 Ga0501033_0000211
761 Ga0501034_0014703
762 Ga0501034_0017286
763 Ga0501036_0004069
764 Ga0501037_0000120
765 Ga0501038_0000139
766 Ga0501039_0041265
767 Ga0501040_0027779
768 Ga0501042_0015949
769 Ga0501043_0000203
770 Ga0501046_0000194
771 Ga0501047_0000287
772 Ga0501047_0022100
773 Ga0501048_0000004
774 Ga0501067_0007250
775 Ga0501069_0000985
776 Ga0501070_0000079
777 Ga0501070_0005413
778 Ga0501073_0001052
779 Ga0501075_0011548
780 Ga0501079_0052483
781 Ga0501083_0000759
782 Ga0501035_0000059
783 Ga0501044_0003201
784 Ga0501045_0091513
785 nmdc:mga06r32_328153_c1
786 nmdc:mga0a205_2747_c1
787 nmdc:mga0a205_9_c1
788 Ga0495601_0000012
789 Ga0495601_0000120
790 Ga0495601_0004446
791 Ga0495612_0000100
792 Ga0495655_0001042
793 Ga0495595_0000001
794 Ga0495595_0000117
795 Ga0495619_0000020
796 Ga0495619_0000046
797 Ga0495619_0000129
798 Ga0495619_0000626
799 Ga0495619_0001343
800 Ga0495619_0002283
801 Ga0495619_0014328
802 Ga0500566_0002230
803 Ga0500641_0002499
804 Ga0500614_002385
805 Ga0500658_0041194
806 Ga0500616_0002898
807 Ga0501084_0155450
808 Ga0501082_0002166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

90

452

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zc0-assembly1.cif.gz_A crystal structure of an archaeal alanine:glyoxylate aminotransferase 0.9445 20 415
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9423 20 419
2zp7-assembly3.cif.gz_F crystal structure of lysn, alpha-aminoadipate aminotransferase (leucine complex), from thermus thermophilus hb27 0.9382 20 415
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.933 20 419
3av7-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products 0.9283 16 415
ID Description Score Start End Superfamily
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9599 83 306 3.40.640.10
1vp4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.951 83 304 3.40.640.10
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9476 83 306 3.40.640.10
2z1yA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9461 306 419 3.90.1150.10
3aovA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9445 83 306 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6V8NP89-F1-model_v4 2-aminoadipate transaminase 0.9777 89 426 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A6I0DZS2-F1-model_v4 PLP-dependent aminotransferase family protein 0.9731 101 420 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A6V8NP89-F1-model_v4 2-aminoadipate transaminase 0.9692 89 426 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A7J9WHI1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9667 31 423 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A1F9UR80-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9643 27 414 GO:0008483
GO:0009058
GO:0030170
GO:1901605

Map