F435794

General Info

Members Datasets Scaffolds Average Seq Length
404 262 354 320

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0045151|Ga0501034_0045151_585_1598
Length 337
Sequence VSQPPAAHLPVLYTQVLSGLRVIEDGTYLDGTFGRGGHARGVLEQLGPQGRLLVMDKDPEAIAVAQRDFAPDPRVSIYRGSFADLLDWNETAAGLDGVLFDLGVSSPQLDVAERGFSFGKDGPLDMRMDPDTGESAAQWLNRVEEREIADVLWTYGEERQSRRIARAVVARRASQPFARTAELAELIASAMPRGKSGTDKSRIHPATRSFQAIRIHINRELADLEAGLDAALARLKPGGRLAVISFHSLEDRIVKQFMNRHAKAPPSNRRLPEMAAFVPTLDLIGGATKAEDDELAANPRSRSAVLRVAEKRGTGNGEPGMRLSRDPSFPASTGGEP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991457 Xanthomonas translucens 569 Isolate Unclassified
20 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
21 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
22 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
23 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
24 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
25 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
26 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
27 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
28 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
29 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
30 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
31 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
34 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
35 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
36 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
37 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
38 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
39 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
40 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
41 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
45 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
46 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
171 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
172 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
173 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
174 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
194 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
249 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
256 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
259 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
260 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
261 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
262 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.62
Metatranscriptomes 0
Isolates 12.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 15.59
Nodule 0.25
Rhizoplane 2.72
Rhizosphere 66.09
Stem 0
Stem Tuber 0
Unclassified 15.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2760736 2162886007 Bacteria 4161
2 JGI25152J39213_1000190 3300002773 Bacteria 41171
3 JGI25150J39212_1000138 3300002774 Bacteria 41134
4 JGI25151J46595_10000382 3300003187 Bacteria 46006
5 JGI25153J46596_10000241 3300003215 Bacteria 46006
6 rootH2_10023963 3300003320 Bacteria 3921
7 Ga0055526_1000005 3300003771 Bacteria 344542
8 Ga0055526_1002585 3300003771 Bacteria 12096
9 Ga0055537_1000884 3300003773 Bacteria 14283
10 Ga0055537_1001212 3300003773 Bacteria 10871
11 Ga0055524_1000005 3300003775 Bacteria 344542
12 Ga0055536_1004195 3300003781 Bacteria 7454
13 Ga0055536_1014937 3300003781 Bacteria 2689
14 Ga0055536_1021204 3300003781 Bacteria 1980
15 Ga0055536_1021212 3300003781 Bacteria 1979
16 Ga0055534_1000002 3300003784 Bacteria 390762
17 Ga0055534_1000187 3300003784 Bacteria 45318
18 Ga0055528_1000002 3300003790 Bacteria 368879
19 Ga0055528_1001509 3300003790 Bacteria 14092
20 Ga0055530_10004738 3300003791 Bacteria 6856
21 Ga0055540_1020179 3300003792 Bacteria 1771
22 Ga0055531_10010766 3300003794 Bacteria 4503
23 Ga0055531_10030254 3300003794 Bacteria 1824
24 Ga0058692_1000032 3300003856 Bacteria 179581
25 Ga0065704_10073882 3300005289 Bacteria 6706
26 Ga0070670_100002004 3300005331 Bacteria 16657
27 Ga0070670_100159026 3300005331 Bacteria 1958
28 Ga0070677_10016633 3300005333 Bacteria 2621
29 Ga0070666_10001335 3300005335 Bacteria 14954
30 Ga0070666_10225369 3300005335 Bacteria 1323
31 Ga0068868_100033060 3300005338 Bacteria 3985
32 Ga0068868_100125240 3300005338 Bacteria 2098
33 Ga0070660_100014385 3300005339 Bacteria 5697
34 Ga0070661_100012907 3300005344 Bacteria 5852
35 Ga0070668_100002651 3300005347 Bacteria 13146
36 Ga0070668_100023652 3300005347 Bacteria 4649
37 Ga0070675_100158168 3300005354 Bacteria 1947
38 Ga0070671_100031846 3300005355 Bacteria 4359
39 Ga0070674_100041345 3300005356 Bacteria 3124
40 Ga0070674_100121188 3300005356 Bacteria 1936
41 Ga0070667_100000065 3300005367 Bacteria 135172
42 Ga0070667_100026874 3300005367 Bacteria 4789
43 Ga0070667_100055890 3300005367 Bacteria 3333
44 Ga0070667_100063195 3300005367 Bacteria 3136
45 Ga0070663_100000997 3300005455 Bacteria 15417
46 Ga0070663_100017001 3300005455 Bacteria 4736
47 Ga0070663_100141396 3300005455 Bacteria 1838
48 Ga0070663_100160265 3300005455 Bacteria 1731
49 Ga0070678_100016226 3300005456 Bacteria 4758
50 Ga0070678_100219431 3300005456 Bacteria 1580
51 Ga0070662_100148452 3300005457 Bacteria 1823
52 Ga0070679_100117838 3300005530 Bacteria 2640
53 Ga0070679_100277885 3300005530 Bacteria 1628
54 Ga0068853_100003938 3300005539 Bacteria 11404
55 Ga0068853_100626696 3300005539 Bacteria 1022
56 Ga0070672_100110162 3300005543 Bacteria 2243
57 Ga0070693_100003608 3300005547 Bacteria 7228
58 Ga0070665_100000376 3300005548 Bacteria 66416
59 Ga0070665_100041667 3300005548 Bacteria 4617
60 Ga0070665_100055054 3300005548 Bacteria 3990
61 Ga0070665_100643019 3300005548 Bacteria 1074
62 Ga0068855_100168370 3300005563 Bacteria 2482
63 Ga0068857_100174376 3300005577 Bacteria 1955
64 Ga0068854_100005313 3300005578 Bacteria 8129
65 Ga0068854_100116295 3300005578 Bacteria 2024
66 Ga0068856_100010417 3300005614 Bacteria 9027
67 Ga0068856_100090242 3300005614 Bacteria 3048
68 Ga0068859_100012879 3300005617 Bacteria 8401
69 Ga0068861_100085873 3300005719 Bacteria 2472
70 Ga0068851_10004189 3300005834 Bacteria 6496
71 Ga0068863_100141478 3300005841 Bacteria 2299
72 Ga0068863_100192349 3300005841 Bacteria 1961
73 Ga0068858_100000817 3300005842 Bacteria 32476
74 Ga0068860_100015829 3300005843 Bacteria 7363
75 Ga0068862_100000355 3300005844 Bacteria 49697
76 Ga0075364_10000194 3300006051 Bacteria 28183
77 Ga0075364_10078592 3300006051 Bacteria 2179
78 Ga0070712_100146845 3300006175 Bacteria 1806
79 Ga0097621_100260055 3300006237 Bacteria 1522
80 Ga0097621_100363662 3300006237 Bacteria 1289
81 Ga0068871_100132460 3300006358 Bacteria 2115
82 Ga0068865_100091062 3300006881 Bacteria 2212
83 Ga0097620_100012879 3300006931 Bacteria 8401
84 Ga0105251_10000192 3300009011 Bacteria 61516
85 Ga0105244_10011834 3300009036 Bacteria 5199
86 Ga0105244_10051505 3300009036 Bacteria 2098
87 Ga0105240_10000239 3300009093 Bacteria 109259
88 Ga0105240_10265689 3300009093 Bacteria 1978
89 Ga0105240_10300992 3300009093 Bacteria 1835
90 Ga0105247_10089976 3300009101 Bacteria 1947
91 Ga0105243_10002762 3300009148 Bacteria 14596
92 Ga0105243_10026351 3300009148 Bacteria 4449
93 Ga0105248_10003695 3300009177 Bacteria 16961
94 Ga0105248_10046205 3300009177 Bacteria 4880
95 Ga0105237_10001329 3300009545 Bacteria 32791
96 Ga0105237_10096367 3300009545 Bacteria 2949
97 Ga0105237_10116554 3300009545 Bacteria 2665
98 Ga0105238_10003813 3300009551 Bacteria 14974
99 Ga0105238_10044393 3300009551 Bacteria 4494
100 Ga0105238_10091285 3300009551 Bacteria 3033
101 Ga0105249_10000084 3300009553 Bacteria 134869
102 Ga0105239_10064225 3300010375 Bacteria 4030
103 Ga0105239_10116139 3300010375 Bacteria 2969
104 Ga0157371_10002390 3300013102 Bacteria 17962
105 Ga0157370_10039602 3300013104 Bacteria 4554
106 Ga0157370_10040208 3300013104 Bacteria 4515
107 Ga0157370_10323784 3300013104 Bacteria 1421
108 Ga0157369_10000001 3300013105 Bacteria 554908
109 Ga0157369_10048857 3300013105 Bacteria 4589
110 Ga0157369_10200624 3300013105 Bacteria 2094
111 Ga0163162_10158055 3300013306 Bacteria 2388
112 Ga0157375_10041082 3300013308 Bacteria 4463
113 Ga0163163_10278106 3300014325 Bacteria 1725
114 Ga0157380_10061535 3300014326 Bacteria 3004
115 Ga0182008_10000084 3300014497 Bacteria 72998
116 Ga0182007_10000060 3300015262 Bacteria 88258
117 Ga0182005_1000421 3300015265 Bacteria 22901
118 Ga0183360_10001 3300015689 Bacteria 3943671
119 Ga0207425_1000040 3300025245 Bacteria 218121
120 Ga0209129_1000011 3300025258 Bacteria 568657
121 Ga0209565_1000001 3300025263 Bacteria 2950419
122 Ga0209565_1000472 3300025263 Bacteria 29961
123 Ga0209673_1000001 3300025273 Bacteria 3176258
124 Ga0209673_1000032 3300025273 Bacteria 339956
125 Ga0209130_1003935 3300025284 Bacteria 5948
126 Ga0209130_1011387 3300025284 Bacteria 2385
127 Ga0209675_1000001 3300025291 Bacteria 2950293
128 Ga0209675_1000020 3300025291 Bacteria 335854
129 Ga0209676_1000131 3300025292 Bacteria 185298
130 Ga0209676_1004055 3300025292 Bacteria 8426
131 Ga0209676_1004753 3300025292 Bacteria 7411
132 Ga0209676_1008557 3300025292 Bacteria 4542
133 Ga0209025_1000002 3300025294 Bacteria 1393142
134 Ga0209025_1000006 3300025294 Bacteria 1153444
135 Ga0209025_1001895 3300025294 Bacteria 24398
136 Ga0209025_1038633 3300025294 Bacteria 2096
137 Ga0209564_1000001 3300025295 Bacteria 3176258
138 Ga0209564_1000210 3300025295 Bacteria 133323
139 Ga0209564_1007128 3300025295 Bacteria 5837
140 Ga0209758_1000003 3300025297 Bacteria 1398533
141 Ga0209050_1001000 3300025298 Bacteria 35489
142 Ga0209050_1001606 3300025298 Bacteria 23288
143 Ga0209050_1016903 3300025298 Bacteria 2949
144 Ga0209050_1033802 3300025298 Bacteria 1543
145 Ga0209050_1034641 3300025298 Bacteria 1507
146 Ga0209256_1000006 3300025299 Bacteria 1250310
147 Ga0209256_1006182 3300025299 Bacteria 6462
148 Ga0209256_1012741 3300025299 Bacteria 3184
149 Ga0209051_1002391 3300025303 Bacteria 13542
150 Ga0209257_1000067 3300025304 Bacteria 342468
151 Ga0209257_1000086 3300025304 Bacteria 287437
152 Ga0209257_1001869 3300025304 Bacteria 22842
153 Ga0209257_1007384 3300025304 Bacteria 6651
154 Ga0209257_1013138 3300025304 Bacteria 3721
155 Ga0207656_10009323 3300025321 Bacteria 3642
156 Ga0207713_1000374 3300025735 Bacteria 48773
157 Ga0207647_10000262 3300025904 Bacteria 43207
158 Ga0207705_10067558 3300025909 Bacteria 2587
159 Ga0207695_10000082 3300025913 Bacteria 284333
160 Ga0207695_10011712 3300025913 Bacteria 10596
161 Ga0207695_10017149 3300025913 Bacteria 8440
162 Ga0207695_10023328 3300025913 Bacteria 6995
163 Ga0207671_10006145 3300025914 Bacteria 10792
164 Ga0207671_10009449 3300025914 Bacteria 8151
165 Ga0207671_10059564 3300025914 Bacteria 2832
166 Ga0207657_10050706 3300025919 Bacteria 3610
167 Ga0207649_10145750 3300025920 Bacteria 1625
168 Ga0207652_10048563 3300025921 Bacteria 3628
169 Ga0207652_10137234 3300025921 Bacteria 2185
170 Ga0207681_10100590 3300025923 Bacteria 2084
171 Ga0207694_10001428 3300025924 Bacteria 20477
172 Ga0207694_10001879 3300025924 Bacteria 17407
173 Ga0207694_10172030 3300025924 Bacteria 1754
174 Ga0207650_10009403 3300025925 Bacteria 6682
175 Ga0207650_10026577 3300025925 Bacteria 4130
176 Ga0207650_10103416 3300025925 Bacteria 2196
177 Ga0207644_10171890 3300025931 Bacteria 1692
178 Ga0207706_10006038 3300025933 Bacteria 11268
179 Ga0207706_10148688 3300025933 Bacteria 2061
180 Ga0207709_10002087 3300025935 Bacteria 12876
181 Ga0207709_10004817 3300025935 Bacteria 7735
182 Ga0207691_10001603 3300025940 Bacteria 22495
183 Ga0207711_10004459 3300025941 Bacteria 11932
184 Ga0207711_10175133 3300025941 Bacteria 1948
185 Ga0207712_10000395 3300025961 Bacteria 37905
186 Ga0207712_10002711 3300025961 Bacteria 11307
187 Ga0207668_10010364 3300025972 Bacteria 5631
188 Ga0207658_10000114 3300025986 Bacteria 88818
189 Ga0207658_10026822 3300025986 Bacteria 4043
190 Ga0207677_10064025 3300026023 Bacteria 2558
191 Ga0207677_10086166 3300026023 Bacteria 2269
192 Ga0207703_10000766 3300026035 Bacteria 31634
193 Ga0207639_10007124 3300026041 Bacteria 7622
194 Ga0207639_10013598 3300026041 Bacteria 5703
195 Ga0207639_10048001 3300026041 Bacteria 3229
196 Ga0207639_10263362 3300026041 Bacteria 1509
197 Ga0207678_10004822 3300026067 Bacteria 12116
198 Ga0207678_10005792 3300026067 Bacteria 11016
199 Ga0207678_10123291 3300026067 Bacteria 2211
200 Ga0207702_10051315 3300026078 Bacteria 3485
201 Ga0207641_10032009 3300026088 Bacteria 4365
202 Ga0207648_10039064 3300026089 Bacteria 4173
203 Ga0207674_10046048 3300026116 Bacteria 4481
204 Ga0207683_10040594 3300026121 Bacteria 4061
205 Ga0207683_10045947 3300026121 Bacteria 3819
206 Ga0207698_10029312 3300026142 Bacteria 3940
207 Ga0209371_1000028 3300027312 Bacteria 429688
208 Ga0209371_1000055 3300027312 Bacteria 257599
209 Ga0209974_10009501 3300027876 Bacteria 3302
210 Ga0268266_10000001 3300028379 Bacteria 4040580
211 Ga0268266_10000008 3300028379 Bacteria 1161875
212 Ga0268266_10058561 3300028379 Bacteria 3317
213 Ga0268265_10000236 3300028380 Bacteria 63286
214 Ga0268264_10085363 3300028381 Bacteria 2709
215 Ga0268256_1000030 3300030500 Bacteria 429688
216 Ga0268256_1000054 3300030500 Bacteria 257599
217 Ga0316177_1040214 3300030731 Bacteria 12983
218 Ga0316176_1069808 3300030732 Bacteria 3149
219 Ga0316178_1102885 3300030735 Bacteria 2112
220 Ga0316183_1109882 3300030742 Bacteria 9506
221 Ga0316182_1081676 3300030745 Bacteria 3416
222 Ga0307413_10003118 3300031824 Bacteria 6903
223 Ga0307413_10091717 3300031824 Bacteria 1980
224 Ga0307413_10132163 3300031824 Bacteria 1710
225 Ga0307413_10280214 3300031824 Bacteria 1253
226 Ga0307406_10151410 3300031901 Bacteria 1655
227 Ga0307407_10016569 3300031903 Bacteria 3672
228 Ga0307407_10056453 3300031903 Bacteria 2274
229 Ga0307412_10064301 3300031911 Bacteria 2478
230 Ga0307409_100023434 3300031995 Bacteria 4278
231 Ga0307409_100229684 3300031995 Bacteria 1681
232 Ga0307416_100093172 3300032002 Bacteria 2594
233 Ga0307416_100750613 3300032002 Bacteria 1068
234 Ga0307414_10006546 3300032004 Bacteria 6501
235 Ga0307414_10038368 3300032004 Bacteria 3216
236 Ga0307414_10127045 3300032004 Bacteria 1972
237 Ga0307414_10210767 3300032004 Bacteria 1588
238 Ga0307414_10223263 3300032004 Bacteria 1548
239 Ga0307411_10026608 3300032005 Bacteria 3485
240 Ga0307507_10145290 3300033179 Bacteria 1804
241 Ga0395900_0010433 3300037418 Bacteria 9502
242 Ga0395900_0325788 3300037418 Bacteria 1515
243 Ga0395898_0091424 3300037466 Bacteria 2928
244 Ga0395898_0181752 3300037466 Bacteria 2010
245 Ga0395905_0004628 3300037471 Bacteria 14231
246 Ga0395905_0031303 3300037471 Bacteria 5009
247 Ga0395905_0042196 3300037471 Bacteria 4280
248 Ga0395901_0011545 3300038443 Bacteria 8951
249 Ga0395901_0290940 3300038443 Bacteria 1695
250 Ga0237819_00853 3300038705 Bacteria 9592
251 Ga0237819_02668 3300038705 Bacteria 3481
252 Ga0237816_00073 3300039145 Bacteria 6966
253 Ga0439436_0007296 3300041404 Bacteria 3402
254 Ga0439447_001515 3300041407 Bacteria 8502
255 Ga0451793_1334102 3300041452 Bacteria 3993
256 Ga0451800_0078018 3300041459 Bacteria 4143
257 Ga0451806_155503 3300041462 Bacteria 4073
258 Ga0451807_1239789 3300041486 Bacteria 4061
259 Ga0439449_0006629 3300042007 Bacteria 4428
260 Ga0439449_0009607 3300042007 Bacteria 3661
261 Ga0439449_0019332 3300042007 Bacteria 2553
262 Ga0439452_007597 3300042010 Bacteria 3315
263 Ga0439457_029177 3300042014 Bacteria 1222
264 Ga0439462_0017093 3300042015 Bacteria 1879
265 Ga0451577_0296850 3300042876 Bacteria 1464
266 Ga0453684_0000316 3300044712 Bacteria 204457
267 Ga0451576_0000128 3300045051 Bacteria 192071
268 Ga0466967_0251111 3300045976 Bacteria 1690
269 Ga0495638_0020430 3300046460 Bacteria 4377
270 Ga0495606_0011217 3300046507 Bacteria 7335
271 Ga0495631_0001451 3300046518 Bacteria 14376
272 Ga0495643_0001835 3300046522 Bacteria 18063
273 Ga0495663_0001344 3300046525 Bacteria 7772
274 Ga0495621_0002271 3300046539 Bacteria 5144
275 Ga0495633_0017169 3300046558 Bacteria 3709
276 Ga0495633_0018399 3300046558 Bacteria 3549
277 Ga0495656_0023043 3300046615 Bacteria 2446
278 Ga0495668_0000926 3300046616 Bacteria 32744
279 Ga0495625_0030366 3300046660 Bacteria 4033
280 Ga0495625_0083823 3300046660 Bacteria 2215
281 Ga0495671_0016841 3300046692 Bacteria 3896
282 Ga0495672_0001556 3300047320 Bacteria 22458
283 Ga0495686_0004679 3300047472 Bacteria 11106
284 Ga0495686_0005093 3300047472 Bacteria 10514
285 Ga0496100_0069463 3300048903 Bacteria 2346
286 Ga0496101_0143260 3300048904 Bacteria 1823
287 Ga0496102_0118394 3300048905 Bacteria 2472
288 Ga0496103_0054389 3300048906 Bacteria 2481
289 Ga0496109_0101052 3300048912 Bacteria 2676
290 Ga0496112_0188931 3300048915 Bacteria 2022
291 Ga0496115_0074675 3300048918 Bacteria 2753
292 Ga0496117_0006937 3300048920 Bacteria 11226
293 Ga0496117_0010151 3300048920 Bacteria 8641
294 Ga0496118_0011435 3300048921 Bacteria 8664
295 Ga0496118_0040803 3300048921 Bacteria 3684
296 Ga0496118_0048172 3300048921 Bacteria 3295
297 Ga0496118_0049818 3300048921 Bacteria 3221
298 Ga0496119_0001174 3300048922 Bacteria 32839
299 Ga0496119_0001231 3300048922 Bacteria 31897
300 Ga0496120_0000919 3300048923 Bacteria 40956
301 Ga0496120_0001157 3300048923 Bacteria 33802
302 Ga0496121_0001734 3300048924 Bacteria 35607
303 Ga0496122_0001358 3300048925 Bacteria 39854
304 Ga0496122_0001411 3300048925 Bacteria 38913
305 Ga0496122_0001592 3300048925 Bacteria 35581
306 Ga0496122_0007321 3300048925 Bacteria 12323
307 Ga0496122_0020647 3300048925 Bacteria 5935
308 Ga0496123_0000868 3300048926 Bacteria 48075
309 Ga0496123_0002023 3300048926 Bacteria 26173
310 Ga0496123_0002349 3300048926 Bacteria 23732
311 Ga0496123_0004282 3300048926 Bacteria 15181
312 Ga0496123_0027324 3300048926 Bacteria 4252
313 Ga0496123_0088883 3300048926 Bacteria 1842
314 Ga0496124_0001111 3300048927 Bacteria 42338
315 Ga0496124_0002535 3300048927 Bacteria 23710
316 Ga0496124_0037510 3300048927 Bacteria 4214
317 Ga0496124_0073252 3300048927 Bacteria 2834
318 Ga0496125_0012977 3300048928 Bacteria 8225
319 Ga0496125_0017653 3300048928 Bacteria 6793
320 Ga0496125_0072562 3300048928 Bacteria 2681
321 Ga0496126_0011494 3300048929 Bacteria 9155
322 Ga0496126_0067480 3300048929 Bacteria 3196
323 Ga0501031_0001928 3300049568 Bacteria 13084
324 Ga0501032_0019869 3300049569 Bacteria 4690
325 Ga0501033_0003778 3300049570 Bacteria 12306
326 Ga0501033_0058222 3300049570 Bacteria 2855
327 Ga0501034_0015733 3300049571 Bacteria 7767
328 Ga0501034_0045151 3300049571 Bacteria 4453
329 Ga0501034_0069875 3300049571 Bacteria 3522
330 Ga0501036_0005764 3300049572 Bacteria 10042
331 Ga0501037_0013531 3300049573 Bacteria 6008
332 Ga0501038_0116814 3300049574 Bacteria 2204
333 Ga0501039_0043848 3300049575 Bacteria 3455
334 Ga0501043_0002773 3300049579 Bacteria 14646
335 Ga0501043_0126127 3300049579 Bacteria 2007
336 Ga0501043_0244011 3300049579 Bacteria 1385
337 Ga0501046_0050238 3300049580 Bacteria 3295
338 Ga0501047_0003228 3300049581 Bacteria 15454
339 Ga0501047_0119439 3300049581 Bacteria 2518
340 Ga0501073_0066921 3300049589 Bacteria 2504
341 Ga0501234_018462 3300049707 Bacteria 1104
342 Ga0501080_0000256 3300049742 Bacteria 40148
343 Ga0501080_0015538 3300049742 Bacteria 7020
344 Ga0501265_000449 3300049762 Bacteria 4331
345 Ga0501275_000051 3300049772 Bacteria 11731
346 Ga0501035_0004348 3300049822 Bacteria 13449
347 Ga0501044_0022828 3300049823 Bacteria 6665
348 Ga0501044_0058782 3300049823 Bacteria 3941
349 Ga0501045_0285436 3300049824 Bacteria 1229
350 nmdc:mga00v17_567_c1 3300050491 Bacteria 20673
351 Ga0500643_002817 3300053087 Bacteria 8687
352 Ga0500597_000016 3300053120 Bacteria 38903
353 Ga0500634_0000078 3300053161 Bacteria 37746
354 Ga0501082_0058066 3300060353 Bacteria 3334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0027324 Ga0496123_0027324_36_848 269
2 3300048928 Ga0496125_0072562 Ga0496125_0072562_21_833 269
3 iso_pu_bacteria 2747842428 2747950880 282
4 3300031901 Ga0307406_10151410 Ga0307406_101514101 289
5 3300031903 Ga0307407_10016569 Ga0307407_100165692 289
6 3300037471 Ga0395905_0031303 Ga0395905_0031303_2500_3447 292
7 3300038443 Ga0395901_0290940 Ga0395901_0290940_63_1010 292
8 3300049570 Ga0501033_0003778 Ga0501033_0003778_10453_11403 292
9 3300009101 Ga0105247_10089976 Ga0105247_100899762 293
10 3300010375 Ga0105239_10064225 Ga0105239_100642252 293
11 3300049707 Ga0501234_018462 Ga0501234_018462_41_928 294
12 3300037471 Ga0395905_0042196 Ga0395905_0042196_1833_2780 296
13 3300030731 Ga0316177_1040214 Ga0316177_104021411 299
14 3300030735 Ga0316178_1102885 Ga0316178_11028852 299
15 3300041404 Ga0439436_0007296 Ga0439436_0007296_1276_2178 299
16 3300042007 Ga0439449_0019332 Ga0439449_0019332_40_942 299
17 3300042015 Ga0439462_0017093 Ga0439462_0017093_497_1399 299
18 3300046525 Ga0495663_0001344 Ga0495663_0001344_4218_5189 299
19 3300046539 Ga0495621_0002271 Ga0495621_0002271_3076_3978 299
20 3300046660 Ga0495625_0083823 Ga0495625_0083823_472_1443 299
21 3300046692 Ga0495671_0016841 Ga0495671_0016841_588_1559 299
22 3300048903 Ga0496100_0069463 Ga0496100_0069463_1163_2086 299
23 3300060353 Ga0501082_0058066 Ga0501082_0058066_2303_3226 299
24 3300032004 Ga0307414_10210767 Ga0307414_102107672 300
25 3300048905 Ga0496102_0118394 Ga0496102_0118394_697_1620 300
26 3300048906 Ga0496103_0054389 Ga0496103_0054389_472_1395 300
27 3300048921 Ga0496118_0049818 Ga0496118_0049818_1459_2382 300
28 3300049579 Ga0501043_0244011 Ga0501043_0244011_222_1148 300
29 3300049580 Ga0501046_0050238 Ga0501046_0050238_2148_3074 300
30 3300049581 Ga0501047_0003228 Ga0501047_0003228_5488_6414 300
31 3300049742 Ga0501080_0000256 Ga0501080_0000256_24180_25106 300
32 3300049824 Ga0501045_0285436 Ga0501045_0285436_86_1012 300
33 3300037418 Ga0395900_0010433 Ga0395900_0010433_3841_4788 301
34 3300037466 Ga0395898_0091424 Ga0395898_0091424_545_1492 301
35 3300037471 Ga0395905_0004628 Ga0395905_0004628_10196_11143 301
36 3300038443 Ga0395901_0011545 Ga0395901_0011545_4891_5838 301
37 3300048904 Ga0496101_0143260 Ga0496101_0143260_405_1352 301
38 3300048912 Ga0496109_0101052 Ga0496109_0101052_125_1072 301
39 3300048915 Ga0496112_0188931 Ga0496112_0188931_840_1787 301
40 3300039145 Ga0237816_00073 Ga0237816_00073_3763_4674 302
41 3300031824 Ga0307413_10091717 Ga0307413_100917171 303
42 3300006237 Ga0097621_100260055 Ga0097621_1002600552 304
43 3300009551 Ga0105238_10044393 Ga0105238_100443933 304
44 3300025924 Ga0207694_10172030 Ga0207694_101720302 304
45 3300026041 Ga0207639_10263362 Ga0207639_102633623 304
46 3300026121 Ga0207683_10045947 Ga0207683_100459471 304
47 3300046615 Ga0495656_0023043 Ga0495656_0023043_1027_1944 304
48 3300005335 Ga0070666_10001335 Ga0070666_1000133515 305
49 3300005335 Ga0070666_10225369 Ga0070666_102253692 305
50 3300005338 Ga0068868_100125240 Ga0068868_1001252403 305
51 3300005344 Ga0070661_100012907 Ga0070661_1000129074 305
52 3300005347 Ga0070668_100023652 Ga0070668_1000236525 305
53 3300005354 Ga0070675_100158168 Ga0070675_1001581683 305
54 3300005356 Ga0070674_100121188 Ga0070674_1001211882 305
55 3300005367 Ga0070667_100000065 Ga0070667_100000065122 305
56 3300005367 Ga0070667_100055890 Ga0070667_1000558903 305
57 3300005367 Ga0070667_100063195 Ga0070667_1000631952 305
58 3300005455 Ga0070663_100000997 Ga0070663_10000099711 305
59 3300005455 Ga0070663_100017001 Ga0070663_1000170011 305
60 3300005539 Ga0068853_100003938 Ga0068853_1000039385 305
61 3300005539 Ga0068853_100626696 Ga0068853_1006266961 305
62 3300005548 Ga0070665_100000376 Ga0070665_1000003764 305
63 3300005548 Ga0070665_100643019 Ga0070665_1006430192 305
64 3300005577 Ga0068857_100174376 Ga0068857_1001743763 305
65 3300005578 Ga0068854_100005313 Ga0068854_1000053135 305
66 3300005614 Ga0068856_100090242 Ga0068856_1000902422 305
67 3300005617 Ga0068859_100012879 Ga0068859_1000128794 305
68 3300005719 Ga0068861_100085873 Ga0068861_1000858732 305
69 3300005834 Ga0068851_10004189 Ga0068851_100041893 305
70 3300005841 Ga0068863_100141478 Ga0068863_1001414783 305
71 3300005841 Ga0068863_100192349 Ga0068863_1001923493 305
72 3300005842 Ga0068858_100000817 Ga0068858_1000008176 305
73 3300005843 Ga0068860_100015829 Ga0068860_1000158295 305
74 3300005844 Ga0068862_100000355 Ga0068862_10000035534 305
75 3300006358 Ga0068871_100132460 Ga0068871_1001324602 305
76 3300006881 Ga0068865_100091062 Ga0068865_1000910623 305
77 3300006931 Ga0097620_100012879 Ga0097620_1000128794 305
78 3300009177 Ga0105248_10003695 Ga0105248_1000369513 305
79 3300009545 Ga0105237_10001329 Ga0105237_1000132918 305
80 3300009551 Ga0105238_10003813 Ga0105238_1000381315 305
81 3300009553 Ga0105249_10000084 Ga0105249_10000084113 305
82 3300010375 Ga0105239_10116139 Ga0105239_101161393 305
83 3300013105 Ga0157369_10048857 Ga0157369_100488575 305
84 3300025904 Ga0207647_10000262 Ga0207647_1000026224 305
85 3300025913 Ga0207695_10023328 Ga0207695_100233288 305
86 3300025914 Ga0207671_10006145 Ga0207671_100061455 305
87 3300025914 Ga0207671_10059564 Ga0207671_100595643 305
88 3300025924 Ga0207694_10001428 Ga0207694_100014286 305
89 3300025924 Ga0207694_10001879 Ga0207694_100018794 305
90 3300025925 Ga0207650_10026577 Ga0207650_100265772 305
91 3300025933 Ga0207706_10006038 Ga0207706_100060385 305
92 3300025941 Ga0207711_10004459 Ga0207711_100044597 305
93 3300025961 Ga0207712_10000395 Ga0207712_1000039524 305
94 3300025961 Ga0207712_10002711 Ga0207712_100027116 305
95 3300025986 Ga0207658_10000114 Ga0207658_1000011481 305
96 3300025986 Ga0207658_10026822 Ga0207658_100268222 305
97 3300026023 Ga0207677_10086166 Ga0207677_100861663 305
98 3300026035 Ga0207703_10000766 Ga0207703_1000076629 305
99 3300026041 Ga0207639_10007124 Ga0207639_100071244 305
100 3300026041 Ga0207639_10013598 Ga0207639_100135982 305
101 3300026041 Ga0207639_10048001 Ga0207639_100480012 305
102 3300026067 Ga0207678_10004822 Ga0207678_100048222 305
103 3300026067 Ga0207678_10005792 Ga0207678_1000579210 305
104 3300026078 Ga0207702_10051315 Ga0207702_100513153 305
105 3300026088 Ga0207641_10032009 Ga0207641_100320093 305
106 3300026121 Ga0207683_10040594 Ga0207683_100405944 305
107 3300026142 Ga0207698_10029312 Ga0207698_100293122 305
108 3300028379 Ga0268266_10000001 Ga0268266_100000013600 305
109 3300028379 Ga0268266_10000008 Ga0268266_10000008850 305
110 3300028380 Ga0268265_10000236 Ga0268265_1000023624 305
111 3300028381 Ga0268264_10085363 Ga0268264_100853632 305
112 3300045976 Ga0466967_0251111 Ga0466967_0251111_55_993 305
113 3300047472 Ga0495686_0005093 Ga0495686_0005093_887_1825 305
114 3300048918 Ga0496115_0074675 Ga0496115_0074675_851_1789 305
115 3300048925 Ga0496122_0001358 Ga0496122_0001358_23013_23951 305
116 3300048926 Ga0496123_0002349 Ga0496123_0002349_18616_19554 305
117 3300048929 Ga0496126_0067480 Ga0496126_0067480_958_1896 305
118 3300053087 Ga0500643_002817 Ga0500643_002817_4404_5342 305
119 3300053120 Ga0500597_000016 Ga0500597_000016_20201_21139 305
120 3300005331 Ga0070670_100159026 Ga0070670_1001590262 306
121 3300005455 Ga0070663_100141396 Ga0070663_1001413962 306
122 3300009093 Ga0105240_10000239 Ga0105240_1000023912 306
123 3300009551 Ga0105238_10091285 Ga0105238_100912853 306
124 3300013105 Ga0157369_10000001 Ga0157369_10000001279 306
125 3300025913 Ga0207695_10000082 Ga0207695_10000082159 306
126 3300025913 Ga0207695_10011712 Ga0207695_100117123 306
127 3300025914 Ga0207671_10009449 Ga0207671_100094496 306
128 3300025925 Ga0207650_10103416 Ga0207650_101034162 306
129 3300026067 Ga0207678_10123291 Ga0207678_101232913 306
130 3300042014 Ga0439457_029177 Ga0439457_029177_92_1165 306
131 iso_pu_bacteria 2842757796 2842759589 306
132 iso_pu_bacteria 2852649853 2852652958 306
133 3300005339 Ga0070660_100014385 Ga0070660_1000143854 308
134 3300005356 Ga0070674_100041345 Ga0070674_1000413453 308
135 3300005455 Ga0070663_100160265 Ga0070663_1001602652 308
136 3300005457 Ga0070662_100148452 Ga0070662_1001484522 308
137 3300005530 Ga0070679_100117838 Ga0070679_1001178382 308
138 3300005530 Ga0070679_100277885 Ga0070679_1002778852 308
139 3300005543 Ga0070672_100110162 Ga0070672_1001101622 308
140 3300006175 Ga0070712_100146845 Ga0070712_1001468453 308
141 3300009545 Ga0105237_10096367 Ga0105237_100963673 308
142 3300009545 Ga0105237_10116554 Ga0105237_101165544 308
143 3300013104 Ga0157370_10040208 Ga0157370_100402083 308
144 3300013104 Ga0157370_10323784 Ga0157370_103237842 308
145 3300013105 Ga0157369_10200624 Ga0157369_102006242 308
146 3300013308 Ga0157375_10041082 Ga0157375_100410823 308
147 3300025909 Ga0207705_10067558 Ga0207705_100675582 308
148 3300025919 Ga0207657_10050706 Ga0207657_100507063 308
149 3300025921 Ga0207652_10048563 Ga0207652_100485632 308
150 3300025921 Ga0207652_10137234 Ga0207652_101372343 308
151 3300025923 Ga0207681_10100590 Ga0207681_101005902 308
152 3300025933 Ga0207706_10148688 Ga0207706_101486882 308
153 3300025940 Ga0207691_10001603 Ga0207691_100016039 308
154 3300026089 Ga0207648_10039064 Ga0207648_100390643 308
155 3300026116 Ga0207674_10046048 Ga0207674_100460483 308
156 3300031824 Ga0307413_10280214 Ga0307413_102802141 308
157 3300031995 Ga0307409_100023434 Ga0307409_1000234344 308
158 3300037418 Ga0395900_0325788 Ga0395900_0325788_51_998 308
159 3300037466 Ga0395898_0181752 Ga0395898_0181752_862_1809 308
160 3300042876 Ga0451577_0296850 Ga0451577_0296850_408_1346 308
161 iso_pu_bacteria 2643221559 2643818353 308
162 iso_pu_bacteria 2643221586 2643938506 308
163 iso_pu_bacteria 2643221612 2644079158 308
164 iso_pu_bacteria 2643221727 2644693934 308
165 iso_pu_bacteria 2941489479 2941492287 308
166 3300032004 Ga0307414_10223263 Ga0307414_102232632 309
167 3300046518 Ga0495631_0001451 Ga0495631_0001451_8297_9358 309
168 3300005355 Ga0070671_100031846 Ga0070671_1000318462 310
169 3300005367 Ga0070667_100026874 Ga0070667_1000268743 310
170 3300005563 Ga0068855_100168370 Ga0068855_1001683703 310
171 3300005614 Ga0068856_100010417 Ga0068856_1000104175 310
172 3300006237 Ga0097621_100363662 Ga0097621_1003636622 310
173 3300009093 Ga0105240_10300992 Ga0105240_103009922 310
174 3300009177 Ga0105248_10046205 Ga0105248_100462054 310
175 3300014325 Ga0163163_10278106 Ga0163163_102781062 310
176 3300025321 Ga0207656_10009323 Ga0207656_100093233 310
177 3300025920 Ga0207649_10145750 Ga0207649_101457502 310
178 3300025931 Ga0207644_10171890 Ga0207644_101718902 310
179 3300025941 Ga0207711_10175133 Ga0207711_101751332 310
180 3300026023 Ga0207677_10064025 Ga0207677_100640253 310
181 3300030745 Ga0316182_1081676 Ga0316182_10816762 310
182 3300031824 Ga0307413_10132163 Ga0307413_101321631 310
183 3300031903 Ga0307407_10056453 Ga0307407_100564533 310
184 3300031911 Ga0307412_10064301 Ga0307412_100643013 310
185 3300031995 Ga0307409_100229684 Ga0307409_1002296841 310
186 3300032002 Ga0307416_100750613 Ga0307416_1007506131 310
187 3300032004 Ga0307414_10127045 Ga0307414_101270453 310
188 3300032005 Ga0307411_10026608 Ga0307411_100266083 310
189 3300033179 Ga0307507_10145290 Ga0307507_101452902 310
190 3300046558 Ga0495633_0017169 Ga0495633_0017169_834_1769 310
191 3300048925 Ga0496122_0001592 Ga0496122_0001592_5393_6328 310
192 3300048926 Ga0496123_0002023 Ga0496123_0002023_13987_14922 310
193 3300048927 Ga0496124_0073252 Ga0496124_0073252_1883_2818 310
194 3300049568 Ga0501031_0001928 Ga0501031_0001928_9558_10508 310
195 3300049569 Ga0501032_0019869 Ga0501032_0019869_2283_3233 310
196 3300049570 Ga0501033_0058222 Ga0501033_0058222_338_1288 310
197 3300049571 Ga0501034_0015733 Ga0501034_0015733_1233_2183 310
198 3300049571 Ga0501034_0069875 Ga0501034_0069875_2234_3184 310
199 3300049572 Ga0501036_0005764 Ga0501036_0005764_812_1762 310
200 3300049573 Ga0501037_0013531 Ga0501037_0013531_2902_3852 310
201 3300049574 Ga0501038_0116814 Ga0501038_0116814_835_1785 310
202 3300049575 Ga0501039_0043848 Ga0501039_0043848_1694_2644 310
203 3300049579 Ga0501043_0126127 Ga0501043_0126127_720_1670 310
204 3300049581 Ga0501047_0119439 Ga0501047_0119439_629_1579 310
205 3300049589 Ga0501073_0066921 Ga0501073_0066921_107_1057 310
206 3300049742 Ga0501080_0015538 Ga0501080_0015538_1598_2548 310
207 3300049822 Ga0501035_0004348 Ga0501035_0004348_8641_9591 310
208 3300049823 Ga0501044_0022828 Ga0501044_0022828_1486_2439 310
209 3300049823 Ga0501044_0058782 Ga0501044_0058782_835_1785 310
210 iso_pu_bacteria 2571042365 2572254809 310
211 iso_pu_bacteria 2643221695 2644530542 310
212 3300005547 Ga0070693_100003608 Ga0070693_1000036088 311
213 3300015689 Ga0183360_10001 Ga0183360_100013100 311
214 3300025304 Ga0209257_1000067 Ga0209257_1000067150 311
215 3300027876 Ga0209974_10009501 Ga0209974_100095012 311
216 3300032004 Ga0307414_10038368 Ga0307414_100383683 311
217 3300044712 Ga0453684_0000316 Ga0453684_0000316_27473_28435 311
218 3300045051 Ga0451576_0000128 Ga0451576_0000128_15087_16049 311
219 3300046507 Ga0495606_0011217 Ga0495606_0011217_1436_2374 311
220 3300048924 Ga0496121_0001734 Ga0496121_0001734_12366_13322 311
221 3300048925 Ga0496122_0007321 Ga0496122_0007321_8827_9765 311
222 3300048926 Ga0496123_0004282 Ga0496123_0004282_5316_6254 311
223 3300003771 Ga0055526_1002585 Ga0055526_10025859 312
224 3300003773 Ga0055537_1001212 Ga0055537_10012129 312
225 3300003784 Ga0055534_1000187 Ga0055534_100018728 312
226 3300003790 Ga0055528_1001509 Ga0055528_10015095 312
227 3300005333 Ga0070677_10016633 Ga0070677_100166334 312
228 3300005456 Ga0070678_100219431 Ga0070678_1002194312 312
229 3300025263 Ga0209565_1000472 Ga0209565_10004729 312
230 3300025273 Ga0209673_1000032 Ga0209673_100003296 312
231 3300025291 Ga0209675_1000020 Ga0209675_100002027 312
232 3300025295 Ga0209564_1000210 Ga0209564_100021096 312
233 3300025298 Ga0209050_1034641 Ga0209050_10346412 312
234 3300025304 Ga0209257_1007384 Ga0209257_10073844 312
235 3300030742 Ga0316183_1109882 Ga0316183_11098824 312
236 3300031824 Ga0307413_10003118 Ga0307413_100031185 312
237 3300046522 Ga0495643_0001835 Ga0495643_0001835_626_1609 312
238 3300046660 Ga0495625_0030366 Ga0495625_0030366_930_1913 312
239 3300047320 Ga0495672_0001556 Ga0495672_0001556_5196_6179 312
240 iso_pu_bacteria 2524614729 2525558148 312
241 iso_pu_bacteria 2627854209 2630649951 312
242 iso_pu_bacteria 8002869464 8002871199 312
243 3300003781 Ga0055536_1021204 Ga0055536_10212042 313
244 3300003781 Ga0055536_1021212 Ga0055536_10212122 313
245 3300003792 Ga0055540_1020179 Ga0055540_10201791 313
246 3300003794 Ga0055531_10030254 Ga0055531_100302542 313
247 3300014326 Ga0157380_10061535 Ga0157380_100615353 313
248 3300025284 Ga0209130_1003935 Ga0209130_10039354 313
249 3300025292 Ga0209676_1004753 Ga0209676_10047535 313
250 3300025298 Ga0209050_1001000 Ga0209050_100100016 313
251 3300025304 Ga0209257_1000086 Ga0209257_1000086117 313
252 3300025304 Ga0209257_1013138 Ga0209257_10131385 313
253 3300048920 Ga0496117_0010151 Ga0496117_0010151_5895_6863 313
254 3300048921 Ga0496118_0011435 Ga0496118_0011435_5916_6884 313
255 3300025294 Ga0209025_1038633 Ga0209025_10386332 314
256 3300006051 Ga0075364_10078592 Ga0075364_100785923 316
257 3300009036 Ga0105244_10011834 Ga0105244_100118343 316
258 3300013102 Ga0157371_10002390 Ga0157371_100023903 316
259 3300013104 Ga0157370_10039602 Ga0157370_100396024 316
260 3300013306 Ga0163162_10158055 Ga0163162_101580553 316
261 3300014497 Ga0182008_10000084 Ga0182008_1000008460 316
262 3300015262 Ga0182007_10000060 Ga0182007_1000006057 316
263 3300015265 Ga0182005_1000421 Ga0182005_100042118 316
264 3300030732 Ga0316176_1069808 Ga0316176_10698083 316
265 3300032004 Ga0307414_10006546 Ga0307414_100065462 316
266 3300048921 Ga0496118_0040803 Ga0496118_0040803_205_1173 316
267 3300048922 Ga0496119_0001231 Ga0496119_0001231_20485_21453 316
268 3300048923 Ga0496120_0001157 Ga0496120_0001157_14961_15929 316
269 3300048925 Ga0496122_0020647 Ga0496122_0020647_2465_3433 316
270 3300048926 Ga0496123_0088883 Ga0496123_0088883_67_1035 316
271 3300048927 Ga0496124_0002535 Ga0496124_0002535_5879_6847 316
272 3300048927 Ga0496124_0037510 Ga0496124_0037510_1496_2464 316
273 3300048928 Ga0496125_0012977 Ga0496125_0012977_2498_3466 316
274 3300048928 Ga0496125_0017653 Ga0496125_0017653_705_1673 316
275 3300048929 Ga0496126_0011494 Ga0496126_0011494_5728_6696 316
276 iso_pu_bacteria 2576861471 2578459674 317
277 iso_pu_bacteria 2765235840 2765577632 317
278 iso_pu_bacteria 2816332141 2816519409 317
279 iso_pu_bacteria 2842391507 2842392635 317
280 iso_pu_bacteria 2874220319 2874224489 317
281 iso_pu_bacteria 2919089067 2919091503 317
282 iso_pu_bacteria 2919134579 2919135086 317
283 iso_pu_bacteria 2928496128 2928498834 317
284 iso_pu_bacteria 2931380184 2931382105 317
285 iso_pu_bacteria 2939622612 2939624864 317
286 iso_pu_bacteria 2939626828 2939628791 317
287 iso_pu_bacteria 2941475908 2941477423 317
288 iso_pu_bacteria 2961047084 2961051253 317
289 iso_pu_bacteria 2961064222 2961065540 317
290 3300049762 Ga0501265_000449 Ga0501265_000449_1197_2174 318
291 3300049772 Ga0501275_000051 Ga0501275_000051_8705_9682 318
292 3300032002 Ga0307416_100093172 Ga0307416_1000931723 319
293 3300003771 Ga0055526_1000005 Ga0055526_100000517 320
294 3300003773 Ga0055537_1000884 Ga0055537_100088412 320
295 3300003775 Ga0055524_1000005 Ga0055524_100000517 320
296 3300003784 Ga0055534_1000002 Ga0055534_1000002312 320
297 3300003790 Ga0055528_1000002 Ga0055528_1000002312 320
298 3300005338 Ga0068868_100033060 Ga0068868_1000330604 320
299 3300005578 Ga0068854_100116295 Ga0068854_1001162952 320
300 3300025263 Ga0209565_1000001 Ga0209565_1000001759 320
301 3300025273 Ga0209673_1000001 Ga0209673_1000001759 320
302 3300025291 Ga0209675_1000001 Ga0209675_10000011774 320
303 3300025295 Ga0209564_1000001 Ga0209564_10000011936 320
304 3300025299 Ga0209256_1000006 Ga0209256_1000006372 320
305 iso_pu_bacteria 2895498888 2895499487 320
306 iso_pu_bacteria 2895511927 2895512509 320
307 iso_pu_bacteria 2895522137 2895522520 320
308 iso_pu_bacteria 2895525241 2895525714 320
309 iso_pu_bacteria 2939589442 2939592529 320
310 iso_pu_bacteria 2974307012 2974310115 320
311 iso_pu_bacteria 2977247770 2977250849 320
312 iso_pu_bacteria 2984514374 2984514664 320
313 3300003320 rootH2_10023963 rootH2_100239635 321
314 3300003781 Ga0055536_1004195 Ga0055536_10041954 321
315 3300005347 Ga0070668_100002651 Ga0070668_1000026515 321
316 3300005456 Ga0070678_100016226 Ga0070678_1000162264 321
317 3300005548 Ga0070665_100055054 Ga0070665_1000550542 321
318 3300009036 Ga0105244_10051505 Ga0105244_100515053 321
319 3300009148 Ga0105243_10026351 Ga0105243_100263513 321
320 3300025292 Ga0209676_1000131 Ga0209676_100013190 321
321 3300025298 Ga0209050_1016903 Ga0209050_10169033 321
322 3300025935 Ga0207709_10004817 Ga0207709_100048172 321
323 3300025972 Ga0207668_10010364 Ga0207668_100103643 321
324 3300027312 Ga0209371_1000028 Ga0209371_1000028265 321
325 3300028379 Ga0268266_10058561 Ga0268266_100585613 321
326 3300030500 Ga0268256_1000030 Ga0268256_1000030129 321
327 3300038705 Ga0237819_00853 Ga0237819_00853_1323_2288 321
328 3300038705 Ga0237819_02668 Ga0237819_02668_1078_2046 321
329 3300047472 Ga0495686_0004679 Ga0495686_0004679_616_1581 321
330 iso_pu_bacteria 2987605356 2987608088 321
331 3300009093 Ga0105240_10265689 Ga0105240_102656892 322
332 3300025913 Ga0207695_10017149 Ga0207695_100171494 322
333 3300006051 Ga0075364_10000194 Ga0075364_100001945 323
334 3300050491 nmdc:mga00v17_567_c1 nmdc:mga00v17_567_c1_13908_14897 323
335 3300002773 JGI25152J39213_1000190 JGI25152J39213_100019020 324
336 3300002774 JGI25150J39212_1000138 JGI25150J39212_100013814 324
337 3300003187 JGI25151J46595_10000382 JGI25151J46595_1000038222 324
338 3300003215 JGI25153J46596_10000241 JGI25153J46596_1000024122 324
339 3300025245 Ga0207425_1000040 Ga0207425_100004066 324
340 3300025258 Ga0209129_1000011 Ga0209129_1000011196 324
341 3300025294 Ga0209025_1000002 Ga0209025_1000002601 324
342 3300025297 Ga0209758_1000003 Ga0209758_1000003608 324
343 3300005331 Ga0070670_100002004 Ga0070670_10000200412 329
344 3300049571 Ga0501034_0045151 Ga0501034_0045151_585_1598 330
345 3300042007 Ga0439449_0009607 Ga0439449_0009607_2506_3573 331
346 iso_pu_bacteria 2852684882 2852687661 333
347 3300041452 Ga0451793_1334102 Ga0451793_1334102_2076_3218 336
348 3300041459 Ga0451800_0078018 Ga0451800_0078018_935_2077 336
349 3300041462 Ga0451806_155503 Ga0451806_155503_927_2069 336
350 3300041486 Ga0451807_1239789 Ga0451807_1239789_1999_3141 336
351 iso_pu_bacteria 2995948881 2995949943 340
352 3300003856 Ga0058692_1000032 Ga0058692_10000329 343
353 3300027312 Ga0209371_1000055 Ga0209371_1000055164 343
354 3300030500 Ga0268256_1000054 Ga0268256_100005469 343
355 iso_pu_bacteria 2747842501 2748019244 343
356 3300041407 Ga0439447_001515 Ga0439447_001515_4068_5126 344
357 iso_pu_bacteria 2643221593 2643973038 344
358 iso_pu_bacteria 2818991457 2819662604 344
359 iso_pu_bacteria 2643221573 2643880794 346
360 iso_pu_bacteria 2643221720 2644661363 346
361 iso_pu_bacteria 2643221728 2644699443 346
362 3300009148 Ga0105243_10002762 Ga0105243_100027626 347
363 3300025935 Ga0207709_10002087 Ga0207709_100020878 347
364 3300005548 Ga0070665_100041667 Ga0070665_1000416673 348
365 3300009011 Ga0105251_10000192 Ga0105251_1000019217 348
366 3300025735 Ga0207713_1000374 Ga0207713_100037422 348
367 3300025925 Ga0207650_10009403 Ga0207650_100094033 348
368 3300046616 Ga0495668_0000926 Ga0495668_0000926_19212_20306 348
369 3300048920 Ga0496117_0006937 Ga0496117_0006937_2649_3698 348
370 3300048921 Ga0496118_0048172 Ga0496118_0048172_457_1506 348
371 3300048922 Ga0496119_0001174 Ga0496119_0001174_738_1787 348
372 3300048923 Ga0496120_0000919 Ga0496120_0000919_33099_34148 348
373 3300048925 Ga0496122_0001411 Ga0496122_0001411_12212_13261 348
374 3300048926 Ga0496123_0000868 Ga0496123_0000868_32860_33909 348
375 3300048927 Ga0496124_0001111 Ga0496124_0001111_28325_29374 348
376 iso_pu_bacteria 2919130084 2919132172 348
377 iso_pu_bacteria 2929195423 2929199090 348
378 3300025294 Ga0209025_1000006 Ga0209025_1000006332 349
379 3300005289 Ga0065704_10073882 Ga0065704_100738823 351
380 3300046558 Ga0495633_0018399 Ga0495633_0018399_770_1828 351
381 3300053161 Ga0500634_0000078 Ga0500634_0000078_19143_20201 351
382 iso_pu_bacteria 8003014200 8003015215 353
383 3300003781 Ga0055536_1014937 Ga0055536_10149373 354
384 3300003791 Ga0055530_10004738 Ga0055530_100047385 354
385 3300003794 Ga0055531_10010766 Ga0055531_100107664 354
386 3300025284 Ga0209130_1011387 Ga0209130_10113872 354
387 3300025292 Ga0209676_1004055 Ga0209676_10040552 354
388 3300025292 Ga0209676_1008557 Ga0209676_10085574 354
389 3300025294 Ga0209025_1001895 Ga0209025_100189512 354
390 3300025295 Ga0209564_1007128 Ga0209564_10071282 354
391 3300025298 Ga0209050_1001606 Ga0209050_100160618 354
392 3300025298 Ga0209050_1033802 Ga0209050_10338023 354
393 3300025299 Ga0209256_1012741 Ga0209256_10127413 354
394 3300025303 Ga0209051_1002391 Ga0209051_100239113 354
395 3300025304 Ga0209257_1001869 Ga0209257_10018692 354
396 3300046460 Ga0495638_0020430 Ga0495638_0020430_2227_3321 354
397 3300049579 Ga0501043_0002773 Ga0501043_0002773_13286_14383 355
398 3300025299 Ga0209256_1006182 Ga0209256_10061826 356
399 3300042007 Ga0439449_0006629 Ga0439449_0006629_653_1795 356
400 3300042010 Ga0439452_007597 Ga0439452_007597_2127_3269 356
401 iso_pu_bacteria 8021622325 8021622603 366
402 iso_pu_bacteria 8021626552 8021627547 366
403 iso_pu_bacteria 8021648035 8021650250 366
404 2162886007 SwRhRL2b_contig_2760736 SwRhRL2b_0314.00003980 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

5

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9355 23 318
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9265 19 318
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9202 19 318
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9194 23 318
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.902 19 315
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.982 122 223 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9656 123 223 1.10.150.170
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9626 122 223 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9378 123 223 1.10.150.170
af_F7F172_184_294_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9372 130 223 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A2X3E5Y1-F1-model_v4 rRNA small subunit methyltransferase H (EC 2.1.1.199) 0.9768 130 223 GO:0005737
GO:0070475
GO:0071424
AF-A0A645CKM3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) 0.9698 137 260 GO:0005737
GO:0070475
GO:0071424
AF-B2I9C0-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9631 19 318 GO:0005737
GO:0070475
GO:0071424
AF-A0A091BSF6-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9629 66 324 GO:0005737
GO:0070475
GO:0071424
AF-A0A1G4A299-F1-model_v4 deleted 0.9599 242 317

Feature Viewer

pLDDT pTM Quality
79.55 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map